Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A027805.442ON38738718880.0
SAKL0G02706g5.442ON3323069271e-123
Kwal_55.213995.442ON3293209011e-119
KLLA0E02355g5.442ON3243048981e-119
KLTH0F15884g5.442ON3293048981e-119
ZYRO0F10208g5.442ON3322968691e-115
TBLA0A064805.442ON3343178651e-114
Smik_4.6385.442ON3463048651e-114
YDR372C (VPS74)5.442ON3453048641e-114
Skud_4.6415.442ON3463048641e-114
KNAG0B042005.442ON3443048591e-113
Suva_2.5445.442ON3463048561e-112
Kpol_1016.25.442ON3282968511e-112
CAGL0A02926g5.442ON3282968511e-112
TDEL0D025905.442ON3303118491e-112
NCAS0F034305.442ON3322978471e-111
KAFR0D050605.442ON3263198421e-110
Ecym_45135.442ON3333008391e-110
ACL165C5.442ON3313038371e-110
NDAI0B057205.442ON3652848351e-109
TPHA0J026105.442ON3293088151e-106
Kpol_1062.245.442ON2762777596e-99
NCAS0H020905.442ON3452844864e-57
NCAS0E003703.547ON82882770.55
TPHA0J027905.477ON88277732.0
NCAS0F019302.412ON41541712.5
ZYRO0C12672g3.441ON159578722.9
AAR058W6.324ON53447695.3
Kwal_33.135101.106ON39471679.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A02780
         (387 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   731   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   361   e-123
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   351   e-119
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   350   e-119
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   350   e-119
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   339   e-115
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   337   e-114
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   337   e-114
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   337   e-114
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   337   e-114
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   335   e-113
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   334   e-112
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   332   e-112
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   332   e-112
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   331   e-112
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   330   e-111
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   328   e-110
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   327   e-110
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   327   e-110
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   326   e-109
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   318   e-106
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   296   6e-99
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   191   4e-57
NCAS0E00370 Chr5 complement(60187..62673) [2487 bp, 828 aa] {ON}...    34   0.55 
TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {...    33   2.0  
NCAS0F01930 Chr6 complement(387933..389180) [1248 bp, 415 aa] {O...    32   2.5  
ZYRO0C12672g Chr3 complement(1001096..1005883) [4788 bp, 1595 aa...    32   2.9  
AAR058W Chr1 (445874..447478) [1605 bp, 534 aa] {ON} Syntenic ho...    31   5.3  
Kwal_33.13510 s33 complement(257729..258913) [1185 bp, 394 aa] {...    30   9.3  

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/387 (93%), Positives = 362/387 (93%)

Query: 1   MPSLQHRHIGKYSTISSETYLNHYFDNAEDGDEFSVSTVXXXXXXXXXXXXXXXXXXXXX 60
           MPSLQHRHIGKYSTISSETYLNHYFDNAEDGDEFSVSTV                     
Sbjct: 1   MPSLQHRHIGKYSTISSETYLNHYFDNAEDGDEFSVSTVSSRNNSDINITSNITTSTDSS 60

Query: 61  XXXXHHYIRNDSNFNSHYSLINPNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLK 120
               HHYIRNDSNFNSHYSLINPNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLK
Sbjct: 61  STINHHYIRNDSNFNSHYSLINPNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLK 120

Query: 121 DKQGYLSFWNDNISYVLRGCILIELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGN 180
           DKQGYLSFWNDNISYVLRGCILIELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGN
Sbjct: 121 DKQGYLSFWNDNISYVLRGCILIELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGN 180

Query: 181 HLLDEALNMMAKERPESIMNWIDLLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNT 240
           HLLDEALNMMAKERPESIMNWIDLLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNT
Sbjct: 181 HLLDEALNMMAKERPESIMNWIDLLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNT 240

Query: 241 SNFLFFDMSTHPLVDIGSKESVKQRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICC 300
           SNFLFFDMSTHPLVDIGSKESVKQRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICC
Sbjct: 241 SNFLFFDMSTHPLVDIGSKESVKQRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICC 300

Query: 301 AYGADVLDDTLLTMNYDDSDNAFKKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSEL 360
           AYGADVLDDTLLTMNYDDSDNAFKKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSEL
Sbjct: 301 AYGADVLDDTLLTMNYDDSDNAFKKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSEL 360

Query: 361 LQHSGESLYLEVVAGVLQVILRMDSLL 387
           LQHSGESLYLEVVAGVLQVILRMDSLL
Sbjct: 361 LQHSGESLYLEVVAGVLQVILRMDSLL 387

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  361 bits (927), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 170/306 (55%), Positives = 226/306 (73%), Gaps = 1/306 (0%)

Query: 82  NPNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCI 141
           + N K     +DPEE+       +P L LMEE++L+GLKDK+GYLSFWNDNISY LRGCI
Sbjct: 28  DENAKDRKVAYDPEEAKLKENTTVPKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCI 87

Query: 142 LIELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNW 201
           LIELALR KI+V+DDP R  +DVS R+IEV+   +KTG  LLDEALN++  + P  I NW
Sbjct: 88  LIELALRDKIRVLDDPARKRFDVSDRLIEVI-DGSKTGEVLLDEALNLIKNDEPLPIANW 146

Query: 202 IDLLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKES 261
           IDLLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE+
Sbjct: 147 IDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEA 206

Query: 262 VKQRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDN 321
           +K+R+ S+LV ++  L YN YF EN+TFKIIR+L LIC AYGA+VL++ L +++YD  D 
Sbjct: 207 IKRRVLSVLVSRNMELNYNEYFSENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDR 266

Query: 322 AFKKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVIL 381
           AF +A+++    S+FP  LD+   SG+ V++ K++Q+E+ Q+ G+ L LEVVAGV +V  
Sbjct: 267 AFSRADEILAQFSEFPFALDKATESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFS 326

Query: 382 RMDSLL 387
           RMD+LL
Sbjct: 327 RMDTLL 332

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  351 bits (901), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 232/320 (72%), Gaps = 2/320 (0%)

Query: 69  RNDSNFNSHYSLIN-PNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLS 127
           +++SN++S   +     G+     +DPEE++  +   +P LNLMEE++L+GLKDK+GYLS
Sbjct: 11  KSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLMGLKDKEGYLS 70

Query: 128 FWNDNISYVLRGCILIELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEAL 187
           FWNDNISY LRGCILIELALR KI+V++D  R  +DVS R++EV+   TKTG  LLDEAL
Sbjct: 71  FWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINA-TKTGEVLLDEAL 129

Query: 188 NMMAKERPESIMNWIDLLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFD 247
           N+M  + P +I NWIDLLSGETWN  K + QLK VRER++KGLVDKG+L+    NF  FD
Sbjct: 130 NLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMKNFFLFD 189

Query: 248 MSTHPLVDIGSKESVKQRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVL 307
           M THP+ D   KE++K+RI S+LV ++  L YN YFP +V+FK++R+L LIC AYGA+VL
Sbjct: 190 MPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLICGAYGANVL 249

Query: 308 DDTLLTMNYDDSDNAFKKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGES 367
           ++ L +++Y+  D AF +A+++    S FP  LD++  +G+ V+I K++Q E+  +S   
Sbjct: 250 ENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQEEIDANSDAL 309

Query: 368 LYLEVVAGVLQVILRMDSLL 387
           L LEVVAGV +V  RMD+LL
Sbjct: 310 LRLEVVAGVFEVFSRMDTLL 329

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  350 bits (898), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 222/304 (73%), Gaps = 1/304 (0%)

Query: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143
           N   H   +D +E+   +   +P L LMEE++L+GLKDKQGYLSFWNDNISY LRGCILI
Sbjct: 22  NEHDHKIVYDEQEAKLRDNTSVPKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILI 81

Query: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203
           ELALR KI+ +DDP R  YDVS R+IEV+   +KTG  LLDE+L++M  + P SI+ WID
Sbjct: 82  ELALRGKIRCVDDPARKRYDVSERLIEVI-DGSKTGEVLLDESLSLMKNDPPTSIVGWID 140

Query: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263
           LLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KES+K
Sbjct: 141 LLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIK 200

Query: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323
           +RI SILV +++ L YN YFP++V+FK IR+L LIC AYGA+VL++ L T++Y+  D  F
Sbjct: 201 RRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGF 260

Query: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383
            +A+++    S+FP  LD++  +GV V++ K++  EL  H G  L LEVVAGV +V  RM
Sbjct: 261 ARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRM 320

Query: 384 DSLL 387
           D+LL
Sbjct: 321 DTLL 324

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  350 bits (898), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 164/304 (53%), Positives = 223/304 (73%), Gaps = 1/304 (0%)

Query: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143
           +G+     +DPEE+   ++   P LNLMEE++L+GLKDK+GYLSFWNDNISY LRGCILI
Sbjct: 27  DGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILI 86

Query: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203
           ELALR KI+V++DP R  +DVS R++EV+   TKTG  LLDEALN+M  + P +I NWID
Sbjct: 87  ELALRGKIQVLNDPARKRFDVSERLVEVINA-TKTGEVLLDEALNLMKNDEPLTIANWID 145

Query: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263
           LLSGETWN  K + QLK VRER++KGLVDKG+L+    NF  FDM THP+ D   KE++K
Sbjct: 146 LLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIK 205

Query: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323
           +RI S+LV ++  L YN YFP +V FK+IR+L LIC AYGA+VL++ L +++Y+  D AF
Sbjct: 206 RRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAF 265

Query: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383
            +A+++    S FP  LD++  +G+ V++ K++Q E++ +   SL LE VAGV +V  RM
Sbjct: 266 SRADEILAQFSQFPFALDKQTETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRM 325

Query: 384 DSLL 387
           D+LL
Sbjct: 326 DTLL 329

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  339 bits (869), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 161/296 (54%), Positives = 218/296 (73%), Gaps = 1/296 (0%)

Query: 92  FDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKKI 151
           +DPEE    + + +P L LMEE++LLGL+DK+GYLSFWNDNISY LRGCI+IELALR KI
Sbjct: 38  YDPEEVKLTDNVEVPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKI 97

Query: 152 KVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWIDLLSGETWN 211
           +V+DD  R  +DVS R+IEV    +KTG  LLDEAL +M  + P SI NWIDLLSGETWN
Sbjct: 98  RVVDDSARKRFDVSERLIEVT-DSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWN 156

Query: 212 VFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSILV 271
             K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K+RI S+LV
Sbjct: 157 PLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLV 216

Query: 272 PKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLFE 331
           P++  L YN+YF E V+FK+IR++ LIC AY A+VL++ L ++ Y+  DNA  +A+++ +
Sbjct: 217 PRNLELNYNDYFSERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILK 276

Query: 332 TISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387
             S++P +LD +  SG+ +++ K++  EL QH   +L LEV+AGV +V  RMD LL
Sbjct: 277 QFSEYPFDLDTQTESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  337 bits (865), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 163/317 (51%), Positives = 220/317 (69%), Gaps = 4/317 (1%)

Query: 71  DSNFNSHYSLINPNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWN 130
           DSN N      N   +     +DPEE    N + +P L LMEE+VLLGL+DK+GYLSFWN
Sbjct: 22  DSNDNEP---TNRQAESRRVAYDPEEDKIRNNMSVPQLTLMEEVVLLGLRDKEGYLSFWN 78

Query: 131 DNISYVLRGCILIELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMM 190
           DNISY LRGCI+IELALR KI+++DDP R  +++S R++EVV   +KTG  LLDEAL +M
Sbjct: 79  DNISYALRGCIIIELALRGKIRILDDPARKRFELSERLVEVV-DSSKTGEVLLDEALQIM 137

Query: 191 AKERPESIMNWIDLLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMST 250
             + P +I NW+DLLSGETWNVFK N QLK VRER+SKGLVDKG+L+    NF  FDM+T
Sbjct: 138 RNDEPLAISNWVDLLSGETWNVFKINYQLKQVRERISKGLVDKGVLRTEMKNFFLFDMAT 197

Query: 251 HPLVDIGSKESVKQRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDT 310
           HP+ D   KE++K+RI SILV + +   YN+YFPE  +FK IR++ LIC AYGA+VL++ 
Sbjct: 198 HPVTDSSCKEAIKRRILSILVNRTAEFTYNDYFPETTSFKYIRTISLICSAYGANVLENV 257

Query: 311 LLTMNYDDSDNAFKKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYL 370
           L ++ Y   DN   +AE+L E  S +P +L+++   G  +++   ++ E+      +L+L
Sbjct: 258 LNSLEYQKRDNGLNRAEELLEQFSQYPFDLEKQTEFGTSINLNALVKEEIEADPKNALFL 317

Query: 371 EVVAGVLQVILRMDSLL 387
           EVVAGV +V  +MD LL
Sbjct: 318 EVVAGVFEVFSKMDLLL 334

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  337 bits (865), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 157/304 (51%), Positives = 219/304 (72%), Gaps = 1/304 (0%)

Query: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143
           NG +    +DPEES   + I +P L LMEE++L+GL+D++GYLSFWND+ISY LRGCI+I
Sbjct: 44  NGTNKKIAYDPEESKLRDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIII 103

Query: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203
           ELALR KI+++DD  R  +D+S R+IEV+   +KTG  LLDE L +M  + P +I NWID
Sbjct: 104 ELALRGKIRILDDSARKRFDLSERLIEVI-DGSKTGEVLLDETLQLMKNDEPLTISNWID 162

Query: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263
           LLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K
Sbjct: 163 LLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIK 222

Query: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323
           +R+ S+LV ++  L YN YFPE  +FKIIR+L LIC +YGA+VL++ L T+ Y+  D A 
Sbjct: 223 RRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAI 282

Query: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383
            +AE++    S FP +L++    G+ V++ K+++ E+  + G +L LEV+AGV +V  RM
Sbjct: 283 SRAEEIMAQFSQFPFDLEKETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRM 342

Query: 384 DSLL 387
           D LL
Sbjct: 343 DMLL 346

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  337 bits (864), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 158/304 (51%), Positives = 218/304 (71%), Gaps = 1/304 (0%)

Query: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143
           NG +    +DPEES   + I +P L LMEE++L+GL+D++GYLSFWND+ISY LRGCI+I
Sbjct: 43  NGTNKKIAYDPEESKLRDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIII 102

Query: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203
           ELALR KI+++DD  R  +D+S R+IEV+   +KTG  LLDE L +M  + P SI NWID
Sbjct: 103 ELALRGKIRILDDSARKRFDLSERLIEVI-DSSKTGEVLLDETLQLMKNDEPLSISNWID 161

Query: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263
           LLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K
Sbjct: 162 LLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIK 221

Query: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323
           +R+ S+LV ++  L YN YFPE  +FKIIR+L LIC +YGA+VL++ L T+ Y+  D A 
Sbjct: 222 RRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAI 281

Query: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383
            +AE++    S +P +L++    GV V++ K+++ E+  + G  L LEV+AGV +V  RM
Sbjct: 282 SRAEEIMAQFSQYPFDLEKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRM 341

Query: 384 DSLL 387
           D LL
Sbjct: 342 DMLL 345

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  337 bits (864), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 157/304 (51%), Positives = 219/304 (72%), Gaps = 1/304 (0%)

Query: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143
           +G +    +DPEES   + I +P L LMEE++L+GL+D++GYLSFWND+ISY LRGCILI
Sbjct: 44  SGANKKIAYDPEESKLRDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILI 103

Query: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203
           ELALR KI+++DD  R  +D+S R++EVV   +KTG  LLDE L +M  + P +I NWID
Sbjct: 104 ELALRGKIRILDDSARKRFDLSERLVEVV-DGSKTGEVLLDETLQLMKNDEPLTISNWID 162

Query: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263
           LLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K
Sbjct: 163 LLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIK 222

Query: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323
           +R+ S+LV ++  L YN YFPE  +FKIIR+L LIC +YGA+VL++ L T+ Y+  D A 
Sbjct: 223 RRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAI 282

Query: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383
            +AE++    S +P +L++    GV V++ K+++ E+  ++G  L LEV+AGV +V  RM
Sbjct: 283 NRAEEIMAQFSQYPFDLEKETELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRM 342

Query: 384 DSLL 387
           D LL
Sbjct: 343 DMLL 346

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  335 bits (859), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 153/304 (50%), Positives = 218/304 (71%), Gaps = 1/304 (0%)

Query: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143
           +G      +DPEE+   +   +P L LMEE++L+GL+D++GYLSFWNDNISY LRGCI+I
Sbjct: 42  SGPTRKVAYDPEEAKLRDNYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMI 101

Query: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203
           ELALRKKI+++DD  R  +D+S R++EVV   +KTG  LLDE L +M  + P +I NWID
Sbjct: 102 ELALRKKIRILDDSARKRFDISERLVEVV-DGSKTGEVLLDETLQLMKNDEPLTIANWID 160

Query: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263
           LLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K
Sbjct: 161 LLSGETWNLMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIK 220

Query: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323
           +RI S +V ++  L +N+YFPE+ +FK IR++ L+C  YGA VL++ L +++Y+  D A 
Sbjct: 221 RRILSTVVSRNMELSFNSYFPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAV 280

Query: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383
            +AE+L E    +P +L+++  SG+  ++ K+ Q E+ +    +LYLEVVAGV++V  RM
Sbjct: 281 SRAEELLEKFGQYPFDLEKQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRM 340

Query: 384 DSLL 387
           D LL
Sbjct: 341 DMLL 344

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  334 bits (856), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 157/304 (51%), Positives = 218/304 (71%), Gaps = 1/304 (0%)

Query: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143
           NG +    +DPEES   + I +P L LMEE++L+GL+D++GYLSFWND+ISY LRGCILI
Sbjct: 44  NGINKKIAYDPEESKLRDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILI 103

Query: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203
           ELALR KI+++DD  R  +D+S R++EV+   +KTG  LLDE L +M  + P +I NWID
Sbjct: 104 ELALRGKIRILDDSARKRFDLSERLVEVI-DGSKTGEVLLDETLQLMKNDEPLTISNWID 162

Query: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263
           LLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K
Sbjct: 163 LLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIK 222

Query: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323
           +R+ S+LV ++  L YN YFPE  +FKIIR+L LIC +YGA+VL++ L T+ Y+  D A 
Sbjct: 223 RRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAI 282

Query: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383
            +AE++    S +P +L++    GV V++ K+++ E+  + G  L LEV+AGV +V  RM
Sbjct: 283 SRAEEIMSHFSQYPFDLEKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRM 342

Query: 384 DSLL 387
           D LL
Sbjct: 343 DMLL 346

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  332 bits (851), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 209/296 (70%), Gaps = 1/296 (0%)

Query: 92  FDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKKI 151
           +DPEE+   +++ +P L LMEE+VLLGL DK GYLSFWNDNISY LRGCI+IELALR KI
Sbjct: 34  YDPEEAKLKDDVTVPTLTLMEEVVLLGLGDKDGYLSFWNDNISYTLRGCIIIELALRNKI 93

Query: 152 KVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWIDLLSGETWN 211
           +++DDP R  +D+S R++EVV   +KTG  LLDEAL +M  + P SI NWIDLLSGETWN
Sbjct: 94  RILDDPARKRFDLSERLVEVVDG-SKTGEVLLDEALQLMKNDEPLSIANWIDLLSGETWN 152

Query: 212 VFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSILV 271
            FK N QLK VRER+SKGLVDKG+L+    NF  FDM+THP+ D   KE++K+RI S LV
Sbjct: 153 FFKINYQLKQVRERISKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALV 212

Query: 272 PKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLFE 331
            +   L YN YFPE   +K+IR++ LIC +Y A+VL++ L ++ Y+  DNA  ++E +  
Sbjct: 213 SRTMELNYNEYFPETTQYKVIRTIALICSSYAANVLENVLSSLEYEKRDNAIARSESILS 272

Query: 332 TISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387
             + +P  LD+     V +++ K ++ E+ Q+ G +L LE VAGV  V  +MD +L
Sbjct: 273 EFAQYPFKLDKASDIKVSINLSKLVEDEIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  332 bits (851), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 156/296 (52%), Positives = 213/296 (71%), Gaps = 1/296 (0%)

Query: 92  FDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKKI 151
           +DPEES   N+   P L LMEE++L+GL+D++GYLSFWND+ISY LRGCILIELALR KI
Sbjct: 34  YDPEESKLQNDSKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKI 93

Query: 152 KVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWIDLLSGETWN 211
           +++D P R  +D+S R+IEV+   +KTG  LLDE L +M  + P SI NWIDLLSGETWN
Sbjct: 94  RILDAPARMRFDISERLIEVI-DSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWN 152

Query: 212 VFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSILV 271
           + K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K+RI S+LV
Sbjct: 153 LLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLV 212

Query: 272 PKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLFE 331
            ++  + YN+YFPE+  FK+IR++ LI  AYGA+VL++ + ++ YD  D A  +AE++  
Sbjct: 213 SRNMEISYNSYFPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILA 272

Query: 332 TISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387
             S +P +L +    G+ V++ K+LQ EL  + G  L LEV+AGV +V  RMD LL
Sbjct: 273 QFSQYPFDLQKESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  331 bits (849), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 217/311 (69%), Gaps = 1/311 (0%)

Query: 77  HYSLINPNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYV 136
             S  N         +DPEE+     +  P L LMEE++LLGL+DK+GYLSFWNDNISY 
Sbjct: 21  QASEFNETTTSKRVAYDPEEAKITENVKNPKLTLMEEVLLLGLRDKEGYLSFWNDNISYA 80

Query: 137 LRGCILIELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPE 196
           LRGCI+IELALR KI++IDD  R  +DVS R+IEVV   +KTG  LLDE L +M  + P 
Sbjct: 81  LRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVV-DASKTGEVLLDETLQLMKYDEPL 139

Query: 197 SIMNWIDLLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDI 256
           +I NWIDLLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D 
Sbjct: 140 TIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDT 199

Query: 257 GSKESVKQRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNY 316
             KE++K+R+ S+LV ++  L YN YFP+  +FK+IR++ LIC +Y A+VL++ L +++Y
Sbjct: 200 SCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIALICGSYRANVLENVLTSLDY 259

Query: 317 DDSDNAFKKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGV 376
           +  D A  +A+++ E  + +P +LD+   SG+ +++ K+++ EL Q+    L LEVVAGV
Sbjct: 260 EKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVKEELSQNKDCPLQLEVVAGV 319

Query: 377 LQVILRMDSLL 387
            +V  RMD LL
Sbjct: 320 FEVFSRMDMLL 330

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  330 bits (847), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 158/297 (53%), Positives = 218/297 (73%), Gaps = 2/297 (0%)

Query: 92  FDPEES-ISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKK 150
           +DPEE+ + N    +P L LMEE++L+GL+DK+GYLSFWNDNISY LRGCILIELALR K
Sbjct: 37  YDPEEARMRNVGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGK 96

Query: 151 IKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWIDLLSGETW 210
           I+++DD  R  +++S R+++V+   TKTG  LLDE L +M  + P SI +WIDLLSGETW
Sbjct: 97  IQILDDSARKRFELSERLVQVI-DGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETW 155

Query: 211 NVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSIL 270
           N+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K+R+ SIL
Sbjct: 156 NIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSIL 215

Query: 271 VPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLF 330
           V ++  L YNNYFPE   FKIIR++ LIC AYGA+VL++ L +++++ SDNA  +A++L 
Sbjct: 216 VSRNMELSYNNYFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELI 275

Query: 331 ETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387
              S FP +L+     G+ V++ +++Q EL    G  L LEV+AGV++V  RMD+LL
Sbjct: 276 AQFSKFPFDLETPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  328 bits (842), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 226/319 (70%), Gaps = 3/319 (0%)

Query: 69  RNDSNFNSHYSLINPNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSF 128
           R+DSN +   ++     +     +DPEE+   + + +P L LMEE++L+GL+D++GYLSF
Sbjct: 11  RSDSNADDSENV--SESQDRKVAYDPEEAKLRDNVSIPKLTLMEEVLLMGLRDREGYLSF 68

Query: 129 WNDNISYVLRGCILIELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALN 188
           WNDNISY LRGCILIELALR KI+++DD  R  +DVS R++EV+   +KTG  LLDEAL 
Sbjct: 69  WNDNISYALRGCILIELALRNKIRILDDSARKRFDVSERLVEVI-DGSKTGEVLLDEALQ 127

Query: 189 MMAKERPESIMNWIDLLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDM 248
           +M  + P +I NWIDLLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM
Sbjct: 128 LMKNDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDM 187

Query: 249 STHPLVDIGSKESVKQRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLD 308
           +THP+ D   KE++K+RI S LV ++  L YN+YF E  +FK IR + L+CC+YGA+VL+
Sbjct: 188 ATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYFAETTSFKYIRIVALVCCSYGANVLE 247

Query: 309 DTLLTMNYDDSDNAFKKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESL 368
           + L +++Y+  D A  +AE++    + +P +L +    G+ V++ K++++E+ ++   +L
Sbjct: 248 NVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSKNTELGISVNLNKEVENEVNENPQFTL 307

Query: 369 YLEVVAGVLQVILRMDSLL 387
            LEV+AGV++V  RMD LL
Sbjct: 308 QLEVIAGVIEVFSRMDMLL 326

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  327 bits (839), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 152/300 (50%), Positives = 213/300 (71%), Gaps = 1/300 (0%)

Query: 88  HLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELAL 147
           H   +DPE+         P L LMEE++L+GLKDK+GYLSFWND+ISY LRGCILIELAL
Sbjct: 35  HKVAYDPEDQKLRENTKEPTLTLMEEVLLMGLKDKEGYLSFWNDSISYSLRGCILIELAL 94

Query: 148 RKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWIDLLSG 207
           R KI+V++D  R  +D+S R++EV+   +KTG  LLDE L++M    P SI+NWIDLLSG
Sbjct: 95  RGKIRVVEDAARKRFDLSERLVEVI-ETSKTGEALLDETLSLMKSNEPLSIVNWIDLLSG 153

Query: 208 ETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIF 267
           ETWN+ K + QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KES+K+R+ 
Sbjct: 154 ETWNLLKISYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVADSSCKESIKRRML 213

Query: 268 SILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAE 327
           S+LVP++  L Y  YFPE+V FK +R++ LIC AYGA+VL++ L +++Y+  +  F +AE
Sbjct: 214 SVLVPRNVSLDYTEYFPESVAFKYLRTIALICGAYGANVLENVLSSLDYEKRERGFSRAE 273

Query: 328 KLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387
           ++    S +P  LD+   +G+ V++   ++ E+ ++ G  L LEVVAGV +V  RMD+ L
Sbjct: 274 EILTQFSQYPFALDKDVETGISVNLYNQVKEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  327 bits (837), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 160/303 (52%), Positives = 211/303 (69%), Gaps = 1/303 (0%)

Query: 85  GKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIE 144
           G  H   +DPEE         P L LMEE++L+GLKDK+GYLSF N+NISY LRGCILIE
Sbjct: 30  GMTHKVAYDPEEQKLRENTREPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIE 89

Query: 145 LALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWIDL 204
           LALR +I+V+DD +R  +D S R+IEVV   +KTG  LLDEAL +M    P +I+NW+DL
Sbjct: 90  LALRGRIQVVDDAMRRRFDPSERLIEVV-DGSKTGEALLDEALTLMKGSEPLTIVNWMDL 148

Query: 205 LSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQ 264
           LSGETWN  K N QL+ VRER++KGLVDKG+L+    NF  FDM THP+ D   KES+K+
Sbjct: 149 LSGETWNFLKINYQLRQVRERLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKR 208

Query: 265 RIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFK 324
           RI S+LVP++  L Y   FPE V FK +R++ LIC A+GA+VL+  L T++Y+  D  F 
Sbjct: 209 RILSVLVPRNVELQYTELFPETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFS 268

Query: 325 KAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMD 384
           +AE+L    S +P  LD+   +G+ V++ + +Q EL ++ G +L LEVVAGVL+V  RMD
Sbjct: 269 RAEELLVQFSQYPFALDKDIETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMD 328

Query: 385 SLL 387
            LL
Sbjct: 329 DLL 331

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  326 bits (835), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 153/284 (53%), Positives = 210/284 (73%), Gaps = 1/284 (0%)

Query: 104 ILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKKIKVIDDPVRNMYD 163
           + P L LMEE++L+GL+DK+GYLSFWNDNISY LRGCILIELALR KI+++DD  R  +D
Sbjct: 83  VTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIRILDDSARKRFD 142

Query: 164 VSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWIDLLSGETWNVFKNNLQLKNVR 223
           +S R+IEV    +KTG  LLDE L +M  + P +I NWIDLLSGETWN+ K N QLK VR
Sbjct: 143 LSERLIEV-KDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNIMKINYQLKQVR 201

Query: 224 ERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSILVPKHSYLLYNNYF 283
           ER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K+R+ S+LV ++    YN YF
Sbjct: 202 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSVLVSRNMEFNYNEYF 261

Query: 284 PENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLFETISDFPINLDQR 343
           P+N  FKIIR++ LIC AYGA+VL++ L +++Y+ SDNA  +A++L    S FP +L++ 
Sbjct: 262 PQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNAIARADELIAQFSKFPFDLEKT 321

Query: 344 EGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387
             + V V++ + +Q EL ++ G  L LEV+AGV++V  RMD+LL
Sbjct: 322 TNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSRMDTLL 365

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  318 bits (815), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 156/308 (50%), Positives = 214/308 (69%), Gaps = 3/308 (0%)

Query: 82  NPNGKHHLTK--FDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRG 139
           N   + +++K  FDPEE+   +++ +P L LMEE+VLLGL D +GYLSFWNDNISYVLRG
Sbjct: 23  NDQSRSNVSKVAFDPEEAKIKDDVSVPKLTLMEEVVLLGLGDSEGYLSFWNDNISYVLRG 82

Query: 140 CILIELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIM 199
           CILIELALR KI++IDD  R  +D+S R+IEV+   +KTG  LLDE L +M  + P+SI+
Sbjct: 83  CILIELALRGKIRIIDDSARKSFDLSERLIEVI-DASKTGEVLLDETLQLMKNDEPQSIV 141

Query: 200 NWIDLLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSK 259
           +WIDLLSGETWN FK N QLK VRER+SKGLVDKG+L+    NF  FDM+THP+ D   K
Sbjct: 142 SWIDLLSGETWNFFKVNYQLKQVRERLSKGLVDKGVLRTEMKNFFLFDMATHPVADSSCK 201

Query: 260 ESVKQRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDS 319
           ES+K+RI S LV +   L YN YFPE+ TFK+IR++ LI  AY A+VL++ L T+ Y+  
Sbjct: 202 ESLKRRIMSTLVDRTLSLQYNEYFPESTTFKVIRTVSLIITAYSANVLENVLNTLEYEKR 261

Query: 320 DNAFKKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQV 379
           D A  +AE L     ++P  L     + + +++ + ++ E+  +   +L LEV+AGV  V
Sbjct: 262 DKALSRAENLLNNFGNYPFKLVNEPDNRISINLNQLVEDEIKANPKTALQLEVLAGVFDV 321

Query: 380 ILRMDSLL 387
             +MD ++
Sbjct: 322 FAKMDVII 329

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  296 bits (759), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 139/277 (50%), Positives = 195/277 (70%), Gaps = 1/277 (0%)

Query: 111 MEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKKIKVIDDPVRNMYDVSARIIE 170
           MEE+VLLG++DK+GYLSFWN+N+S+VLRGCILIELA R  I+VIDDP R  +D+S R+IE
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 171 VVMPITKTGNHLLDEALNMMAKERPESIMNWIDLLSGETWNVFKNNLQLKNVRERVSKGL 230
           VV P  KTG  LLDE L MM  E  +SI  WIDLLSGETWN+FK NLQLK VRER+SKGL
Sbjct: 61  VVNP-KKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGL 119

Query: 231 VDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSILVPKHSYLLYNNYFPENVTFK 290
           VDKGIL+    NF  FDM+THP+ D+  KE +K+RI S+L+P+ + +L + YFPE V  +
Sbjct: 120 VDKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLR 179

Query: 291 IIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLFETISDFPINLDQREGSGVPV 350
            +R++ LI  AY   VL++    ++Y   D+ F +  ++ +  S +P   D +  + +  
Sbjct: 180 CLRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIAT 239

Query: 351 DIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387
           ++ + +++EL +    +L LE +AGV +V L+MDS++
Sbjct: 240 NLNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  191 bits (486), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 168/284 (59%), Gaps = 8/284 (2%)

Query: 106 PPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKKIKVIDDPVRNMYDVS 165
           P L LM+E+ LL LKDK+GY+S W+  +SYVLR C++IELALR KI+ + +  +   D++
Sbjct: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEG-KKKKDLA 121

Query: 166 ARIIEV-VMPITKTGNHLLDEALNMMAKERPE-SIMNWIDLLSGETWNVFKNNLQLKNVR 223
               ++ V+  + TG+ LLD+ L +M KE+   S+ +WI LLSGE+ N  K + QL +VR
Sbjct: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181

Query: 224 ERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSILVPKHSYLLYNNYF 283
           +R+ + LV+ GIL   T       + THP+ DI  K +++ R+  IL      L    YF
Sbjct: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241

Query: 284 PENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLFETISDFPINLDQR 343
           P+ V+++++R++ L C AYGAD+LD        +++     +A  L    S FP  L+Q 
Sbjct: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTE-NETVIGKGRARVLLSLFSKFPFELNQ- 299

Query: 344 EGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387
               V  D+ + +  EL +H  E+  LEVVAG + VI  +D++L
Sbjct: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>NCAS0E00370 Chr5 complement(60187..62673) [2487 bp, 828 aa] {ON}
           Anc_3.547
          Length = 828

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 69  RNDSNFNSH--YSLINPNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYL 126
           R D ++NS   YSL N        K D   + SNN+I+L   N+ ++ +LLG +    + 
Sbjct: 643 RMDFSYNSFIVYSLFNLEKASQFKKTDSNAN-SNNQILLGNFNITKDFILLGYQKSYEFY 701

Query: 127 SFWNDNISYVLRGCILIELALR 148
             W  N+ Y+    ++ E  ++
Sbjct: 702 EKWKTNLGYMGHLVLIAEEVVK 723

>TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {ON}
           Anc_5.477 YOR141C
          Length = 882

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 219 LKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGS---KESVKQRIFSILVPKHS 275
           LKNV    +  L+D+ ILKNN  N +F D +T  ++  GS   K    +    +++P   
Sbjct: 239 LKNVNSESNVSLIDETILKNNPDNIVFDDPTTTIVIHPGSRYLKIGFAKDDSPLVIPNCV 298

Query: 276 YLLYNNYFPENVTFKII 292
               N+ + ENV   I+
Sbjct: 299 AFPKNSLYSENVEETIV 315

>NCAS0F01930 Chr6 complement(387933..389180) [1248 bp, 415 aa] {ON}
           Anc_2.412 YMR126C
          Length = 415

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 315 NYDDSDNAFKKAEKLFETISDFPINLDQREGSGVPVDIIKD 355
           N  DS+N   K+  LF+  S F +  D+ +G+G   D IKD
Sbjct: 261 NSPDSENQNNKSSPLFKKFSSFSMGADKNKGTGYSPDYIKD 301

>ZYRO0C12672g Chr3 complement(1001096..1005883) [4788 bp, 1595 aa]
            {ON} similar to uniprot|Q03018 Saccharomyces cerevisiae
            YGR098C ESP1 Separase with cysteine protease activity
            (related to caspases) that promotes sister chromatid
            separation by mediating dissociation of the cohesin Scc1p
            from chromatin inhibited by Pds1p
          Length = 1595

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 7/78 (8%)

Query: 66   HYIRNDSNFNSHYSLINPNGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQ-- 123
            H+++++ N +   S + P GKH   KFD   +I+N E +      +EEI L  LK+ +  
Sbjct: 985  HHLKSNVNASPRSSSMTPRGKHMRQKFDRAAAINNLETL---KKFIEEIELEPLKNHELS 1041

Query: 124  GYLSFWNDNISYVLRGCI 141
               SF++  +S  L  CI
Sbjct: 1042 QLASFYSLTLS--LLSCI 1057

>AAR058W Chr1 (445874..447478) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR054C (CTR86)
          Length = 534

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 233 KGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSILVPKHSYLLY 279
           +G++KN+T  F   D  TH L ++ S  +++  I+S LV   S+  Y
Sbjct: 210 QGVIKNHTELFDVIDNKTHDLENLSSLGAIQMSIWSCLVTHASFSPY 256

>Kwal_33.13510 s33 complement(257729..258913) [1185 bp, 394 aa] {ON}
           YNL254C - Hypothetical ORF [contig 116] FULL
          Length = 394

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 274 HSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLFETI 333
           H Y L    F E +  K  + L L+      D+L     ++ YD +  A+KK++K   ++
Sbjct: 199 HQYKLPPVLFAEQLVTKARKHLPLV-----EDILCGKHTSLYYDHARKAYKKSQKAVLSV 253

Query: 334 SDFPINLDQRE 344
            +F  NLD RE
Sbjct: 254 DEF-RNLDLRE 263

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,557,102
Number of extensions: 1942250
Number of successful extensions: 6043
Number of sequences better than 10.0: 43
Number of HSP's gapped: 6222
Number of HSP's successfully gapped: 43
Length of query: 387
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 276
Effective length of database: 40,753,473
Effective search space: 11247958548
Effective search space used: 11247958548
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)