Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A025505.474ON57857828620.0
TDEL0A033805.474ON55955510961e-143
Skud_15.3015.474ON6255979791e-124
YOR137C (SIA1)5.474ON6225939781e-124
Smik_15.3175.474ON6266089341e-118
NCAS0H022605.474ON5705759241e-117
Suva_8.1895.474ON6265929141e-115
SAKL0G03542g5.474ON5745538771e-110
NDAI0C014005.474ON7056048221e-100
Kwal_55.212685.474ON5685627964e-98
KLTH0F15026g5.474ON5745697591e-92
KLLA0E03147g5.474ON5785815303e-59
Ecym_24554.200ON5722892606e-23
Skud_12.4454.200ON5812952454e-21
NCAS0J012204.200ON5832982438e-21
KLLA0B13134g4.200ON5653042438e-21
ZYRO0B07898g4.200ON5833122392e-20
YLR361C (DCR2)4.200ON5783042384e-20
KNAG0B058604.200ON5853252374e-20
Kpol_472.154.200ON5293002347e-20
Smik_12.4484.200ON5803292358e-20
SAKL0B05038g4.200ON5903122331e-19
NDAI0J019704.200ON5893002285e-19
TDEL0E017304.200ON5743092251e-18
KAFR0A062104.200ON5812982214e-18
TBLA0D020204.200ON6433112224e-18
Suva_10.4624.200ON5812982189e-18
CAGL0B02761g4.200ON5783112171e-17
KLTH0E10824g4.200ON5804182152e-17
Kwal_55.203334.200ON5772952082e-16
ABL009W4.200ON5692971964e-15
TPHA0F011004.200ON5582921868e-14
YAL010C (MDM10)7.103ON49365840.12
Smik_1.577.103ON49365732.7
KLTH0G07128g5.267ON186255723.9
TBLA0A060506.241ON85339724.3
ZYRO0G15796g8.753ON165149715.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A02550
         (578 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A02550 Chr1 (616882..618618) [1737 bp, 578 aa] {ON} Anc_5.4...  1107   0.0  
TDEL0A03380 Chr1 complement(601033..602712) [1680 bp, 559 aa] {O...   426   e-143
Skud_15.301 Chr15 complement(535844..537721) [1878 bp, 625 aa] {...   381   e-124
YOR137C Chr15 complement(581813..583681) [1869 bp, 622 aa] {ON} ...   381   e-124
Smik_15.317 Chr15 complement(543212..545092) [1881 bp, 626 aa] {...   364   e-118
NCAS0H02260 Chr8 complement(443026..444738) [1713 bp, 570 aa] {O...   360   e-117
Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON...   356   e-115
SAKL0G03542g Chr7 complement(292214..293938) [1725 bp, 574 aa] {...   342   e-110
NDAI0C01400 Chr3 (292788..294905) [2118 bp, 705 aa] {ON} Anc_5.474    321   e-100
Kwal_55.21268 s55 (759935..761641) [1707 bp, 568 aa] {ON} YOR137...   311   4e-98
KLTH0F15026g Chr6 (1230760..1232484) [1725 bp, 574 aa] {ON} simi...   296   1e-92
KLLA0E03147g Chr5 complement(290622..292358) [1737 bp, 578 aa] {...   208   3e-59
Ecym_2455 Chr2 complement(885426..887144) [1719 bp, 572 aa] {ON}...   104   6e-23
Skud_12.445 Chr12 complement(787532..789277) [1746 bp, 581 aa] {...    99   4e-21
NCAS0J01220 Chr10 complement(212622..214373) [1752 bp, 583 aa] {...    98   8e-21
KLLA0B13134g Chr2 (1149114..1150811) [1698 bp, 565 aa] {ON} simi...    98   8e-21
ZYRO0B07898g Chr2 (616796..618547) [1752 bp, 583 aa] {ON} simila...    97   2e-20
YLR361C Chr12 complement(847388..849124) [1737 bp, 578 aa] {ON} ...    96   4e-20
KNAG0B05860 Chr2 complement(1152991..1154748) [1758 bp, 585 aa] ...    96   4e-20
Kpol_472.15 s472 (43361..44950) [1590 bp, 529 aa] {ON} (43361..4...    95   7e-20
Smik_12.448 Chr12 complement(786446..788188) [1743 bp, 580 aa] {...    95   8e-20
SAKL0B05038g Chr2 complement(434061..435833) [1773 bp, 590 aa] {...    94   1e-19
NDAI0J01970 Chr10 complement(488882..490651) [1770 bp, 589 aa] {...    92   5e-19
TDEL0E01730 Chr5 (333362..335086) [1725 bp, 574 aa] {ON} Anc_4.2...    91   1e-18
KAFR0A06210 Chr1 (1254374..1256119) [1746 bp, 581 aa] {ON} Anc_4...    90   4e-18
TBLA0D02020 Chr4 (503782..505713) [1932 bp, 643 aa] {ON} Anc_4.2...    90   4e-18
Suva_10.462 Chr10 complement(807033..808778) [1746 bp, 581 aa] {...    89   9e-18
CAGL0B02761g Chr2 (265971..267707) [1737 bp, 578 aa] {ON} simila...    88   1e-17
KLTH0E10824g Chr5 (973337..975079) [1743 bp, 580 aa] {ON} simila...    87   2e-17
Kwal_55.20333 s55 (355985..357718) [1734 bp, 577 aa] {ON} YLR361...    85   2e-16
ABL009W Chr2 (381100..382809) [1710 bp, 569 aa] {ON} Syntenic ho...    80   4e-15
TPHA0F01100 Chr6 complement(249205..250881) [1677 bp, 558 aa] {O...    76   8e-14
YAL010C Chr1 complement(134184..135665) [1482 bp, 493 aa] {ON}  ...    37   0.12 
Smik_1.57 Chr1 complement(117182..118663) [1482 bp, 493 aa] {ON}...    33   2.7  
KLTH0G07128g Chr7 complement(569563..575151) [5589 bp, 1862 aa] ...    32   3.9  
TBLA0A06050 Chr1 (1490547..1493108) [2562 bp, 853 aa] {ON} Anc_6...    32   4.3  
ZYRO0G15796g Chr7 (1290889..1290948,1291032..1295927) [4956 bp, ...    32   5.6  

>TBLA0A02550 Chr1 (616882..618618) [1737 bp, 578 aa] {ON} Anc_5.474
           YOR137C
          Length = 578

 Score = 1107 bits (2862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/578 (93%), Positives = 539/578 (93%)

Query: 1   MVPQRXXXXXXXXXXXXXXXXXXCIAWSRLRLFFLNVKSQPNAVEYNGGLIDDIKLMKCY 60
           MVPQR                  CIAWSRLRLFFLNVKSQPNAVEYNGGLIDDIKLMKCY
Sbjct: 1   MVPQRKLLKVFKKTTYLTTFLLLCIAWSRLRLFFLNVKSQPNAVEYNGGLIDDIKLMKCY 60

Query: 61  RWYKNCETLYAQSAVHDNSFVLWNRVSKNMTDSSLYAIESNWLYETFFYVHLFNTNANKE 120
           RWYKNCETLYAQSAVHDNSFVLWNRVSKNMTDSSLYAIESNWLYETFFYVHLFNTNANKE
Sbjct: 61  RWYKNCETLYAQSAVHDNSFVLWNRVSKNMTDSSLYAIESNWLYETFFYVHLFNTNANKE 120

Query: 121 DEKQPLADIAVSRDPSLVPLTVLQEVMPSLRSSDSMMGNKRLYYQKTSWWYRFWNNPLPT 180
           DEKQPLADIAVSRDPSLVPLTVLQEVMPSLRSSDSMMGNKRLYYQKTSWWYRFWNNPLPT
Sbjct: 121 DEKQPLADIAVSRDPSLVPLTVLQEVMPSLRSSDSMMGNKRLYYQKTSWWYRFWNNPLPT 180

Query: 181 KMNLMNKWKHNNDILWSKIQHDSCLITNIQLYLGSNFVESRPFWKEIIHELHNEDGNSIP 240
           KMNLMNKWKHNNDILWSKIQHDSCLITNIQLYLGSNFVESRPFWKEIIHELHNEDGNSIP
Sbjct: 181 KMNLMNKWKHNNDILWSKIQHDSCLITNIQLYLGSNFVESRPFWKEIIHELHNEDGNSIP 240

Query: 241 ISITRKVECGFDANHTFPKNTXXXXXXXXXXXXXXXXXXXXXDIHIKGNEENSAILGEFQ 300
           ISITRKVECGFDANHTFPKNT                     DIHIKGNEENSAILGEFQ
Sbjct: 241 ISITRKVECGFDANHTFPKNTINNKDLLQLKQKSDLKILQLSDIHIKGNEENSAILGEFQ 300

Query: 301 SRIFISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPIIRAQIPFVISFGAKDFS 360
           SRIFISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPIIRAQIPFVISFGAKDFS
Sbjct: 301 SRIFISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPIIRAQIPFVISFGAKDFS 360

Query: 361 KYATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKDDYSNLITQNDLAIFIF 420
           KYATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKDDYSNLITQNDLAIFIF
Sbjct: 361 KYATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKDDYSNLITQNDLAIFIF 420

Query: 421 NSKTSKRQFFKDYISLYKSPPKLALAFQYLPIPTYRLSGVFPIIGQYNERNLLPEGFDND 480
           NSKTSKRQFFKDYISLYKSPPKLALAFQYLPIPTYRLSGVFPIIGQYNERNLLPEGFDND
Sbjct: 421 NSKTSKRQFFKDYISLYKSPPKLALAFQYLPIPTYRLSGVFPIIGQYNERNLLPEGFDND 480

Query: 481 DNLINYMHEMNIKALSCGFDHSNDCCLQSIHDIWLCYSGATGLTAPHSIFMPPSVRLFKV 540
           DNLINYMHEMNIKALSCGFDHSNDCCLQSIHDIWLCYSGATGLTAPHSIFMPPSVRLFKV
Sbjct: 481 DNLINYMHEMNIKALSCGFDHSNDCCLQSIHDIWLCYSGATGLTAPHSIFMPPSVRLFKV 540

Query: 541 DNIDKSITSWKRNYNKIDEVYDYQYIYNQPKQKHTPSN 578
           DNIDKSITSWKRNYNKIDEVYDYQYIYNQPKQKHTPSN
Sbjct: 541 DNIDKSITSWKRNYNKIDEVYDYQYIYNQPKQKHTPSN 578

>TDEL0A03380 Chr1 complement(601033..602712) [1680 bp, 559 aa] {ON}
           Anc_5.474 YOR137C
          Length = 559

 Score =  426 bits (1096), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 223/555 (40%), Positives = 333/555 (60%), Gaps = 34/555 (6%)

Query: 25  IAWSRLRLFFLNVKSQ---PNAVEYNGGLIDDIKLMKCYRWYKNCETLYAQSAVHDNSFV 81
           +A+S    F +++++    P   EY GGLIDD++ ++CYRW+  C +L A+    D+  V
Sbjct: 25  LAYSSRSSFIIHLQNTFNVPTTSEYRGGLIDDVQSIRCYRWFGQCRSLIAKQRSSDDRIV 84

Query: 82  LWNRVSKNMTDSSLYAIESNWLYETFFYVHLFNTNANKEDEKQPLADIAVSRDPSLVPLT 141
            W+R+SKN+TD SLY+IE+++ Y+T+ YVH ++ + N      P++++A+SRD S++P+ 
Sbjct: 85  SWSRISKNLTDESLYSIETSFFYKTYLYVHEWDGSVNP----GPISELAISRDSSMIPIQ 140

Query: 142 VLQEVMPSLRSSDSMMGNKRLYYQKTSWWYRFWNNPLPTKM--NLMNKWKHNNDILWSKI 199
           V Q+V   +++SDS + +  ++ ++      F  +   + +  +L   WK+    +W K 
Sbjct: 141 VTQDVQRLIKTSDSSVFHNHVHRERRPIIDFFTRDHSDSDIIHSLGEDWKYKGGGIWCKH 200

Query: 200 QHDSCLITNIQLYLGSNFVESRPFWKEIIHELHNEDGN-SIPISITRKVECGFDANH--T 256
           + D   ITNIQLYLGS F+ESRP WKE+IHE     G+ S  IS+TR++  G +      
Sbjct: 201 RSDQDPITNIQLYLGSGFLESRPNWKEVIHEYSRNKGHKSQLISVTREINNGHEKGEQSV 260

Query: 257 FPKNTXXXXXXXXXXXXXXXXXXXXXDIHIKGNEENSAILGEFQSRIFISRIIDIERPDL 316
             K+                      DIH + +E+  A+L EFQ++ FIS +I  ERPDL
Sbjct: 261 IIKDDDVLRISLSPHYGKSLKILQISDIHFRCSEDTIAVLSEFQTKHFISNVISRERPDL 320

Query: 317 VVITGDILDGNKSVDYQTCILNVVQPIIRAQIPFVISFGAKDFSKYATQQEITDFVNQIP 376
           VV+TGD LDG+ S+DYQ CI+ +VQP+I+++ P+ I+ G  D+S++A   +I DF+  +P
Sbjct: 321 VVVTGDFLDGDNSLDYQACIMKLVQPMIKSKTPYAITTGVSDYSRFAAISQIQDFIKGLP 380

Query: 377 YCLNKNSDSNGHLTIPYNFSTIPNDSKDDYSNLITQNDLAIFIFNSKTSKRQFF---KDY 433
           Y LN+ +   GHL I  +FS                 D AI+I +S    +QFF   KDY
Sbjct: 381 YSLNRYASPEGHLAISSHFSK--------------GTDAAIYILDSFHPVKQFFSMQKDY 426

Query: 434 ISLYKSPPKLALAFQYLPIPTYRLSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIK 493
            +      + ALAF++LPIP YR  GVFPIIGQYNE++++     +D  L   M+  N+K
Sbjct: 427 QTY-----RYALAFRHLPIPEYRPEGVFPIIGQYNEQSIVKSKLFDDKILQKIMYSFNVK 481

Query: 494 ALSCGFDHSNDCCLQSIHDIWLCYSGATGLTAPHSIFMPPSVRLFKVDNIDKSITSWKRN 553
           A+SCG +HSNDCCLQS  D+WLCY G+ G+       M PSVRLF +D     +TSWKRN
Sbjct: 482 AMSCGHEHSNDCCLQSRGDMWLCYGGSAGIGIDRMNGMEPSVRLFNIDGDLDEVTSWKRN 541

Query: 554 YNKIDEVYDYQYIYN 568
           +  I+ VYDYQYIY 
Sbjct: 542 FRLIESVYDYQYIYQ 556

>Skud_15.301 Chr15 complement(535844..537721) [1878 bp, 625 aa] {ON}
           YOR137C (REAL)
          Length = 625

 Score =  381 bits (979), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 219/597 (36%), Positives = 326/597 (54%), Gaps = 64/597 (10%)

Query: 30  LRLFFLNVKSQPNAVEYNGGLIDDIKLMKCYRWYKNCETLYA--------QSAVHDNSFV 81
           LRL   NV   P   EYNGG IDDI++++CY WY+ C +LYA           V D S V
Sbjct: 31  LRLNTKNVFINPKIAEYNGGTIDDIQILRCYHWYRQCGSLYAPRLHPSTSAERVKDKSSV 90

Query: 82  LWNRVSKNMTDSSLYAIESNWLYETFFYVHLFNTNANKEDEKQPLADIAVSRDPSLVPLT 141
           LW+RVSKN+T  SLY+++S   Y ++ YVH+ +   N    K  + ++A++RD +L+PL 
Sbjct: 91  LWSRVSKNITVESLYSLQSGTFYNSYLYVHMKSFQGN---SKNSIKELAMARDSALIPLQ 147

Query: 142 VLQEVMPSLRSSDSMMGNKRLYYQK---TSWWYRFWNNPLPTK--MNLMNKWKHNNDILW 196
           VL+++   ++SSDS + +  +Y ++   +SWW   +   + +        +W +    +W
Sbjct: 148 VLRDINKMVKSSDSSVFHNHVYRREKPTSSWWKLLFGISVDSDDIAVFGEEWVYKGSGIW 207

Query: 197 SKI----QHDSCLITNIQLYLGSNFVESRPFWKEIIHELHNEDGNSIPISITRKVECGFD 252
            K       +   I N+++YLGS+F+ESRPFWKE+IHE H  +  S+PISITRK E   +
Sbjct: 208 CKFILNDDDNDPPIINLEIYLGSSFIESRPFWKEVIHEFHRNNMPSMPISITRKHETK-N 266

Query: 253 ANHTFP-----------KNTXXXXXXXXXXXXXXXXX-------------XXXXDIHIKG 288
           A++ +P           KN                                   D H K 
Sbjct: 267 AHYKYPNKLPGSLEAPDKNNDALRLLQADEDYRITSSHIQYSWGQRSFKILQMTDFHFKC 326

Query: 289 NEENSAILGEFQSRIFISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPIIRAQI 348
            + + +I+ E ++  FI R++ +E+PDLVVITGD+LD   S+DYQTCI+ +VQP+I  Q+
Sbjct: 327 TDNSMSIINEIRTVNFIDRVLALEKPDLVVITGDLLDSQNSMDYQTCIMKLVQPMISNQV 386

Query: 349 PFVISFGAKDFSKYATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPN-----DSK 403
           P+ IS GA D S +AT  +I DF+  +PY  N  +   GH+ I  +F+   +     + +
Sbjct: 387 PYAISLGASDESNFATLSQIKDFIGNLPYAFNNIASKEGHMAIKVSFNKKLSKNALLEKR 446

Query: 404 DDYSNLITQNDLAIFIFNSKTSKRQFFKDYISLYKSPPKLALAFQYLPIPTYRLSGVFPI 463
            D +   +  +   F+F+S      F  DY  L        LAFQY P+  YR  G+FPI
Sbjct: 447 VDNNEETSPAEALFFVFDSFNPVNDFLLDYSDLI-GKIDYGLAFQYFPLSEYRPRGLFPI 505

Query: 464 IGQYNERNLLPE-------------GFDNDDNLINYMHEMNIKALSCGFDHSNDCCLQSI 510
           IGQYNE++ L                  + ++ ++ +   N+K + CG +H+NDCCLQS 
Sbjct: 506 IGQYNEKSTLTVETSRCKGEVSMTINGKHYESFLDILSLWNMKGVGCGHEHNNDCCLQSK 565

Query: 511 HDIWLCYSGATGLTAPHSIFMPPSVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIY 567
           +D+WLCY G+ G+  P    + P+VRLF VD+I   ITSWKRN   +DEVYDYQYIY
Sbjct: 566 NDMWLCYGGSAGIDLPRIEGIYPNVRLFNVDDIMDEITSWKRNSIIVDEVYDYQYIY 622

>YOR137C Chr15 complement(581813..583681) [1869 bp, 622 aa] {ON}
           SIA1Protein of unassigned function involved in
           activation of the Pma1p plasma membrane H+-ATPase by
           glucose
          Length = 622

 Score =  381 bits (978), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 217/593 (36%), Positives = 318/593 (53%), Gaps = 60/593 (10%)

Query: 30  LRLFFLNVKSQPNAVEYNGGLIDDIKLMKCYRWYKNCETLYA--------QSAVHDNSFV 81
           L+L   NV    N  EY+GG+IDDI++++CY WY+ C +LYA           + D + +
Sbjct: 31  LKLHAKNVLMDHNVAEYHGGMIDDIQILRCYHWYRQCSSLYAPKLHPSNTAKKIKDKNSI 90

Query: 82  LWNRVSKNMTDSSLYAIESNWLYETFFYVHLFNTNANKEDEKQPLADIAVSRDPSLVPLT 141
           LW RVSKN+T  +LY+++S   Y ++ YVHL +  +N    K  + ++A++RD +L+PL 
Sbjct: 91  LWTRVSKNITVETLYSLQSGPFYNSYLYVHLKDFQSN---PKNTIKELAIARDSALIPLQ 147

Query: 142 VLQEVMPSLRSSDSMMGNKRLYYQK---TSWWYRFWNNPLPTK--MNLMNKWKHNNDILW 196
           VL+++   ++SSDS + +  +Y ++   +SWW   +   + T        +W +    +W
Sbjct: 148 VLRDINKLVKSSDSSVFHNHVYLREKPTSSWWKLLFGISVDTDNIAVFGEEWVYKGSGIW 207

Query: 197 SKI----QHDSCLITNIQLYLGSNFVESRPFWKEIIHELHNEDGNSIPISITRKVECGFD 252
            K       +   ITN+++YLGS+F+ESRP WKE+IHE H  +  S+PISITRK+E   +
Sbjct: 208 CKYILNDDDNDAPITNLEIYLGSSFIESRPSWKEVIHEFHRNNIPSLPISITRKLETK-N 266

Query: 253 ANHTFPKNTXXXXXX--------------------XXXXXXXXXXXXXXXDIHIKGNEEN 292
            +H F                                             D H K  + +
Sbjct: 267 HHHKFSNGLLGSLRTPSKDINIQVDADYKITSPHIQFSRGQRSFKILQITDFHFKCTDNS 326

Query: 293 SAILGEFQSRIFISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPIIRAQIPFVI 352
             ++ E ++  FI R++  E PDLVVITGD+LD + ++DYQTCI+ VVQP+I  +IP+ I
Sbjct: 327 MTVINEIKTVNFIDRVLASENPDLVVITGDLLDSHNTIDYQTCIMKVVQPMISNKIPYAI 386

Query: 353 SFGAKDFSKYATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPN-----DSKDDYS 407
           S G  D S  AT  +I DF+  +PY  N  +   GH+ I  +F          +   D  
Sbjct: 387 SLGVSDESNLATSAQIRDFIRNLPYTFNNVASEEGHMAIEVSFKKKLTKNTLLERDIDTE 446

Query: 408 NLITQNDLAIFIFNSKTSKRQFFKDYISLYKSPPKLALAFQYLPIPTYRLSGVFPIIGQY 467
           +    ++   F+F+S      F +DY  L        LAFQY P+  YR  G+FPIIGQY
Sbjct: 447 DETNPSEALFFVFDSFAPVNNFLQDYNDLI-GKIDFGLAFQYFPLSEYRPHGLFPIIGQY 505

Query: 468 NERNLL----PEGFDNDDNLINYMHEM---------NIKALSCGFDHSNDCCLQSIHDIW 514
           NER+ L    P         IN  H           NIK +SCG +H+NDCCLQS +++W
Sbjct: 506 NERSTLTVDTPRSRGQVSMTINGKHYKSFLDILSLWNIKGVSCGHEHNNDCCLQSKNEMW 565

Query: 515 LCYSGATGLTAPHSIFMPPSVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIY 567
           LCY G+ G+  P    + P+VRLF +D+I   ITSWKRN N +DEVYDYQYIY
Sbjct: 566 LCYGGSAGIGLPRIQGIYPTVRLFNLDDILDEITSWKRNSNLVDEVYDYQYIY 618

>Smik_15.317 Chr15 complement(543212..545092) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score =  364 bits (934), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 211/608 (34%), Positives = 328/608 (53%), Gaps = 75/608 (12%)

Query: 30  LRLFFLNVKSQPNAVEYNGGLIDDIKLMKCYRWYKNCETLYA--------QSAVHDNSFV 81
           L+L   N    PN  EY+ G+IDDI++++CY WY+ C +LYA         S V D + V
Sbjct: 31  LKLHAKNALINPNTAEYHEGMIDDIQVLRCYHWYRQCGSLYAPRLHPSNTASKVKDKNNV 90

Query: 82  LWNRVSKNMTDSSLYAIESNWLYETFFYVHLFNTNANKEDEKQPLADIAVSRDPSLVPLT 141
           LW+RVSKN+T  +LY+++S   Y ++ YVH       + + +  + ++A++RD +L+PL 
Sbjct: 91  LWSRVSKNITIEALYSLQSGAFYNSYLYVH---PKGFQSNSRNSIKELAIARDSALIPLQ 147

Query: 142 VLQEVMPSLRSSDSMMGNKRLYYQK---TSWWYRFWNNPLPTK--MNLMNKWKHNNDILW 196
           VL+++   ++SSDS + +  +Y ++   +SWW   +   + +        +W +    +W
Sbjct: 148 VLRDINKMVKSSDSSVFHNHVYQREKPTSSWWKLLFGISVDSDDIAVFGEEWVYKGSGIW 207

Query: 197 SK--IQHDSC--LITNIQLYLGSNFVESRPFWKEIIHELHNEDGNSIPISITRKVECGFD 252
            K  +  D     I ++++YLGS+F+ESRP WKE++HE H  +  S+PISITRK++   +
Sbjct: 208 CKYVLNDDDSDPPIISLEIYLGSSFIESRPSWKEVMHEFHRNNIPSLPISITRKLKTKNN 267

Query: 253 ANHTFPKNTX-----------------------XXXXXXXXXXXXXXXXXXXXDIHIKGN 289
            +    + T                                            D H K  
Sbjct: 268 LHKASKRLTGPLKAPEKDNNILELLQVDGNYKITSPHIQFSRGQRSFKILQMTDFHFKCT 327

Query: 290 EENSAILGEFQSRIFISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPIIRAQIP 349
           + + +I+ E ++  FI R++ +E PDLVVITGD+LD   ++DYQTCI+ +VQP+I  +IP
Sbjct: 328 DNSMSIINEIRTVNFIDRVLALENPDLVVITGDLLDSQNTIDYQTCIMKLVQPMISNKIP 387

Query: 350 FVISFGAKDFSKYATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPN--------- 400
           + IS G  D S  AT  ++ D++  +PY  N  +   GH+ I  +F              
Sbjct: 388 YAISLGVSDESNLATPSQVQDYIRNLPYTFNSVASEEGHIAIRVSFKKKLLKNTLLKRGI 447

Query: 401 DSKDDYSNLITQNDLAIFIFNSKTSKRQFFKDYISLYKSPPKLALAFQYLPIPTYRLSGV 460
           ++KD+     T ++   F+F+S      F  DY +L        LAFQY P+  YR  G+
Sbjct: 448 NAKDE----TTPSEALFFVFDSFNPVNDFLLDYSNLI-GKIDYGLAFQYFPLSEYRPHGL 502

Query: 461 FPIIGQYNERNLLP--------------EGFDNDDNLINYMHEMNIKALSCGFDHSNDCC 506
           FPIIGQYNER+ L               +G  N  + ++ ++  NIK +SCG +H+NDCC
Sbjct: 503 FPIIGQYNERSTLTVDTSRSKGEVSMTIDG-KNYKSFLDILNLWNIKGVSCGHEHNNDCC 561

Query: 507 LQSIHDIWLCYSGATGLTAPHSIFMPPSVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYI 566
           LQSI+++WLCY G+ G+       + P+VRLF +D+I   ITSWKR+ N +DEVYDYQYI
Sbjct: 562 LQSINEMWLCYGGSAGIDVARIEGIHPNVRLFNLDDIKDEITSWKRSSNLVDEVYDYQYI 621

Query: 567 YNQPKQKH 574
           Y   K KH
Sbjct: 622 Y---KGKH 626

>NCAS0H02260 Chr8 complement(443026..444738) [1713 bp, 570 aa] {ON}
           Anc_5.474
          Length = 570

 Score =  360 bits (924), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 212/575 (36%), Positives = 324/575 (56%), Gaps = 59/575 (10%)

Query: 24  CIAWSRLRLFFLNVKSQPNAVEYNGGLIDDIKLMKCYRWYKNCETLYAQSAVHDNSFVLW 83
           C +   LR    NV  Q    EY GG I DI+ + C+ WY+ C ++             W
Sbjct: 25  CNSLGSLRNHLKNVFRQDIPEEYTGGPITDIQCIPCFYWYQTCGSIIWNDQK-------W 77

Query: 84  NRVSKNMTDSSLYAIESNWLYETFFYVHLFNTNANKEDEKQPLADIAVSRDPSLVPLTVL 143
            RVSKN++D SLY++ES     +F YV        ++  ++P++DIA+S DP ++P+ V 
Sbjct: 78  LRVSKNLSDESLYSMESGPFSRSFLYVR-------QDTGEKPISDIAISSDPLMIPVHVT 130

Query: 144 QEVMPSLRSSDSMMGNKRLYYQK-TSW---WYRFWN------------NPLPTKMNLMN- 186
           Q++   L+SSDS + +   ++QK +SW   W  FWN            +   + M+ ++ 
Sbjct: 131 QDINNLLQSSDSSVYHNHKFHQKGSSWRASWSWFWNSGKVLASHDHADDASDSTMDDISL 190

Query: 187 ---KWKHNNDILWSKIQHDSCLITNIQLYLGSNFVESRPFWKEIIHELHNEDGNSIPISI 243
               WK+    +W K  +   ++ NI+++LGS F+ESRP+W+E+IHE   +D   +PISI
Sbjct: 191 RGENWKYKGYGIWCKFDNTKEIVANIEIFLGSLFLESRPYWREVIHEFKPDDKLPLPISI 250

Query: 244 TRKVECGFDANHTFPKNTXXXXXXXXXXXXXXXXXXXXXDIHIKGNEENSAILGEFQSRI 303
           T K+        T  K                       D+H + +  +  +L E+Q+  
Sbjct: 251 TVKIA-------TNVKEETGELNDGTLKMDSKFKILQVSDVHFRSSINSMPMLKEYQTMQ 303

Query: 304 FISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPIIRAQIPFVISFGAKDFSKYA 363
           FI+  I  E P+LV++TGDILD   S+DYQTCI+N+VQP+I+ +IP++I+ G+ D+S+YA
Sbjct: 304 FITNTITRELPNLVIVTGDILDSTNSIDYQTCIMNLVQPMIKFKIPYIITLGSADYSEYA 363

Query: 364 TQQEITDFVNQIPYCLNKNSDSNGHLTIP-YNFSTIPNDSKDDYSNLITQNDLAIFIFNS 422
           ++ +I +F++ +PY L K S  NGHL IP + F    ND K +    ++Q++L I++ +S
Sbjct: 364 SRDQIINFISTLPYSLTKFSTDNGHLIIPLHKF----NDPKGE----VSQDELMIYVIDS 415

Query: 423 KTSKRQFFKDYISLYKSPP--KLALAFQYLPIPTYRLSGVFPIIGQYNERNLLP------ 474
             S     K +  +   P   + ALAF+ LPIP YR  G+FPIIGQYNER  L       
Sbjct: 416 FHSIENDVK-FKEIASKPVDWEYALAFRSLPIPQYRPDGLFPIIGQYNERTSLELRENVG 474

Query: 475 EGFDNDDNLINYMHEMNIKALSCGFDHSNDCCLQSIHDIWLCYSGATGLTAPHSIFMPPS 534
               N  NL +++    +K++SCG +H+NDCCLQS +++WLCY G+TG+       +  +
Sbjct: 475 TAVGNVINLQDFLISKKVKSISCGHEHNNDCCLQSKNEMWLCYGGSTGVGTKRMEGLFAN 534

Query: 535 VRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIYNQ 569
           VRLF +D     ITSWKRN + ID VYDYQYIY +
Sbjct: 535 VRLFDIDTDIGEITSWKRNMHLIDNVYDYQYIYKR 569

>Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score =  356 bits (914), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 207/592 (34%), Positives = 314/592 (53%), Gaps = 66/592 (11%)

Query: 36  NVKSQPNAVEYNGGLIDDIKLMKCYRWYKNCETLYA--------QSAVHDNSFVLWNRVS 87
           N    PN  EY+GGLIDDI++++CY WY+ C +LYA             +   VLWNRVS
Sbjct: 37  NTLLSPNLTEYHGGLIDDIQVLRCYCWYRQCGSLYAPRLQPSGAGKKAKEKKNVLWNRVS 96

Query: 88  KNMTDSSLYAIESNWLYETFFYVHLFNTNANKEDEKQPLADIAVSRDPSLVPLTVLQEVM 147
           KN++   +Y++++   Y ++ YVH  N  +     K  + ++A++RD +L+PL VL+++ 
Sbjct: 97  KNISVEPMYSLQTGIFYNSYLYVHAKNIQSKL---KNSIKELAIARDSALIPLQVLRDIN 153

Query: 148 PSLRSSDSMMGNKRLYYQ---KTSWWYRFWNNPLPTK--MNLMNKWKHNNDILWSKI--- 199
             ++SSDS + +  +Y +    + WW       + +        +W +  + +W K    
Sbjct: 154 KMVKSSDSSVFHNHVYQRDKPTSPWWKLLLGIAVDSDDISVFGEEWVYKGNGIWCKYILN 213

Query: 200 -QHDSCLITNIQLYLGSNFVESRPFWKEIIHELHNEDGNSIPISITRKVEC--------- 249
              +   I ++++YLGS+F+ESRP WKE+IHE H  +  S+PISITRK+           
Sbjct: 214 NDGNDLPIVDLEIYLGSSFIESRPNWKEVIHEFHRNNIPSLPISITRKINTPRTRHGPLN 273

Query: 250 GFDANHTFPKNTXXXXXXXX--------------XXXXXXXXXXXXXDIHIKGNEENSAI 295
           G       P+N                                    D H K  E    I
Sbjct: 274 GLPGPLKSPENENNILRLLQVDEDYRITSPHIQFSKGQRSFKILQMTDFHFKCTENGMTI 333

Query: 296 LGEFQSRIFISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPIIRAQIPFVISFG 355
           + E ++  FI R++ +E PDLVVITGD+LD   S+DYQTCI+ +VQP+I  +IP+ IS G
Sbjct: 334 INEIRTVNFIDRMLALENPDLVVITGDLLDSANSMDYQTCIMRLVQPMISNKIPYAISLG 393

Query: 356 AKDFSKYATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNF-------STIPNDSKDDYSN 408
           A D SK A+  +I DF++ +PY  N  +   GH+ I  +F       +    ++   Y +
Sbjct: 394 ASDESKLASLPQIKDFISNLPYSFNHVATEEGHMAIQVSFKKKLLKHALFERETDAKYES 453

Query: 409 LITQNDLAIFIFNSKTSKRQFFKDYISLYKSPPKLALAFQYLPIPTYRLSGVFPIIGQYN 468
             + ++   FIF+S      F  DY +L        L FQY PI  YR  G+FPIIGQYN
Sbjct: 454 --SPSEALFFIFDSFNPVGDFLLDYSNLI-GKIDYGLTFQYFPISEYRPHGLFPIIGQYN 510

Query: 469 ERNLLPE-------------GFDNDDNLINYMHEMNIKALSCGFDHSNDCCLQSIHDIWL 515
           ER+ L               G  + ++ ++ ++  N+K +SCG +H+NDCCLQS +++WL
Sbjct: 511 ERSTLTVDTARSKGEVSMTIGGKHYNSFLDILNLWNVKGVSCGHEHNNDCCLQSKNEMWL 570

Query: 516 CYSGATGLTAPHSIFMPPSVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIY 567
           CY G+ G+       + P+VRLF +D+I   ITSWKR+ N +DEVYDYQYIY
Sbjct: 571 CYGGSAGMDVSRMEGLYPNVRLFNLDDIMDEITSWKRSSNLVDEVYDYQYIY 622

>SAKL0G03542g Chr7 complement(292214..293938) [1725 bp, 574 aa] {ON}
           similar to uniprot|Q12212 Saccharomyces cerevisiae
           YOR137C SIA1 Suppressor of eIF5A High-copy suppressor of
           temperature-sensitive tif51A-1
          Length = 574

 Score =  342 bits (877), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/553 (36%), Positives = 306/553 (55%), Gaps = 35/553 (6%)

Query: 34  FLNVKSQPNAVEYNGGLIDDIKLMKCYRWYKNCETLYAQSAVHDNS-FVLWNRVSKNMTD 92
           ++N   + + V+Y GGLIDD++ +KCYRWY +C+T+Y +   H N   + W RV K M D
Sbjct: 36  WINTFKKGHDVQYQGGLIDDVRFIKCYRWYSHCDTIYDKQ--HSNGPLIQWKRVHKKMRD 93

Query: 93  SSLYAIESNWLYETFFYVHLFNTNANKEDEKQPLADIAVSRDPSLVPLTVLQEVMPSLRS 152
           S+LYAI S  LY T+ YVH  +         + + D+A++R+ ++VPL VL++V   +RS
Sbjct: 94  SNLYAINSGMLYSTYLYVH--SAKKTTFGTTRAITDLAIAREKTVVPLHVLKDVNLQIRS 151

Query: 153 SDSMMGNKRLYYQKTSWWYRFWNNPLPTKMNLMNKWKHNNDILWSK---IQH--DSCLIT 207
           SD+ + +   Y Q+ SW    +    PT       W++ +D +W K   IQ   D   +T
Sbjct: 152 SDNSVFHNHEYPQEFSW--SIFGKGSPTLSVDDEDWEYKSDGIWCKYSLIQEGSDDTALT 209

Query: 208 NIQLYLGSNFVESRPFWKEIIHELHNEDGNSIPISITRKVECGFDANHTFPKNTXXXXXX 267
           N+Q+YLG +F+ESRP WKE IH      G    +SIT +    F+ N             
Sbjct: 210 NLQIYLGDDFIESRPMWKEAIHG--KSRGRLAALSITSER---FNKNELVDN---VHIAN 261

Query: 268 XXXXXXXXXXXXXXXDIHIK---GNEENSAILGEFQSRIFISRIIDIERPDLVVITGDIL 324
                          D+H     G       L +FQ+R FIS +ID E+PDLVVITGDIL
Sbjct: 262 TLSLKSQGFKILQLSDLHYSSGMGVCNEPPCLADFQTRNFISTVIDREKPDLVVITGDIL 321

Query: 325 DGNKSVDYQTCILNVVQPIIRAQIPFVISFGAKDFSKYATQQEITDFVNQIPYCLNK-NS 383
           DG  ++DY+T +L  VQP++ ++ P+ I+FG +DFS  AT+++I +F+  +P+C+N  N+
Sbjct: 322 DGVNTLDYETALLKAVQPMVSSRTPYAIAFGLQDFSTQATKRDILEFIGSLPFCMNSVNN 381

Query: 384 DSNGHLTIPYNFST----IPNDSKDDYSNLITQNDLAIFIFNSKTSKRQFFKDYISLYKS 439
           DSN      ++F T    +P    ++ S ++   D +  + +  +  R      +    +
Sbjct: 382 DSNVINLDKHSFYTTNIALPIHKGEEISGMVYVLD-STDVESQDSFLRNAHASALLSKHT 440

Query: 440 PPKLALAFQYLPIPTYRLSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGF 499
            P  + AFQ+LP   YR +G+F IIG YNE+  L +       L + + E+ ++ LSCG+
Sbjct: 441 KPMYSFAFQHLPTIEYRPTGLFAIIGSYNEKKQLSDVIPR-TKLRDTLGELKVQVLSCGY 499

Query: 500 DHSNDCCLQS-----IHDIWLCYSGATGLTAPHSIFMPPSVRLFKVDNIDKSITSWKRNY 554
           +H NDCCL S       ++WLCY G +GL+      M P++RLF +D+    ITSWKR+ 
Sbjct: 500 EHGNDCCLHSTGPEYTGELWLCYGGVSGLSGYQIEGMSPNIRLFGIDDEKGEITSWKRSL 559

Query: 555 NKIDEVYDYQYIY 567
              +EVYDYQYIY
Sbjct: 560 ANPEEVYDYQYIY 572

>NDAI0C01400 Chr3 (292788..294905) [2118 bp, 705 aa] {ON} Anc_5.474
          Length = 705

 Score =  321 bits (822), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 208/604 (34%), Positives = 310/604 (51%), Gaps = 99/604 (16%)

Query: 45  EYNGGLIDDIKLMKCYRWYKNCETLYAQSAVHDNSFVLWNRVSKNMTDSSLYAIESNWLY 104
           EY  G I DI+ ++CY WY  C  L+     HD   +LW R+ K+++D  LYA+ES   Y
Sbjct: 121 EYEEGPILDIQRLRCYHWYSTCNVLW-----HDG--ILWQRIKKDLSDEKLYALESTQYY 173

Query: 105 ETFFYVHLFNTNANKEDEKQP---------LADIAVSRDPSLVPLTVLQEVMPSLRSSDS 155
           +++ YV   + N +      P         +++IA+SRDP+++P+ V+++V    +SSDS
Sbjct: 174 DSYIYVKTLSANMDTLSPNIPNGSPHTLKRISEIAMSRDPTIIPMQVIRDVNKLFKSSDS 233

Query: 156 MMGNKRLYYQKTS------------------------------------W-WYRFWNNPL 178
            M +  +++Q                                       W W    ++  
Sbjct: 234 SMFHTHVFHQSGDEHDPVYSDNHAHNKNKDIDVHDDNSHMNGYQFLQQIWSWLLAISDSH 293

Query: 179 PTKMNLMNK-WKHNNDILWSK----IQHDSCLITNIQLYLGSNFVESRPFWKEIIHELHN 233
              ++LM + WK+    +W K    ++ +  ++  +++YLGS+F E R  WKEIIHE   
Sbjct: 294 DDDLSLMGEDWKYRGSGIWCKYENGVEMEPMIVNKLEIYLGSSFQEFRHNWKEIIHEYKT 353

Query: 234 EDGN---SIPISITRKVECGFDANHTFPKNTXXXXXXXXXXXXXXXX----XXXXXDIHI 286
           E      S+PISITR++  G     T P                            D+H 
Sbjct: 354 ERDERDVSLPISITRQIGRG---TKTDPDKIILIEKETEKKFGLMTAFGFKILQVSDLHY 410

Query: 287 KGNEENSAILGEFQSRIFISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPIIRA 346
           K ++E+ + L EFQ+  FI ++I  E P+L+VITGDILDG   VDYQTCI+ +VQP I  
Sbjct: 411 KCSDESISNLKEFQTNNFIKKVILREFPNLIVITGDILDGTNCVDYQTCIMKLVQPFINF 470

Query: 347 QIPFVISFGAKDFSKYATQQEITDFVNQIPYCLNKNSD--SNGHLTIPYNFSTIPNDSKD 404
           +IP++I  G  D+S+YA+++ I  F+  +PYC+NK S   ++ ++ IP       +D  +
Sbjct: 471 EIPYLIMLGTSDYSRYASRESILQFIRTLPYCINKLSQNVNDTNVMIPIYNKYNDDDKVN 530

Query: 405 DYSNLITQNDLAIFIFNSKTSKRQFFK-DYISLYKSPPKLALAFQYLPIPTYRLSGVFPI 463
           D   +I   D    I N+K       K DY           LAF+ LPIP YR  G+FPI
Sbjct: 531 DPYIMIYGVDSFNPIDNTKMKNEGSVKWDY----------GLAFRSLPIPEYRPEGMFPI 580

Query: 464 IGQYNERNLLP-EGFDNDDN-----------------LINYMHEMNIKALSCGFDHSNDC 505
           +GQYNE++ L  E F N+D+                 L +++   N++ LSCG +HSNDC
Sbjct: 581 VGQYNEKSSLTFEEFANNDDSVDADDGGDGRWIGANKLQDFLISENVQVLSCGHEHSNDC 640

Query: 506 CLQSIHDIWLCYSGATGLTAPHSIFMPPSVRLFKVDNIDKSITSWKRNYNKIDEVYDYQY 565
           CLQS + +WLCY G++G+       +  SVRLF+VD     ITSWKRN N ID VYDYQY
Sbjct: 641 CLQSKNKMWLCYDGSSGMDVARLENIHASVRLFEVDTNAGEITSWKRNSNSIDNVYDYQY 700

Query: 566 IYNQ 569
           IY +
Sbjct: 701 IYKK 704

>Kwal_55.21268 s55 (759935..761641) [1707 bp, 568 aa] {ON} YOR137C
           (SIA1) - High-copy suppressor of temperature-sensitive
           tif51A-1 [contig 130] FULL
          Length = 568

 Score =  311 bits (796), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 188/562 (33%), Positives = 303/562 (53%), Gaps = 39/562 (6%)

Query: 24  CIA-WSRLRLFFLNVKSQP-NAVEYNGGLIDDIKLMKCYRWYKNCETLYAQSAVHDNSFV 81
           CI+ +  +++ F+N  +Q   A  Y GG IDD+K +KC+RW+ +C  ++ + ++ D   +
Sbjct: 27  CISFYGVIKIQFVNWLNQGFEAKGYEGGTIDDVKFIKCFRWFGDCNVVFERHSLRDE-IL 85

Query: 82  LWNRVSKNMTDSSLYAIESNWLYETFFYVHLFNTNANKEDEKQPLADIAVSRDPSLVPLT 141
            W RV K++ D SLYA++   L+ T+ YVH    N   +D    ++D+A++RD S VP+ 
Sbjct: 86  PWLRVGKSLNDDSLYAVDRGLLHHTYLYVH---PNDGTQDS---ISDLAIARDESNVPVQ 139

Query: 142 VLQEVMPSLRSSDSMMGNKRLYYQKTSWWYRFWNNPLPTKMNLMNKWKHNNDILWSKIQH 201
           VLQ+V    +  DS M +   +++    W R   +   +       W +    +W K   
Sbjct: 140 VLQDVNSRAKFKDSSMFHDHDHHKSIWSWIR--GSGFHSLSLRGEDWHYKGHGVWCKYSS 197

Query: 202 -----DSCLITNIQLYLGSNFVESRPFWKEIIHELHNEDGNSIPISITRKVECGFDANHT 256
                D  +IT+IQ ++G  FVE RP WK  IHE++N  G  +  SI+  ++      H 
Sbjct: 198 KSRLDDEAVITDIQTFIGYGFVEPRPMWKVAIHEMNNF-GRDLQQSISFSIQISDKEAHI 256

Query: 257 FPKNTXXXXXXXXXXXXXXXXXXXXXDIHIKGNEENSAI--LGEFQ-SRIFISRIIDIER 313
            P  +                     D+H+  +  N  +     +Q +++F+SR+I +ER
Sbjct: 257 DPSASNIDLQLRDGEFKILQLS----DVHVSSDLANCDVEKCTNYQKTKMFVSRVIQLER 312

Query: 314 PDLVVITGDILDGNKSVDYQTCILNVVQPIIRAQIPFVISFGAKDFSKYATQQEITDFVN 373
           PD+V+ TGD +DG  ++DYQT IL   + +I A+IP+ +++G+ D+SKYA++++I  ++ 
Sbjct: 313 PDMVIFTGDFIDGPNAIDYQTAILKAAETVISAEIPWAVTWGSSDYSKYASKRQILQYLE 372

Query: 374 QIPYCLNKNSDSNG-HLTIPYNFSTIP-NDSKDDYSNLITQNDLAIFIFNSKTSKRQFFK 431
            +P+CLN+ S   G  ++    F++ P N+  D    LI   D +    N+    R  +K
Sbjct: 373 TLPFCLNRLSFGKGDKVSGNTTFNSFPLNNGSDSQVGLIYTLD-STSDENAAEFVRSAYK 431

Query: 432 DYISLYKSPPKLALAFQYLPIPTYRLSGVFPIIGQYNERNLL--PEGFDNDDNLINYMHE 489
           D I      P  +LAFQ+ PIP YR  G FPIIG YN+++ L  P+       +   + +
Sbjct: 432 DVIEHTNRKPLYSLAFQHSPIPEYRPKGPFPIIGSYNDKDPLDVPQL-----GIREALED 486

Query: 490 MNIKALSCGFDHSNDCCLQSI-----HDIWLCYSGATGLTAPHSIFMPPSVRLFKVDNID 544
             I+A+SC  +H NDCCLQS       D+WLCY G TG+   +      +VRLF++D+  
Sbjct: 487 AEIQAMSCSQEHGNDCCLQSSGPDCKKDVWLCYGGHTGVAGHYVSEKMANVRLFRIDDNA 546

Query: 545 KSITSWKRNYNKIDEVYDYQYI 566
           K IT+WKRN    D VYDYQY+
Sbjct: 547 KEITTWKRNSLSPDAVYDYQYL 568

>KLTH0F15026g Chr6 (1230760..1232484) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q12212 Saccharomyces cerevisiae YOR137C SIA1
           Suppressor of eIF5A High-copy suppressor of
           temperature-sensitive tif51A-1
          Length = 574

 Score =  296 bits (759), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 182/569 (31%), Positives = 299/569 (52%), Gaps = 64/569 (11%)

Query: 30  LRLFFLNVKSQPNAVE-YNGGLIDDIKLMKCYRWYKNCETLYAQSAVHDNSFVLWNRVSK 88
           ++  F N+   P  +E Y GGLIDD++ +KC+RWYK+C+ +  +    +  FV W RV K
Sbjct: 35  VKTHFANIFQPPTKLEGYTGGLIDDVRFLKCFRWYKDCDVILEKRG-RNGEFVPWMRVRK 93

Query: 89  NMTDSSLYAIESNWLYETFFYVHLFNTNANKEDEKQPLADIAVSRDPSLVPLTVLQEVMP 148
            + +  LY+++S   Y ++ YVH  + N      K  ++D+A+++D S +P+ VLQ++  
Sbjct: 94  ELDEEKLYSVDSGLFYRSYLYVHPCDGN------KDCVSDLAIAKDRSSIPMQVLQDINA 147

Query: 149 SLRSSDSMMGNKRLYYQKTSWWYRFWNNPLPTKMNLMNKWKHNNDILWSKIQHDSCL--- 205
            ++S DS M +   +++  ++W R +             W +    +W K    + +   
Sbjct: 148 KIQSKDSSMFHGHEHHK--TFWTRIFGGRRERLSLQGEDWHYRRHGIWCKYSSSNKIDEG 205

Query: 206 --ITNIQLYLGSNFVESRPFWKEIIHEL-HNEDGNSIPISIT-RKVECGFDANHTFPKNT 261
             ITN+Q++LGS FV+ RP WK  IHE+ H    +  PISI+ +K +   D+        
Sbjct: 206 QSITNLQIFLGSGFVDPRPMWKTAIHEMDHRNSESPTPISISIQKYDKSMDSRFVTENGI 265

Query: 262 XXXXXXXXXXXXXXXXXXXXXDIHIKG---NEENSAILGEFQSRIFISRIIDIERPDLVV 318
                                D+H+       E+     E++++ FISRII++E PDLVV
Sbjct: 266 LNADDGKFKILQVS-------DLHVSNAIERCESHLCTNEWKTQRFISRIIELETPDLVV 318

Query: 319 ITGDILDGNKSVDYQTCILNVVQPIIRAQIPFVISFGAKDFSKYATQQEITDFVNQIPYC 378
            TGD ++G ++ DYQT IL   + +I A+IP+ +++G  D+SKYA++++I +F+  +PY 
Sbjct: 319 FTGDFINGPETTDYQTAILKATECVISAKIPWAMTWGTLDYSKYASERDIFNFIKSLPYN 378

Query: 379 LN----KNSDSNGHLTIPYNFSTIPNDSKDDYSNLITQNDLAIFIFNSKTSKRQFFKDYI 434
           LN    K       +T  +               L   N++   ++   ++  +   D++
Sbjct: 379 LNYLHAKQVQDASLITTTFAL------------QLKRDNEIFGVVYILDSTNPENAVDFL 426

Query: 435 -SLYKSPPK-------LALAFQYLPIPTYRLSGVFPIIGQYNERNLL--PEGFDNDDNLI 484
            + Y++  K        +LAFQ+ PIP YR SG FPIIG YN+++ L  P+       + 
Sbjct: 427 KTAYENASKNSDRDTLYSLAFQHAPIPEYRPSGSFPIIGSYNDKSPLDVPQV-----GIR 481

Query: 485 NYMHEMNIKALSCGFDHSNDCCLQSI-----HDIWLCYSGATGLTAPHSIF-MPPSVRLF 538
             + +  I A SCG +H NDCCLQS       D+WLCY G  G+   +S      SVRLF
Sbjct: 482 KALDDFKIHAFSCGQEHGNDCCLQSSDSNSNKDVWLCYGGHAGVVGRYSPEDSASSVRLF 541

Query: 539 KVDNIDKSITSWKRNYNKIDEVYDYQYIY 567
           ++D+  K IT+WKRN  + D VYDYQ+++
Sbjct: 542 RIDDSLKEITTWKRNSREPDSVYDYQFLF 570

>KLLA0E03147g Chr5 complement(290622..292358) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|Q12212 Saccharomyces
           cerevisiae YOR137C SIA1 Suppressor of eIF5A High-copy
           suppressor of temperature-sensitive tif51A-1
          Length = 578

 Score =  208 bits (530), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 172/581 (29%), Positives = 273/581 (46%), Gaps = 70/581 (12%)

Query: 26  AWSRLRLFFLNVKSQPNAVEYNGGLID------DIKLMKCYRWYKNCETLYAQSAVHDNS 79
           +WS ++    N   Q   ++ +G L D      D+++ KCY W+ NC+ ++  S   D  
Sbjct: 26  SWSLIQRHLKNWLVQAPDLKLSGSLQDTGIKVRDVRISKCYSWFSNCDAIWDYSLQDD-- 83

Query: 80  FVLWNRVS-KNMTDSSLYAIESNWLYETFFYVHLFNTNANKEDEKQPLADIAVSRDPSLV 138
            V W R+    M D+S   I   + + ++ Y      N    +    + D+A+SR+   +
Sbjct: 84  LVTWYRIDMGKMQDTS---IGQGFGWTSYVYWQPLYPN----ERGSAVVDLALSRNG--L 134

Query: 139 PLTVLQEVMPSLRSSD-------SMMGNKRLYYQKTSWWYRF-----WNNPLPTKMNLMN 186
           PL +  E    ++++D       S   N+  +Y K     RF     W+       N + 
Sbjct: 135 PLGLANERYNKIKNNDIDGYHVHSNTDNE--FYVKDDSSNRFNPDMKWSAKFG---NHLE 189

Query: 187 KWKHNNDILWSKIQHDSCLITNIQLYLGSNFVESRPFWKEIIHELHNEDGNSIPISITRK 246
            W    D +W K    S  I  I+ ++G +F+ESRP WKE++H LH E G S PISI+ +
Sbjct: 190 DWFWRGDGIWCKYGRRSNGIKEIKAFIGEDFIESRPMWKEMVHCLHRE-GYSKPISISFQ 248

Query: 247 VECGFDANHTFPKNTXXXXXXXXXXXXXXXXXXXXXDIHI--------KGNEENSAILGE 298
                D  +   K+                      D+H         +  + +S    +
Sbjct: 249 KSRLDDFTYGKEKDLSQISEPSLVMKRADFKILQISDLHFGRHIVSDSRKEKPDSIFRYD 308

Query: 299 FQSRIFISRIIDIERPDLVVITGDIL-DGNKSVDYQTCILNVVQPIIRAQIPFVISFGAK 357
           + +  FI  +I  ERPDL VITG I  D NK++DY++ IL +V PII   IPF+ ++G  
Sbjct: 309 WPNVQFIHSVIRNERPDLAVITGHIFKDFNKNLDYESQILKMVSPIISNGIPFLFTWGEP 368

Query: 358 DFSKYATQQEITDFVNQIPYCLNKNSDSNG-HLTIPYNFSTIPNDSKDDYSNLITQNDLA 416
             +    +  I +F+  +P+CLNK    N  +L +P     +P  +      + T     
Sbjct: 369 QVTT-EFKVNILNFIKSLPFCLNKFDLKNSTYLMLPL---LLPAKTPGSQKQIGT----- 419

Query: 417 IFIFNSKTSKRQFFKDYISLYKSPPKLA-LAFQYLPIPTYRLSGVFPIIGQYNERNLLPE 475
           IF F+S  ++   F D     +SP  +  LAFQ+LP+  YR  G F +IG Y ++  L +
Sbjct: 420 IFAFDSNVTESYNFLD--KFPRSPQSVYNLAFQHLPLHEYRPQGSFALIGNYEQKGSL-D 476

Query: 476 GFDNDDNLINYMHEMNIKALSCGFDHSNDCCLQS-------IHDIWLCYSGATGLTAPHS 528
              +     N + E +IKA+SCG +H NDCC+ S        +++WLCY G TG    + 
Sbjct: 477 YIPHTKAFRNLLGEKDIKAISCGHEHGNDCCVLSDGKQQNLKNNMWLCYGGVTGYDQAYE 536

Query: 529 IFMPPSVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIYNQ 569
                 VR+FK+D     ITSWKR+     +V DYQYI+++
Sbjct: 537 ----SKVRIFKIDTEKNDITSWKRSIKDTSKVSDYQYIWSR 573

>Ecym_2455 Chr2 complement(885426..887144) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii ABL009W
          Length = 572

 Score =  104 bits (260), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 137/289 (47%), Gaps = 25/289 (8%)

Query: 304 FISRIIDIERPDLVVITGDILDGNKSVDYQTCILNVVQPIIRAQIPFVISFGAKDFSKYA 363
           F+  +++IE PDL+V TGD ++G    D +T +L  + P IR  IP+ + +G  D S   
Sbjct: 279 FVETVLEIENPDLIVFTGDQIEGEWEQDSETALLKALGPAIRRGIPYAVIWGNHDDSGSM 338

Query: 364 TQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFS--TIPNDSKDDY---------SNLITQ 412
            +QE++ +V Q+PY L K +  +G L   + F    +  D +D           S+  + 
Sbjct: 339 DRQELSKYVYQLPYSLFKINPRDG-LRNDFGFGNYVLQVDDRDGSPAITFYFLDSHKRSP 397

Query: 413 NDLAIFIFN-SKTSKRQFFKDYIS--LYKSPPKLALAFQYLPIPTYRLSGVFPIIGQYNE 469
           N    F ++  K  +  + ++Y +  L      L++AF ++P+P Y          Q NE
Sbjct: 398 NPKVYFGYDWIKEEQLNYLEEYYTKNLADKHTDLSMAFIHIPLPEYLNFQSVRNDEQQNE 457

Query: 470 R-NLLPEGFDN---DDNLINYMHEMNIKALSCGFDHSNDCCLQS-----IHDIWLCYSGA 520
           +     EG      +    + + ++ + A+S G DH ND CL++        +WLCY GA
Sbjct: 458 KIGSFKEGITAPRYNSGTADVLVKLKVSAVSVGHDHCNDYCLETDFLSHSDSLWLCYGGA 517

Query: 521 TGLTAPHSI-FMPPSVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIYN 568
            G             +R+F+ +   K I +WKR +   D  +D+Q I++
Sbjct: 518 VGERGYAGYGGTERRIRIFEFNAKKKVINTWKRLHGSPDRKFDFQIIHD 566

>Skud_12.445 Chr12 complement(787532..789277) [1746 bp, 581 aa] {ON}
           YLR361C (REAL)
          Length = 581

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 142/295 (48%), Gaps = 37/295 (12%)

Query: 300 QSRIFISRIIDIERPDLVVITGDILDGNKSV-DYQTCILNVVQPIIRAQIPFVISFGAKD 358
           +++ FI +++DIE+P +VV TGD + G++S+ D +T +L  V P+I  +IP+ + +G  D
Sbjct: 283 KTKTFIQQVLDIEKPQMVVFTGDQIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHD 342

Query: 359 FSKYATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKDDYSNLITQNDLAIF 418
                T+ +++   + +PY L K   SN H T    F  + N     +S   T+  ++  
Sbjct: 343 DEGSLTRWQLSQLASALPYSLFK---SNIHDTQDNTFG-VGNYVHQVFSKDDTEAPVSTL 398

Query: 419 IFNS-----------------KTSKRQFFKDYI-SLYKSPPKLALAFQYLPIPTY----- 455
            F                   K S+ ++ ++Y   + KS  KL++AF ++P+P Y     
Sbjct: 399 YFLDSHKYSTAGKIYPGYDWIKESQWKYIEEYHDKVLKSKTKLSMAFFHIPLPEYLNTAS 458

Query: 456 --RLSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSNDCCLQ---SI 510
                   P+IG Y E    P+    +   I  +  + +  +SCG DH ND CL+   + 
Sbjct: 459 KTHAGEKNPLIGTYKEGVTAPK---YNSEGIATLDRLGVDVISCGHDHCNDYCLRDDSTP 515

Query: 511 HDIWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEVYDYQ 564
           +  WLCY G  G             +R++++D  + +I +WKR     + ++DYQ
Sbjct: 516 NRPWLCYGGGGGEGGYAGYGGTERRIRIYEIDISEDNIHTWKRLNGSPENLFDYQ 570

>NCAS0J01220 Chr10 complement(212622..214373) [1752 bp, 583 aa] {ON}
           Anc_4.200
          Length = 583

 Score = 98.2 bits (243), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 143/298 (47%), Gaps = 39/298 (13%)

Query: 304 FISRIIDIERPDLVVITGDILDGNKSV-DYQTCILNVVQPIIRAQIPFVISFGAKDFSKY 362
           F+ +++++E P LVV TGD + G++S+ D +T +L  + P+++ +IP+ + +G  D    
Sbjct: 285 FVKKVLELEDPQLVVFTGDQIMGDRSIQDSETTLLKAIAPVVKRKIPWAMVWGNHDDEGS 344

Query: 363 ATQQEITDFVNQIPYCL----NKNSDSNGHLTIPYNFSTIPNDSKDDY-------SNLIT 411
            T+ E+++    +PY L     K++ +N      Y      NDS D         S+  +
Sbjct: 345 LTRWELSELATNLPYSLFQIGTKDTKNNLFGVGNYYIQAQANDSDDLIATFYFLDSHKYS 404

Query: 412 QNDLAIFIFNSKTSKRQFFKDYISLYKSPPKL----------ALAFQYLPIPTY------ 455
           +  ++      K S+  +F+D   LY +  KL          ++AF ++P+P Y      
Sbjct: 405 KTKISPGYDWIKESQWDYFED---LYNNKLKLSIQSSHKLHVSMAFFHIPLPEYLNLDSK 461

Query: 456 -RLSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSNDCCLQSIHD-- 512
            R +    I+G + E    P     +   +N + ++ +   SCG DH ND CLQ      
Sbjct: 462 RRPNEQNQIVGTFKEGVTAPR---YNSGGLNVLQKLGVSVTSCGHDHCNDYCLQDDSTPS 518

Query: 513 -IWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIYN 568
            IWLCY G  G             +R++++D+   +I++WKR  +   E++DYQ I N
Sbjct: 519 FIWLCYGGGGGEGGYAGYGGTERRLRIYEIDSNKGTISTWKRLNSSPKEIFDYQIILN 576

>KLLA0B13134g Chr2 (1149114..1150811) [1698 bp, 565 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361C DCR2
           Protein involved in cell cycle regulation
          Length = 565

 Score = 98.2 bits (243), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 79/304 (25%), Positives = 141/304 (46%), Gaps = 61/304 (20%)

Query: 304 FISRIIDIERPDLVVITGDILDGNK-SVDYQTCILNVVQPIIRAQIPFVISFGAKDFSKY 362
           FI +++DIE+P +VV TGD + G++   D +T +L V+ P+I  +IP+ + +G  D    
Sbjct: 269 FIDQVLDIEKPQMVVFTGDQIMGDECKQDSETALLKVLAPVISRKIPWAMVWGNHDDEGS 328

Query: 363 ATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKD------DYSNLITQND-- 414
             + ++++F +++PY L               F   P DSKD      +Y   +   D  
Sbjct: 329 LNRWQLSEFASKLPYSL---------------FEIGPRDSKDNQFGLGNYVREVKGGDGT 373

Query: 415 --LAIFIFNS---------------KTSKRQFFKDYISLYKSPPK-------LALAFQYL 450
             +A++  +S               K  + ++ ++Y+  + S  +       +++AF ++
Sbjct: 374 TNIALYFLDSHKYSKSKAFPGYDWVKEEQWEYMEEYLESHDSIKQAKHSGDLISMAFFHI 433

Query: 451 PIPTYR----LSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSND-C 505
           P+P YR     SG   ++G Y E    P     +   +  +H++ +   S G DH ND C
Sbjct: 434 PLPEYRNFPQESGSNRVVGTYKEGITAPR---YNSEGVKTLHKLGVSVTSVGHDHCNDYC 490

Query: 506 CLQSIHD----IWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEV 560
            L   +D    IWLCY GA G             +R++++D + K I SWKR     +  
Sbjct: 491 LLDDFNDGEDKIWLCYGGAAGEGGYAGYGGTERRIRVYEIDALKKDIYSWKRLNGSPENT 550

Query: 561 YDYQ 564
           +D+Q
Sbjct: 551 FDHQ 554

>ZYRO0B07898g Chr2 (616796..618547) [1752 bp, 583 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361C DCR2
           Protein involved in cell cycle regulation
          Length = 583

 Score = 96.7 bits (239), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 89/312 (28%), Positives = 131/312 (41%), Gaps = 69/312 (22%)

Query: 304 FISRIIDIERPDLVVITGDILDGNKSV-DYQTCILNVVQPIIRAQIPFVISFGAKDFSKY 362
           F+  ++DIE+PD+V+ TGD + G++S  D +T +L  + P+I   IP+ + +G  D    
Sbjct: 283 FVEEVLDIEQPDMVIFTGDQIMGSRSKQDSETALLKTLAPVISKGIPWAMVWGNHDDEGT 342

Query: 363 ATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKD-------------DYSNL 409
             + E++ FVN +P  L               F   P D+ D             D+ N 
Sbjct: 343 LNRWELSKFVNDLPLSL---------------FMVGPKDTADNTFGVGNYFHQVMDFEN- 386

Query: 410 ITQNDLAIFIFNS----------------KTSKRQFFKDYI--SLYK-----SPPKLALA 446
             Q  L  +  +S                K  +  +FK      LY+       P L++A
Sbjct: 387 -RQPVLTFYFLDSHKYSTTGKIFPGYDWIKEDQWDYFKRIYDEKLYQHIRNTQKPHLSMA 445

Query: 447 FQYLPIPTY-------RLSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGF 499
           F ++P P Y       R     PIIG   E    P     D      +  MN++A SCG 
Sbjct: 446 FFHIPTPEYLHEASRERPGESNPIIGNPMEGVTAPR---YDSKAAAALAHMNVQAASCGH 502

Query: 500 DHSNDCCL---QSIHDIWLCYSGATGLTAP--HSIFMPPSVRLFKVDNIDKSITSWKRNY 554
           DHSND CL    S   IW CY GA G      H+      VR++  +  D +I +WKR  
Sbjct: 503 DHSNDYCLLDDSSPQKIWFCYGGAVGEGGYGDHNDGYERRVRIYHFETKDGNIYTWKRLN 562

Query: 555 NKIDEVYDYQYI 566
           +     +DYQ I
Sbjct: 563 SSPINYFDYQLI 574

>YLR361C Chr12 complement(847388..849124) [1737 bp, 578 aa] {ON}
           DCR2Phosphoesterase involved in downregulation of the
           unfolded protein response, at least in part via
           dephosphorylation of Ire1p; dosage-dependent positive
           regulator of the G1/S phase transition through control
           of the timing of START
          Length = 578

 Score = 96.3 bits (238), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/304 (25%), Positives = 145/304 (47%), Gaps = 37/304 (12%)

Query: 291 ENSAILGEFQSRIFISRIIDIERPDLVVITGDILDGNKSV-DYQTCILNVVQPIIRAQIP 349
           ++ A   + ++  F+ +++DIE+P LVV TGD + G++S+ D +T +L  V P+I  +IP
Sbjct: 271 KHEACKADPKTETFVQQVLDIEKPQLVVFTGDQIMGDRSIQDSETVLLKAVAPVIARKIP 330

Query: 350 FVISFGAKDFSKYATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKDDYSNL 409
           + + +G  D     T+ ++++  + +PY L K S  + H     N   + N     +SN 
Sbjct: 331 WAMVWGNHDDEGSLTRWQLSEIASVLPYSLFKFSPHDTH----DNTFGVGNYIYQIFSNN 386

Query: 410 ITQNDLAIFIFNS-----------------KTSKRQFFKDYISL-YKSPPKLALAFQYLP 451
            T+  +    F                   K S+ ++ +DY  +  K    L++AF ++P
Sbjct: 387 DTEVPVGTLYFLDSHKYSTVGKIYPGYDWIKESQWKYIEDYHDVNLKFKTGLSMAFFHIP 446

Query: 452 IPTY-------RLSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSND 504
           +P Y             P+IG Y E    P+    +   I  +  +++  +SCG DH ND
Sbjct: 447 LPEYLNIESKTHPGEKNPLIGMYKEGVTAPK---YNSEGITTLDRLSVDVVSCGHDHCND 503

Query: 505 CCLQ---SIHDIWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEV 560
            CL+   + + IWLCY G  G             +R+++++  + +I +WKR      E+
Sbjct: 504 YCLRDDSTPNKIWLCYGGGGGEGGYAGYGGTERRIRIYEINVNENNIHTWKRLNGSPKEI 563

Query: 561 YDYQ 564
           +D+Q
Sbjct: 564 FDFQ 567

>KNAG0B05860 Chr2 complement(1152991..1154748) [1758 bp, 585 aa]
           {ON} Anc_4.200 YLR361C
          Length = 585

 Score = 95.9 bits (237), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 82/325 (25%), Positives = 141/325 (43%), Gaps = 57/325 (17%)

Query: 289 NEENSAILGEFQSRIFISRIIDIERPDLVVITGDILDGNKS-VDYQTCILNVVQPIIRAQ 347
           ++     L + ++  F+  ++D E P LVV TGD + G+KS  D +T +L  + P++   
Sbjct: 263 SKSEGPCLADPKTLTFVESVLDTESPQLVVFTGDQIMGDKSRYDSETTLLKALAPVLERH 322

Query: 348 IPFVISFGAKDFSKYATQQEITDFVNQIPYCLNKNS---DSNGHLTIPYNFSTIPNDSKD 404
           IP+ + +G  D     ++ E++ F   +P  L K S     +    +   F  + +D+ +
Sbjct: 323 IPWCLVWGNHDDEGSLSRWELSRFAETLPLSLFKISPRDTGDSSFGVGNYFHQVFSDNGE 382

Query: 405 DYSNLITQNDLAIFIFNS----KTSK----------------RQFFKDYISLYKSPP--- 441
           +      +  + ++  +S    +T K                +Q +   I+ +       
Sbjct: 383 E------KPAITLYFLDSHKYSRTGKLYPGYDWIKEAQWDYVKQLYDKAIAPFADAATET 436

Query: 442 ----KLALAFQYLPIPTYRLSGVF----------PIIGQYNERNLLPEGFDNDDNLINYM 487
               +L++AF ++P+P Y   G F          P++GQ+ E    P+   N   L    
Sbjct: 437 SQERQLSMAFFHIPLPEY---GDFQSQSNPAEQNPMLGQHKEGLTAPK--YNSGGLTTLQ 491

Query: 488 HEMNIKALSCGFDHSNDCCLQ--SIHD-IWLCYSGATGLTAPHSIFMPP-SVRLFKVDNI 543
           H M ++A SCG DH ND CLQ  S  D IWLC+ G+ G  A          +R F  D  
Sbjct: 492 H-MRVQATSCGHDHCNDYCLQDDSTGDKIWLCFGGSAGEGAYAGYGGTERRIRTFNFDTT 550

Query: 544 DKSITSWKRNYNKIDEVYDYQYIYN 568
              I +WKR        +DYQ + +
Sbjct: 551 SGRIETWKRLNGSPQNAFDYQVLVD 575

>Kpol_472.15 s472 (43361..44950) [1590 bp, 529 aa] {ON}
           (43361..44950) [1590 nt, 530 aa]
          Length = 529

 Score = 94.7 bits (234), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 142/300 (47%), Gaps = 42/300 (14%)

Query: 297 GEFQSRIFISRIIDIERPDLVVITGDILDGNK-SVDYQTCILNVVQPIIRAQIPFVISFG 355
            +F++R FI  I++++RPDLVV TGD + G++ S+D  + +  VV PIIR +IP+ + +G
Sbjct: 235 ADFKTRTFIESILNLDRPDLVVFTGDQIMGSQCSLDATSALFKVVNPIIRRKIPWTMVWG 294

Query: 356 AKDFSKYATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPND-SKDDYSNLITQND 414
             D     ++ ++++    +PY + + +          NF T  N     +Y + I  +D
Sbjct: 295 NHDDEGSLSRVQLSNLAMSLPYSMFRYNP---------NFDTSDNTFGTGNYIHKIRASD 345

Query: 415 ---LAIFIF-------NSKTSKRQFFKDYISL---------YKSPPKLALAFQYLPIP-- 453
              LA  IF        +KT K +   D+I           Y +   L +AF ++P+P  
Sbjct: 346 GSPLASLIFLDSHKKATTKTGKVKLGYDWIKESQLNYVKENYGTETPLNMAFFHIPLPEF 405

Query: 454 --TYRLSGVF-PIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSNDCCL--- 507
             T    GV   I+G + E    P     +   ++ +  + ++ +  G DH ND CL   
Sbjct: 406 LNTKSDEGVKNVIVGLFKEGVTAPR---YNSGALDVLKSLKVQVVGVGHDHCNDYCLLEK 462

Query: 508 QSIHDIWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYI 566
              +  WLC+ GA G             VRL++++  D SI +WKR  +K  E ++ Q +
Sbjct: 463 SKKYGTWLCFGGAAGEGGYGGYGGTERRVRLYEINGKDLSIKTWKRLNSKPKEKFEEQLL 522

>Smik_12.448 Chr12 complement(786446..788188) [1743 bp, 580 aa] {ON}
           YLR361C (REAL)
          Length = 580

 Score = 95.1 bits (235), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 85/329 (25%), Positives = 154/329 (46%), Gaps = 63/329 (19%)

Query: 283 DIHIKGNEENSAILGEF----------QSRIFISRIIDIERPDLVVITGDILDGNKSV-D 331
           D+H+   E  S  L EF          +++IFI +++D E+P LVV +GD + G++S+ D
Sbjct: 257 DLHLGVGE--SECLDEFPKHEACKADPKTKIFIEQVLDNEKPQLVVFSGDQIMGDRSIQD 314

Query: 332 YQTCILNVVQPIIRAQIPFVISFGAKDFSKYATQQEITDFVNQIPYCLNKNSDSNGHLTI 391
            +T +L  V P+I  +IP+ + +G  D     T+ ++++  +++PY L K S        
Sbjct: 315 SETVLLKAVAPVIARKIPWAMVWGNHDDEGSLTRWQLSELASELPYSLFKFS-------- 366

Query: 392 PY----NFSTIPNDSKDDYSNLITQNDLAIFIFNS-----------------KTSKRQFF 430
           PY    N   + N     +SN  T+  ++   F                   K S+ ++ 
Sbjct: 367 PYDTQDNSFGVGNYIWQVFSNKSTELPVSTLYFLDSHKYSTVGKIYPGYDWIKESQWKYI 426

Query: 431 KDY----ISLYKSPPKLALAFQYLPIPTY-------RLSGVFPIIGQYNERNLLPEGFDN 479
           +DY    + L   P   ++AF ++P+P Y             P++G Y E    P+    
Sbjct: 427 EDYYHENLKLKTGP---SMAFFHIPLPEYLNVESKTHPGERNPLVGTYKEGVTAPK---Y 480

Query: 480 DDNLINYMHEMNIKALSCGFDHSNDCCLQ---SIHDIWLCYSGATGLTAPHSIFMPP-SV 535
           +   +N + ++ +  +SCG DH ND CL+   + + +WLCY G  G             +
Sbjct: 481 NSEGLNTLDKLGVDVISCGHDHCNDYCLRDDSTPNRLWLCYGGGGGEGGYAGYGGTERRI 540

Query: 536 RLFKVDNIDKSITSWKRNYNKIDEVYDYQ 564
           R+++++  + +I +WKR      E++DYQ
Sbjct: 541 RIYEINVGENNIHTWKRLNGSPREIFDYQ 569

>SAKL0B05038g Chr2 complement(434061..435833) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q05924 Saccharomyces cerevisiae
           YLR361C DCR2 Protein involved in cell cycle regulation
          Length = 590

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 89/312 (28%), Positives = 138/312 (44%), Gaps = 69/312 (22%)

Query: 304 FISRIIDIERPDLVVITGDILDGNK-SVDYQTCILNVVQPIIRAQIPFVISFGAKDFSKY 362
           FI+R++D E+P LVV TGD + GN+   D +T +L V++P+I  +IPF + +G  D    
Sbjct: 290 FINRVLDREKPHLVVFTGDQIMGNECKQDSETALLKVLEPVITRKIPFAMVWGNHDDEGS 349

Query: 363 ATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKDDYSNLITQNDLAIFIFNS 422
            ++ E++  V ++PY + + S  +              DSK    N I Q    IF   +
Sbjct: 350 LSRWEMSQIVAKLPYSIFRLSQHD------------TKDSKFGLGNYIQQ----IFTSEN 393

Query: 423 KTSKRQFFKDYISLYKSPPK-----------------------------------LALAF 447
           + +   +F D    Y S PK                                   L++AF
Sbjct: 394 QPAISLYFLDS-HKYSSNPKIFPGYDWIKEEQWDYMRNYYETNLKKANEAYGGNHLSMAF 452

Query: 448 QYLPIPTYR--LSGVFP-----IIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFD 500
            ++P+P Y    S   P     +IG Y E    P+    +   +  +H++ + A+S G D
Sbjct: 453 FHIPLPEYLHFQSQQEPDKQNLVIGNYKEGITAPK---YNSGGLKALHDLKVSAVSVGHD 509

Query: 501 HSNDCCL--QSI---HDIWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNY 554
           H ND CL   SI     IWLCY G  G             +R+F++D    SI +WKR  
Sbjct: 510 HCNDYCLLEDSISKDEKIWLCYGGGGGEGGYAGYGGTERRIRIFEIDTQGNSIYTWKRLN 569

Query: 555 NKIDEVYDYQYI 566
              DE++D+Q I
Sbjct: 570 GTPDEIFDHQTI 581

>NDAI0J01970 Chr10 complement(488882..490651) [1770 bp, 589 aa] {ON}
           Anc_4.200
          Length = 589

 Score = 92.4 bits (228), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 141/300 (47%), Gaps = 62/300 (20%)

Query: 304 FISRIIDIERPDLVVITGDILDGNKSV-DYQTCILNVVQPIIRAQIPFVISFGAKDFSKY 362
           FI  ++DIE P LV+ TGD + G+ S+ D +T +L  + P+I  ++ + + +G  D    
Sbjct: 306 FIESVLDIESPQLVIYTGDQIMGDLSIQDSETTLLKALSPVISRRLSWAMVWGNHDDEGS 365

Query: 363 ATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKD-------------DYSNL 409
            ++ ++++  + +P+ L             + FS  P D+ D             DYSN 
Sbjct: 366 LSRWQLSELASILPFSL-------------FQFS--PKDTNDNSFGVGNYVENIYDYSNE 410

Query: 410 ITQNDLAIFIFNS-KTSKR-QFFKDY-----------ISLYKSPPK---LALAFQYLPIP 453
           +    + ++  +S K SK  + F  Y            SL+ S P+   +++AF ++P+P
Sbjct: 411 LK---ITLYFLDSHKYSKNGKIFPGYDWIKEDQWEYMKSLHSSTPENKGISMAFFHIPLP 467

Query: 454 TY--RLSGVFP-----IIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSNDCC 506
            Y    S   P     I+GQ+ E    P+    +   ++ + E+ +   SCG DH ND C
Sbjct: 468 EYLDLDSKKVPSQQNEIVGQFKEGVTAPK---YNSGGLSTLQELGVTVTSCGHDHCNDYC 524

Query: 507 LQ---SIHDIWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEVYD 562
           L+   +   IWLCY G+ G  A          +R+F++D  D S+ +WKR      E++D
Sbjct: 525 LRDDSTPSMIWLCYGGSAGEGAYAGYGGTERRIRVFEIDTTDNSVYTWKRLNGSPSEIFD 584

>TDEL0E01730 Chr5 (333362..335086) [1725 bp, 574 aa] {ON} Anc_4.200
           YLR361C
          Length = 574

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/309 (26%), Positives = 133/309 (43%), Gaps = 64/309 (20%)

Query: 304 FISRIIDIERPDLVVITGDILDGNKSV-DYQTCILNVVQPIIRAQIPFVISFGAKDFSKY 362
           FI R++DIE PDLVV TGD + G++S+ D +T +L  V P IR +IP+ + +G  D    
Sbjct: 275 FIERVLDIESPDLVVYTGDQIMGDRSIRDSETSLLKAVAPAIRRKIPWAMVWGNHDDEGS 334

Query: 363 ATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKDD-------YSNLI---TQ 412
             +  ++ +V  +PY +               F   P D+KD+       +  +I   T 
Sbjct: 335 LGRWALSKYVESLPYSI---------------FQISPKDTKDNSFGVGNYFHQIIDPTTG 379

Query: 413 NDLAIFIF-----NSKTSK----------------RQFFKDYISLYKSPPK---LALAFQ 448
              A   F      S T K                R+ + + IS   + P    L++AF 
Sbjct: 380 KPAATLYFLDSHKYSTTGKVYPGYDWIKEAQWDYLRELYDEKISPSLAKPSQKHLSMAFF 439

Query: 449 YLPIPTY-------RLSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDH 501
           ++P+P Y         +   P++G   E  + P+   N    +++   + +   SCG DH
Sbjct: 440 HIPLPEYLDFDSQKEANNRNPLVGNSKEAVMAPKYNSNGKKTLDH---LGVSVTSCGHDH 496

Query: 502 SNDCCL---QSIHDIWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKI 557
            ND CL    +    WLCY G TG             VR++ +D  +  I +WKR     
Sbjct: 497 CNDYCLLDDSTSKKTWLCYGGGTGEGGYGGYGGTERRVRIYLLDGKNGDIHTWKRLNGNP 556

Query: 558 DEVYDYQYI 566
           +  +DYQ +
Sbjct: 557 NGYFDYQLM 565

>KAFR0A06210 Chr1 (1254374..1256119) [1746 bp, 581 aa] {ON}
           Anc_4.200 YLR361C
          Length = 581

 Score = 89.7 bits (221), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 132/298 (44%), Gaps = 42/298 (14%)

Query: 304 FISRIIDIERPDLVVITGDILDGNKSV-DYQTCILNVVQPIIRAQIPFVISFGAKDFSKY 362
           FI +++D E P LVV TGD + G++S+ D +T +L  + P+IR ++P+ + +G  D    
Sbjct: 290 FIEKVLDNESPQLVVFTGDQIMGDRSIQDSETTLLKALDPVIRRKLPWAMVWGNHDDEGS 349

Query: 363 ATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKDDYSNLITQNDLAIFIFNS 422
            ++ ++++   ++PY L + S  +       N   + N +K  ++    +  L    F  
Sbjct: 350 LSRWQLSELAAKLPYSLFEMSKYD----TKNNKFGVGNYAKQVFNGDNEEEGLITLYFLD 405

Query: 423 KTSKRQFFKDY-----------------------ISLYKSPPKLALAFQYLPIPTY---- 455
                Q  K Y                       +   K   +L++AF ++P+P Y    
Sbjct: 406 SHKYSQMGKIYPGYDWIKEEQLNYIEHEYNTKLLLKQSKQKKQLSMAFFHIPLPEYLNLN 465

Query: 456 ---RLSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSNDCCL---QS 509
              R     P++G++ E    P+    +   +  +  + ++  SCG DH ND CL    +
Sbjct: 466 SAKRAGENNPLVGEFKEGVTAPK---YNSGALEKLQSLGVQVTSCGHDHCNDYCLLDDST 522

Query: 510 IHDIWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYI 566
             DIWLC+ G+ G  A          +R++ ++    ++ +WK      +  +DYQ +
Sbjct: 523 SSDIWLCFGGSAGEGAYAGYGGTERRIRVYALNTERSTVYTWKLLNGSPNLPFDYQQL 580

>TBLA0D02020 Chr4 (503782..505713) [1932 bp, 643 aa] {ON} Anc_4.200
           YLR361C
          Length = 643

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 140/311 (45%), Gaps = 46/311 (14%)

Query: 304 FISRIIDIERPDLVVITGDILDGNK-SVDYQTCILNVVQPIIRAQIPFVISFGAKDFSKY 362
           F+S+++D E+P LVV +GD + G++   D +T +L  V P+I+  IP+ + +G  D    
Sbjct: 326 FVSQVLDEEQPQLVVFSGDQIMGDRCKADSKTALLKAVAPVIQRGIPWAMIWGNHDDEGS 385

Query: 363 ATQQEITDFVNQIPYCLNKNS--DSNGHLTIPYNFSTIPNDSKDDYSNLITQNDLAIFIF 420
             + EI++F   +P    + +  D++ +     N+     D++D     +TQ   A  ++
Sbjct: 386 MDRIEISEFAAALPGSQFQFTPFDTSDNTFGVGNYLLNVYDTQD-----VTQVTPAFTLY 440

Query: 421 NSKTSKRQFFKDYISLY--------------------KSPPKLALAFQYLPIPTYR---- 456
              + K      + + Y                      P  +++AF ++P+P YR    
Sbjct: 441 FLDSHKYATTGRFSAGYDWVKPKQLHYFQYQHDQLPPTEPQHISMAFLHIPVPEYRNLQS 500

Query: 457 -----LSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSNDCCLQ--- 508
                   + P +G + E    P     D   ++ + ++ I  +SCG DH ND CL+   
Sbjct: 501 NRPETRGELNPFVGNHKEPVTAPA---RDSGTLSMLQQLGISVVSCGHDHCNDYCLEDDS 557

Query: 509 SIHDIWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIY 567
           +  D+WLCY GA G             +R++++D     + +WKR    ++E  DYQ + 
Sbjct: 558 TGSDVWLCYGGAAGEGGYSGYGGTERRIRIYELDAKAGRVVTWKRRRGSMNEARDYQVLV 617

Query: 568 NQPKQK--HTP 576
           ++  +   H P
Sbjct: 618 DRETESDLHVP 628

>Suva_10.462 Chr10 complement(807033..808778) [1746 bp, 581 aa] {ON}
           YLR361C (REAL)
          Length = 581

 Score = 88.6 bits (218), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 140/298 (46%), Gaps = 35/298 (11%)

Query: 300 QSRIFISRIIDIERPDLVVITGDILDGNKSV-DYQTCILNVVQPIIRAQIPFVISFGAKD 358
           ++  F+ +++DIE P LVV TGD + G++S+ D +T +L  V P+I   IP+ + +G  D
Sbjct: 283 KTEAFVQQVLDIEAPQLVVFTGDQIMGDRSIQDSETALLKAVAPVISRGIPWAMVWGNHD 342

Query: 359 FSKYATQQEITDFVNQIPYCL--------NKNSDSNG---HLTIPYNFSTIPNDS----- 402
                T+ ++++  + +PY L          N+   G   H     N + +P  +     
Sbjct: 343 DEGSLTRWQLSELASTLPYSLFQFGIYDTKDNTFGVGNYVHQVFSKNDTEMPVSTLYFLD 402

Query: 403 KDDYSNLITQNDLAIFIFNSKTSKRQFFKDYI-SLYKSPPKLALAFQYLPIPTY--RLSG 459
              YS +        +I   K S+ ++ K Y     +   +L++AF ++P+P Y    S 
Sbjct: 403 SHKYSTVGKIYPGYDWI---KESQWEYMKKYYDETLEFKTELSMAFFHIPLPEYLNTESN 459

Query: 460 VFP-----IIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSNDCCLQ---SIH 511
             P     ++G Y E    P+   N + +   + ++ +  +SCG DH ND CLQ   +  
Sbjct: 460 THPGEKNALVGTYKEGVTAPKY--NSEGMAT-LEKLGVDVVSCGHDHCNDYCLQDDSTSS 516

Query: 512 DIWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIYN 568
            IWLCY G  G             +R+++++  + +I +WKR      E +DYQ + N
Sbjct: 517 LIWLCYGGGGGEGGYAGYGGTERRIRIYEINISENNIYTWKRLNGSPKEFFDYQSMLN 574

>CAGL0B02761g Chr2 (265971..267707) [1737 bp, 578 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361c
          Length = 578

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 139/311 (44%), Gaps = 66/311 (21%)

Query: 304 FISRIIDIERPDLVVITGDILDGNKSV-DYQTCILNVVQPIIRAQIPFVISFGAKDFSKY 362
           F+  ++DIE+P  VV +GD + G++S+ D ++ +   V P+IR +IP+ + +G  D    
Sbjct: 284 FVEEVLDIEKPGFVVFSGDQIMGDRSLQDSESVLYKAVDPVIRRRIPWAMVWGNHDDEGS 343

Query: 363 ATQQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKD------DYSNLI-TQND- 414
            ++ E++    ++PY                 F   P+D+KD      +Y++ I  +ND 
Sbjct: 344 LSRWELSKLAMKLPYS---------------RFQISPHDTKDNTFGVGNYAHQIFYENDP 388

Query: 415 ----LAIFIFN----SKTSKRQFFKDYI---------SLYKSPPK----------LALAF 447
               L+++  +    SKT K     D++         SLY+   K           A+ F
Sbjct: 389 EVAALSLYFMDSHKYSKTGKIYLGYDWLKEEQLEYIQSLYERGMKSHIKENIHRHAAMTF 448

Query: 448 QYLPIPTY-------RLSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFD 500
            ++P+P Y       R      +IG + E    P    N   L+  + ++ +  + CG D
Sbjct: 449 IHIPLPEYLNLDSKKRPGESNELIGTFKEGVTAPRY--NSGGLVA-LDKIGVDVVGCGHD 505

Query: 501 HSNDCCLQ----SIHDIWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYN 555
           H ND CL     S  +IWLCY G  G             +R +K D     IT+WKR  +
Sbjct: 506 HCNDYCLHDDSTSNKNIWLCYGGGAGEGGYAGYGGTERRIRTYKFDPQTGKITTWKRLNS 565

Query: 556 KIDEVYDYQYI 566
           K  E++D+Q +
Sbjct: 566 KPSEIFDFQIV 576

>KLTH0E10824g Chr5 (973337..975079) [1743 bp, 580 aa] {ON} similar
           to uniprot|Q05924 Saccharomyces cerevisiae YLR361C DCR2
           Protein involved in cell cycle regulation
          Length = 580

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 97/418 (23%), Positives = 172/418 (41%), Gaps = 67/418 (16%)

Query: 194 ILWSKIQHDSCLITNIQLYLGSNFVESRPFWKEIIHELHNEDGNSIPISITRKVECGFDA 253
           ++  K   +S  +T I +  G + V+ RP W+  + +    + + +P  +T +       
Sbjct: 176 VITEKSLTESDFVTEISVLFGEDCVDPRPAWR--LSKEWRLEHSKVPCYLTLRTRDSDPH 233

Query: 254 NHTFPKNTXXXXXXXXXXXXXXXXXXXXXDIHIKGNE--------ENSAILGEFQSRIFI 305
              FP                        D+H    E        ++   + + ++  F+
Sbjct: 234 GKKFP--------TLSASLENPFKIVQLADLHYSVGEGRCRDEFPKHENCIADPKTLAFV 285

Query: 306 SRIIDIERPDLVVITGDILDGNKSV-DYQTCILNVVQPIIRAQIPFVISFGAKDFSKYAT 364
            +++D E+P LVV TGD + G++ V D  T +L VV PII+ QIP+ + +G  D      
Sbjct: 286 EKVLDTEKPQLVVFTGDQIMGSECVQDSVTALLKVVDPIIKRQIPYAMVWGNHDDEGSLD 345

Query: 365 QQEITDFVNQIPYCLNKNSDSNGHLTIPYNFSTIPNDSKDDYSNLITQND----LAIFIF 420
           + EI+  V  +P  L K  D   H T   +F         +Y + I   D     A++  
Sbjct: 346 RWEISKLVQSLPLSLFKIGD---HDTNDNSFGV------GNYVHYIYGEDGNPLSALYFL 396

Query: 421 NS----------------KTSKRQFFKDYISLY-KSPPKLALAFQYLPIPTY-------R 456
           ++                K  +  FF  Y   +      L++AF ++P+P Y        
Sbjct: 397 DAHKYSPNAKAYPGYDWIKEEQWNFFDGYKDAFVDQKASLSMAFFHIPLPEYLNVDSSSS 456

Query: 457 LSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSNDCCL------QSI 510
                P+IG + E    P+    +   I  + E+ +K  S G DH ND CL       +I
Sbjct: 457 PGTQNPLIGNFKEGVTAPK---YNSKGIATLRELGVKVTSVGHDHCNDYCLLEDSQSPAI 513

Query: 511 HD-IWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYI 566
           ++ IWLC+ GA G             +R++++D   +SI +WK   +  +  +D+Q +
Sbjct: 514 NERIWLCFGGAAGEGGYGGYGGTERRIRVYQLDFSKRSIVTWKVLNSSPEAPFDHQTL 571

>Kwal_55.20333 s55 (355985..357718) [1734 bp, 577 aa] {ON} YLR361C -
           Hypothetical ORF [contig 150] FULL
          Length = 577

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/295 (28%), Positives = 135/295 (45%), Gaps = 35/295 (11%)

Query: 304 FISRIIDIERPDLVVITGDILDGNK-SVDYQTCILNVVQPIIRAQIPFVISFGAKDFSKY 362
           FI R++D+E+P LVV TGD + G++   D  T +L VV P+I  +IP+ + +G  D    
Sbjct: 281 FIERVLDLEKPQLVVFTGDQIMGDECRQDSLTALLKVVAPVIERKIPYAMVWGNHDDEGS 340

Query: 363 ATQQEITDFVNQIPYCLNKNSDSNGHLT-------IPYNFSTIPNDSKDDY---SNLITQ 412
             + E+++ V   PY L K S+ +           + Y +    N     Y   S+  + 
Sbjct: 341 LNRWELSELVKSFPYSLFKISEHDTQDNSFGVGNYMHYIYGKDGNPVSSLYFLDSHKYSP 400

Query: 413 NDLAI----FIFNSKTSKRQFFKDYISLYKSPPKLALAFQYLPIPTY-------RLSGVF 461
           N  A     +I   +    + F+D  S  K    L++AF ++P+P Y           + 
Sbjct: 401 NAKAYPGYDWIKEEQWKYLETFEDSFSDQKR--SLSMAFFHIPLPEYANFQSTQSPDYMN 458

Query: 462 PIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSNDCCL------QSIHD-IW 514
           P IG + E    P+    + N I  + ++ +KA S G DH ND CL      Q+  D IW
Sbjct: 459 PSIGSFKEGLTAPKF---NSNGIPTLRKLGVKATSVGHDHCNDYCLLDDSQSQANEDKIW 515

Query: 515 LCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIYN 568
           LC+ GA G             +R F++D   +SI SWK   +  +  +D Q + N
Sbjct: 516 LCFGGAAGEGGYAGYGGTERRIRTFQLDFEAQSIQSWKVLNSSPESRFDSQILVN 570

>ABL009W Chr2 (381100..382809) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR361C
          Length = 569

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 132/297 (44%), Gaps = 45/297 (15%)

Query: 304 FISRIIDIERPDLVVITGDILDGNKSV-DYQTCILNVVQPIIRAQIPFVISFGAKDFSKY 362
           F++ ++DIERPD+ V TGD + G+    D +T +L    P  +  IPF + +G  D +  
Sbjct: 284 FVNDVLDIERPDMAVYTGDQITGDLCDNDAETPLLKAFAPANQRWIPFAVIWGNHDDAGS 343

Query: 363 ATQQEITDFVNQIPYCLNKNS-------------------DSNGHLTIPYNFSTIPNDSK 403
             + +++ +V  +P+ L K                       NGH  I + F        
Sbjct: 344 LNRLQLSQYVEALPFSLFKIGPRDTMDRSFGMGNYVHQVLGENGHPEITFYFV------- 396

Query: 404 DDYSNLITQNDLAIFIFNSKTSKRQFFKDYISLYKSPPKLALAFQYLPIPTYR--LSGVF 461
           D +S         ++ +  K  + Q+F+D  +  +   +L+LAF ++P+P Y    S   
Sbjct: 397 DTHSYAPNPRGRRVYDW-VKEEQWQYFEDCHAKLEH-TELSLAFLHIPLPEYLDVKSKKD 454

Query: 462 P-----IIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSNDCCLQS-IHD--- 512
           P      +G + E    P    ++      +  + + A++ G DH ND CLQ+   D   
Sbjct: 455 PQKYNQFLGTFREGVTAPR---HNSGGAERLARLGVSAVTAGHDHCNDYCLQTDFRDIDP 511

Query: 513 -IWLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEVYDYQYIY 567
            IW+CY GA G             +R+F++D  +K I +WKR  +  ++ +D   IY
Sbjct: 512 KIWMCYGGAAGEGGYGGYGGTERRIRIFEIDTREKRIETWKRLNSSPNDKFDAHLIY 568

>TPHA0F01100 Chr6 complement(249205..250881) [1677 bp, 558 aa] {ON}
           Anc_4.200 YLR361C
          Length = 558

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 131/292 (44%), Gaps = 30/292 (10%)

Query: 300 QSRIFISRIIDIERPDLVVITGDILDGNK-SVDYQTCILNVVQPIIRAQIPFVISFGAKD 358
           ++++FI +++D+E+PDLV+ TGD + G++   D ++ +L VV PII  +I + + +G  D
Sbjct: 261 KTQVFIDKVLDLEQPDLVIFTGDQIMGDQCKKDSKSALLKVVGPIIARKIKWAMVWGNHD 320

Query: 359 FSKYATQQEITDFVNQIPYC---LNKNSDS-NGHLTIPYNFSTIPNDSKDDYSNLITQND 414
                 + E++     +PY    +N   D+ +    I      I  + K+   + I    
Sbjct: 321 DEGSLDRFELSQLAASLPYSTFRINAGIDTLDTTFGIGNYVQKIYKEEKNKPDSYIPIGS 380

Query: 415 LAIFIFNSKTSKR-QFFKDYISL-----------YKSPPKLALAFQYLPIPTY------R 456
           L IF+ + K SK  + F  Y  +           Y     L +AF ++P+P Y       
Sbjct: 381 L-IFMDSHKYSKSPKSFPGYDWIKPSQYNYIGKHYGLKTPLNMAFFHIPLPEYLNIKSES 439

Query: 457 LSGVFPIIGQYNERNLLPEGFDNDDNLINYMHEMNIKALSCGFDHSNDCCLQS---IHDI 513
                 I+G   E    P+   N   L     E+N++ +S G DH ND CL +       
Sbjct: 440 TGKENKIVGSGREGVTAPKY--NSGTLEFLKKELNVQLISVGHDHCNDYCLSNDDYGSKS 497

Query: 514 WLCYSGATGLTAPHSIFMPP-SVRLFKVDNIDKSITSWKRNYNKIDEVYDYQ 564
           WLCY G  G             +R+F++D    SI +WKR      + +D+Q
Sbjct: 498 WLCYGGGAGEGGYSGYGGTERRIRVFEIDFDKLSIETWKRKQTNSQDTFDHQ 549

>YAL010C Chr1 complement(134184..135665) [1482 bp, 493 aa] {ON}
           MDM10Subunit of both the ERMES complex that links the ER
           to mitochondria, and of the mitochondrial sorting and
           assembly machinery (SAM complex) that functions in
           import and assembly of outer membrane beta-barrel
           proteins
          Length = 493

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 92  DSSLYAIESNWLYETFFYV---HLFNTNANKEDEKQPLADIAVSRDPSLVPLTVLQEVMP 148
           D +LY+IESN  +   F+    HL  TN N  D+ +P++D  V  +P+     +L E +P
Sbjct: 297 DFNLYSIESNLSFGCEFWQKKHHLLETNKNNNDKLEPISDELVDINPNSRATKLLHENVP 356

Query: 149 SLRSS 153
            L S+
Sbjct: 357 DLNSA 361

>Smik_1.57 Chr1 complement(117182..118663) [1482 bp, 493 aa] {ON}
           YAL010C (REAL)
          Length = 493

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 92  DSSLYAIESNWLYETFFYV--HLFNTNANKEDEKQPLADIAVSRDPSLVPLTVLQEVMPS 149
           D +LY+IESN  +   F+   H    N N  D+ +P++   V  +P+     +L E +P+
Sbjct: 298 DFNLYSIESNLSFGCEFWQKKHHMAINGNNNDKLEPVSHELVDVNPNKKTTKLLHESVPN 357

Query: 150 LRSSD 154
           L+S D
Sbjct: 358 LKSID 362

>KLTH0G07128g Chr7 complement(569563..575151) [5589 bp, 1862 aa]
           {ON} similar to uniprot|P08964 Saccharomyces cerevisiae
           YHR023W MYO1 Type II myosin heavy chain required for
           wild- type cytokinesis and cell separation localizes to
           the actomyosin ring binds to myosin light chains Mlc1p
           and Mlc2p through its IQ1 and IQ2 motifs respectively
          Length = 1862

 Score = 32.3 bits (72), Expect = 3.9,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 388 HLTIPYNFSTIPNDSKDDYSNLITQNDLAIFIFNSKTSKRQFFKDYISLYKSPPK 442
           HL  P     + N   DD  N+ T + L +   N  ++ R + +DYISLY   PK
Sbjct: 70  HLNEPSVLHNLENRYADD--NIYTYSGLFLVAINPYSNIRIYTQDYISLYHGSPK 122

>TBLA0A06050 Chr1 (1490547..1493108) [2562 bp, 853 aa] {ON}
           Anc_6.241 YPL221W
          Length = 853

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 4/39 (10%)

Query: 376 PYCLNKNSDSNGHLTIPYNFSTIPNDSKDDYSNLITQND 414
           PY ++   + NGH T    ++++PN+ KD+ +NL+T ND
Sbjct: 809 PYNVDSTPELNGHST----WTSVPNNKKDEDTNLLTDND 843

>ZYRO0G15796g Chr7 (1290889..1290948,1291032..1295927) [4956 bp,
           1651 aa] {ON} similar to uniprot|P22082 Saccharomyces
           cerevisiae YOR290C SNF2 involved in the coordinate
           regulation of phospholipid synthesis transcriptional
           regulator
          Length = 1651

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 296 LGEFQSRI-FISRIIDIERPDLVVITGDILDG-NKSVDYQTCILNVVQP 342
           L EF  +   + R++D + PDLVV + D+    N+ VDYQ+   N ++P
Sbjct: 384 LSEFVEKTKEVGRVVDTDNPDLVVDSYDLPPTPNEMVDYQSLFPNAIKP 432

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,529,216
Number of extensions: 3134389
Number of successful extensions: 8931
Number of sequences better than 10.0: 50
Number of HSP's gapped: 9059
Number of HSP's successfully gapped: 64
Length of query: 578
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 463
Effective length of database: 40,294,809
Effective search space: 18656496567
Effective search space used: 18656496567
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)