Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A025305.477ON85485441590.0
ZYRO0D11308g5.477ON86875722350.0
TDEL0A034105.477ON83775421800.0
Smik_15.3205.477ON87376621410.0
YOR141C (ARP8)5.477ON88176621290.0
Suva_8.1925.477ON87976721130.0
Skud_15.3045.477ON88375321010.0
Kpol_543.105.477ON87675520070.0
NCAS0H022905.477ON86375619860.0
TPHA0J027905.477ON88275419560.0
CAGL0I07161g5.477ON83777018360.0
KAFR0E025305.477ON84279317930.0
Kwal_55.212505.477ON77574617580.0
SAKL0G03608g5.477ON79477417170.0
KNAG0B040205.477ON93479717110.0
KLTH0F14960g5.477ON77574616840.0
AFR135W5.477ON79177116690.0
Ecym_23115.477ON77577416320.0
NDAI0C013705.477ON97466116270.0
KLLA0E03213g5.477ON78878114650.0
TDEL0C031207.448ON438691048e-04
NCAS0B071302.117ON3811971030.001
TDEL0B068602.593ON46191990.003
Kpol_181.22.593ON463145970.006
ZYRO0F01122g2.593ON462204960.007
ABR084W2.593ON464165960.007
TBLA0B010702.117ON383105960.007
ZYRO0B04928g3.161ON391187950.008
Ecym_23062.593ON407153940.012
TBLA0H028002.593ON484144920.022
NCAS0A147207.448ON485203890.047
Suva_13.2022.593ON467101880.077
KLLA0E22925g2.117ON380105870.082
Suva_16.3647.448ON48071860.11
YMR033W (ARP9)2.593ON467101860.12
YPR034W (ARP7)7.448ON47769860.13
Smik_16.2787.448ON47669860.14
ACR184C7.448ON40163850.15
Skud_13.1892.593ON467101850.16
AFR051W2.117ON40578840.18
Ecym_63852.117ON377102830.28
ZYRO0F02772g8.23ON37536830.28
NDAI0G030408.23ON37536830.29
Skud_8.1902.117ON38472830.29
TPHA0D002508.23ON37536820.29
NCAS0C037008.23ON37536820.29
KNAG0L002508.23ON37536820.29
KAFR0D009408.23ON37536820.29
Kpol_1058.158.23ON37536820.29
TBLA0C004408.23ON37536820.29
CAGL0K05335g7.448ON52974830.30
TDEL0C004708.23ON37536820.30
CAGL0K12694g8.23ON37536820.30
Suva_6.188.23ON37536820.30
Smik_6.398.23ON37536820.30
YFL039C (ACT1)8.23ON37536820.30
Skud_6.318.23ON36036820.30
SAKL0B00968g8.23ON37536820.31
ABR222W8.23ON37636820.32
KNAG0H036502.117ON38772820.32
Ecym_15208.23ON37636820.33
Suva_15.3262.117ON38481820.38
TPHA0N014302.593ON472134820.39
TBLA0F004507.448ON48299810.43
Smik_13.2032.593ON467101810.54
Skud_16.3217.448ON47971790.74
ZYRO0G05676g2.117ON381129790.79
CAGL0H09042g2.117ON387167790.83
TDEL0B048102.117ON373105781.1
AGR099C8.251ON30571771.2
SAKL0E11814g2.117ON37978771.5
ZYRO0G17182g7.448ON46565762.1
KNAG0I001503.578ON1180133762.4
Smik_8.2102.117ON38472752.5
SAKL0B11220g2.593ON46663752.6
Smik_11.2642.521ON90044753.2
NDAI0B044602.117ON381160743.2
NCAS0G003405.690ON88793743.3
Kwal_33.146422.117ON383139733.9
SAKL0H17358g8.251ON311157724.3
KLTH0G04268g5.549ON146111695.4
YHR129C (ARP1)2.117ON38481716.8
NDAI0C005802.593ON50196717.4
Suva_4.2833.258ON33697717.5
TPHA0H014005.690ON95593718.2
KLTH0B05940g2.117ON38376708.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A02530
         (854 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.4...  1606   0.0  
ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {...   865   0.0  
TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {O...   844   0.0  
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...   829   0.0  
YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...   824   0.0  
Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON...   818   0.0  
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...   813   0.0  
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...   777   0.0  
NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {O...   769   0.0  
TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {...   758   0.0  
CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} simila...   711   0.0  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...   695   0.0  
Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141...   681   0.0  
SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {...   665   0.0  
KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.4...   663   0.0  
KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} simi...   653   0.0  
AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic ho...   647   0.0  
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...   633   0.0  
NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.4...   631   0.0  
KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {...   568   0.0  
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    45   8e-04
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    44   0.001
TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 4...    43   0.003
Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON} co...    42   0.006
ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp...    42   0.007
ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {...    42   0.007
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    42   0.007
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    41   0.008
Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}...    41   0.012
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    40   0.022
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    39   0.047
Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 ...    39   0.077
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    38   0.082
Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034...    38   0.11 
YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa] ...    38   0.12 
YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}  ARP7Compo...    38   0.13 
Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034...    38   0.14 
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    37   0.15 
Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 ...    37   0.16 
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    37   0.18 
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    37   0.28 
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    37   0.28 
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...    37   0.29 
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    37   0.29 
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...    36   0.29 
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...    36   0.29 
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...    36   0.29 
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...    36   0.29 
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    36   0.29 
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...    36   0.29 
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    37   0.30 
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...    36   0.30 
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...    36   0.30 
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...    36   0.30 
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...    36   0.30 
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...    36   0.30 
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    36   0.30 
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    36   0.31 
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...    36   0.32 
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    36   0.32 
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    36   0.33 
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    36   0.38 
TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2....    36   0.39 
TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.4...    36   0.43 
Smik_13.203 Chr13 (331960..331989,332074..333447) [1404 bp, 467 ...    36   0.54 
Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034...    35   0.74 
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    35   0.79 
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    35   0.83 
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    35   1.1  
AGR099C Chr7 complement(924366..925283) [918 bp, 305 aa] {ON} Sy...    34   1.2  
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    34   1.5  
ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} simi...    34   2.1  
KNAG0I00150 Chr9 complement(14436..17911,17999..18065) [3543 bp,...    34   2.4  
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    33   2.5  
SAKL0B11220g Chr2 (978268..978297,978363..979733) [1401 bp, 466 ...    33   2.6  
Smik_11.264 Chr11 complement(441359..444061) [2703 bp, 900 aa] {...    33   3.2  
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    33   3.2  
NCAS0G00340 Chr7 (57980..60643) [2664 bp, 887 aa] {ON} Anc_5.690...    33   3.3  
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    33   3.9  
SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa] ...    32   4.3  
KLTH0G04268g Chr7 (340594..341034) [441 bp, 146 aa] {ON} similar...    31   5.4  
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    32   6.8  
NDAI0C00580 Chr3 complement(110741..112246) [1506 bp, 501 aa] {O...    32   7.4  
Suva_4.283 Chr4 complement(502688..503698) [1011 bp, 336 aa] {ON...    32   7.5  
TPHA0H01400 Chr8 complement(313405..316272) [2868 bp, 955 aa] {O...    32   8.2  
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    32   8.9  

>TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.477
           YOR141C
          Length = 854

 Score = 1606 bits (4159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 802/854 (93%), Positives = 802/854 (93%)

Query: 1   MSEDQNSSADDQIGTPIGNTQEQGQDQDDDANSNYDSNEDSIDVQDLADDSTIDIKQXXX 60
           MSEDQNSSADDQIGTPIGNTQEQGQDQDDDANSNYDSNEDSIDVQDLADDSTIDIKQ   
Sbjct: 1   MSEDQNSSADDQIGTPIGNTQEQGQDQDDDANSNYDSNEDSIDVQDLADDSTIDIKQDSD 60

Query: 61  XXXXXXXXXXXKSEEKHNVISNXXXXXXXXXXXXXXNNDYGETPLADTKIPSKKNPKIDS 120
                      KSEEKHNVISN              NNDYGETPLADTKIPSKKNPKIDS
Sbjct: 61  NENENEDIGDDKSEEKHNVISNKVIIKRKPGRKRRPNNDYGETPLADTKIPSKKNPKIDS 120

Query: 121 SKNKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGLFQPAMLINQKNYS 180
           SKNKKFHLHLLEKRRLGR            QSGIEKIETLTVNPTGLFQPAMLINQKNYS
Sbjct: 121 SKNKKFHLHLLEKRRLGRLKAAEEFAKKLKQSGIEKIETLTVNPTGLFQPAMLINQKNYS 180

Query: 181 SDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEANQAAQDEDINLGDPSTTI 240
           SDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEANQAAQDEDINLGDPSTTI
Sbjct: 181 SDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEANQAAQDEDINLGDPSTTI 240

Query: 241 VIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELNDNFNYSKDQSEKFDEYKNE 300
           VIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELNDNFNYSKDQSEKFDEYKNE
Sbjct: 241 VIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELNDNFNYSKDQSEKFDEYKNE 300

Query: 301 LLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDIEDVNRWINDPQKKYFGSD 360
           LLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDIEDVNRWINDPQKKYFGSD
Sbjct: 301 LLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDIEDVNRWINDPQKKYFGSD 360

Query: 361 AIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLVHILTSDTFQLKTSDFSS 420
           AIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLVHILTSDTFQLKTSDFSS
Sbjct: 361 AIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLVHILTSDTFQLKTSDFSS 420

Query: 421 YKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQ 480
           YKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQ
Sbjct: 421 YKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQ 480

Query: 481 TRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTDLNINAAHDWILAEKLKK 540
           TRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTDLNINAAHDWILAEKLKK
Sbjct: 481 TRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTDLNINAAHDWILAEKLKK 540

Query: 541 DFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLAPLSLFYPQVLKLLKSEQLAK 600
           DFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLAPLSLFYPQVLKLLKSEQLAK
Sbjct: 541 DFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLAPLSLFYPQVLKLLKSEQLAK 600

Query: 601 YKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSETSDEISMLKRTLNIHLNLEE 660
           YKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSETSDEISMLKRTLNIHLNLEE
Sbjct: 601 YKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSETSDEISMLKRTLNIHLNLEE 660

Query: 661 IRDEIDKEHEIPNSNYTSLEKXXXXXXXXXXXXLDISKINSFYSNILLVGGGAKIPSLDF 720
           IRDEIDKEHEIPNSNYTSLEK            LDISKINSFYSNILLVGGGAKIPSLDF
Sbjct: 661 IRDEIDKEHEIPNSNYTSLEKAIIQSIANASASLDISKINSFYSNILLVGGGAKIPSLDF 720

Query: 721 ILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNYGKTNKTSEEEESLKKAIDELIKTE 780
           ILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNYGKTNKTSEEEESLKKAIDELIKTE
Sbjct: 721 ILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNYGKTNKTSEEEESLKKAIDELIKTE 780

Query: 781 FEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGASVLAQIKLVEELFVTTADWDM 840
           FEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGASVLAQIKLVEELFVTTADWDM
Sbjct: 781 FEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGASVLAQIKLVEELFVTTADWDM 840

Query: 841 HGSRILQHKCIFTY 854
           HGSRILQHKCIFTY
Sbjct: 841 HGSRILQHKCIFTY 854

>ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 868

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/757 (55%), Positives = 554/757 (73%), Gaps = 19/757 (2%)

Query: 113 KKNPKIDSSK---NKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGLFQ 169
           KK PK+D +K    KK  LHLLEKRRLGR            + GIEK+ET T+ PTGLFQ
Sbjct: 116 KKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQ 175

Query: 170 PAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGR------GEAN 223
           P +LINQKNYSSDYLKKD Q+FA+R+RK +R N Q   S+ NTPD  + +       E N
Sbjct: 176 PMILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVP-SMANTPDVADLKRENGNTTELN 234

Query: 224 QAAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVS-ELND 282
           +AA DEDI+L D +TT+VIHPGS  LK+G+A+D +P +IPSCVA+PK++  + +  +  +
Sbjct: 235 EAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMDQKN 294

Query: 283 NFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDI 342
              Y++DQ  +F+E K E+  SF+ERMRFYKRKVQ N HEQV++FNK SKPE + +KND 
Sbjct: 295 QTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDKNDY 354

Query: 343 EDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFL 402
             +N WI  P ++Y+G+DA+RCSK++F+IRYP + GGSFNI +P YR+L +L+ +    L
Sbjct: 355 NRIN-WITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFTGLL 413

Query: 403 VHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATC 462
            H+L S  FQLK S F+ YK+VLVI D+FEKSH+E + R L+ EMQF AVAI+QESLATC
Sbjct: 414 EHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATC 473

Query: 463 YGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYT 522
           YGAG+ +STCVVN+GATQTRIACVDEG++++DS ++LDYG DDITKLF++ LLQS FPY 
Sbjct: 474 YGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQ 533

Query: 523 DLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLAPL 582
           D +I  AH W LAE+LKK++ TF DANVTVQLYNFIKR+PGQ  +K++F+ F+EV+LAPL
Sbjct: 534 DWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVILAPL 593

Query: 583 SLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSETS 642
           SLFYP ++  L++E   + +NE+++ +LP SRDIFT  L+DW+S++Q +CL+  LY    
Sbjct: 594 SLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYCGNQ 653

Query: 643 DEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXXXXXLDISKINSF 702
           DE  ML + L+    L+E++ E   E +I   NY  LEK             D+SK++SF
Sbjct: 654 DEFQMLCKLLDAPSRLDELQAENRLEPDI-RQNYAPLEKAIVQSITNACLSFDVSKMSSF 712

Query: 703 YSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNY-----G 757
           YSNIL+ GGG+ +P+ DFIL DRI IWRPR+LS  SFP  YKKL+K IK++ N      G
Sbjct: 713 YSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNGEG 772

Query: 758 KTNKTSEEEESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWK 817
           K+N   +E+E LK+ + E+IK E E Y  ++E Q + D   PVS+LP PR++DPA LIWK
Sbjct: 773 KSN-GPQEDEQLKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIWK 831

Query: 818 GASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           GASVLAQIKLVEEL++T ADWD+HGSRILQ+KCIFTY
Sbjct: 832 GASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868

>TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {ON}
           Anc_5.477 YOR141C
          Length = 837

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/754 (54%), Positives = 550/754 (72%), Gaps = 22/754 (2%)

Query: 112 SKKNPKIDSSK---NKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGLF 168
           +KK+P++D +K    KK  LHLLEKRRLGR            Q GIEKIE+ T+  TGLF
Sbjct: 95  AKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLF 154

Query: 169 QPAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEANQ---- 224
           QP +LINQKNYSSDYLKKD QIFA+R RK +R N QT+ S+NNTPD  + +    +    
Sbjct: 155 QPVLLINQKNYSSDYLKKDEQIFALRERKTLRNNTQTS-SINNTPDVIDIKNTNTEVPDY 213

Query: 225 -AAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELNDN 283
            AA DEDI+L D +TT+VIHPGS+ L+IG+A+D  P+++PSCVA+PK       +ELND 
Sbjct: 214 IAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPK-------TELNDE 266

Query: 284 FNYS---KDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKN 340
           F  +   ++Q E+F+E K+ +  SF+ERMR+YKRKV  N HEQV+S+NKNSKP+ + ++N
Sbjct: 267 FQEAPLKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQN 326

Query: 341 DIEDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCE 400
           D   +N WI    K+Y+GS+A++CSKE F IR PF  GGSFN+ +P Y +L +L+++V  
Sbjct: 327 DPGAIN-WIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDVIS 385

Query: 401 FLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLA 460
            L H L+++   L+ + FS YK+VLVI D+F KSH+E   R LL EMQF AVAIIQESLA
Sbjct: 386 LLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLA 445

Query: 461 TCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFP 520
            CYGAG  SSTCVVN+GAT T IAC+DEG+++E+S+VSLDYGGDD+TKLF++ LLQS FP
Sbjct: 446 GCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFP 505

Query: 521 YTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLA 580
           Y D +IN++H WILAE+LKK + TF DANV VQLYNFIKRVP Q  ++YEF+ F+EV LA
Sbjct: 506 YQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYEFKVFDEVSLA 565

Query: 581 PLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSE 640
           PL+LFYP+++  L S+      N  V+ QLPASRDIFT+ +NDW+S++Q++CL+ +LYS 
Sbjct: 566 PLALFYPEIISYLHSKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYSG 625

Query: 641 TSDEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXXXXXLDISKIN 700
            ++   ++ + L++  + ++ + +   E +    NYT LEK            +D++K++
Sbjct: 626 NNNNQLIMSKLLDLQTSFDDFQSKPPMEAD-SRKNYTPLEKAIIQSITNASTPIDVAKMS 684

Query: 701 SFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNYGKTN 760
           SFYSNIL+VGGG+KIP+LDFIL DRI IWRPRLLS+ SFP FYKKL K  K++   GKT 
Sbjct: 685 SFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKTAGKTG 744

Query: 761 KTSEEEESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGAS 820
           ++ EE++S KK I+E+I  E +AY   +E Q  ++   PV++LP PR+MD AEL WKGA 
Sbjct: 745 ESEEEDQSSKK-INEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELAWKGAC 803

Query: 821 VLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           VLAQIKLVEEL++T+ DWD+HGSRILQ+KC+FTY
Sbjct: 804 VLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/766 (54%), Positives = 546/766 (71%), Gaps = 15/766 (1%)

Query: 99  DYGETPLADTKIPSKKNPKIDSSK---NKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIE 155
           D    P A T    KK PK+D +K    KK  LHLLEKRRLGR            + GIE
Sbjct: 113 DKRAQPTAQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIE 172

Query: 156 KIETLTVNPTGLFQPAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDF 215
           K+E  T+  TGLFQP MLINQKNYSSDYLKKD QIFA+R+RK +R N  T  S  NTPD 
Sbjct: 173 KVEATTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDV 232

Query: 216 QEGR----GEANQAAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKN 271
            + +     EAN A+ +E+I+L D + TIVIHPGS  +KIG+ +D +P+L+P+CVAVPK 
Sbjct: 233 IDLKNLPHSEANTASLNEEIDLNDSTATIVIHPGSNSVKIGFPKDEHPVLVPNCVAVPKK 292

Query: 272 QFLDTVSELNDNFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNS 331
                 SE ++ F+  ++QSEKF   K+++ K+F+ERMR+YKRKV  N HEQV+SFN+NS
Sbjct: 293 WLNLESSENDEIFSLQREQSEKFHSIKSDMEKNFRERMRYYKRKVPGNAHEQVISFNENS 352

Query: 332 KPEDVTEKNDIEDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTL 391
           KPE ++EKND   + +WI D  K Y+GSDA+RC  E FIIR PF  GGSFNI +PYY++L
Sbjct: 353 KPEIISEKNDPSPI-KWIFDDSKLYYGSDALRCVDEKFIIRKPF-KGGSFNINSPYYKSL 410

Query: 392 SELLSEVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNA 451
           +EL+S+V + L + L S+T  +K + F+ YK+VLVI DIF+KSH+E   R+LL E+QF A
Sbjct: 411 AELISDVTKLLEYALKSETLNVKPAKFNQYKVVLVIPDIFKKSHIETFIRVLLTELQFQA 470

Query: 452 VAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFS 511
           VAIIQESLATCYGAG+ +STCVVN+GA++TRIACVDEG+++E S ++LDYGGDDIT+LF 
Sbjct: 471 VAIIQESLATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAITLDYGGDDITRLFG 530

Query: 512 ILLLQSGFPYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEF 571
           + LLQS FP  D  IN+ H W+LAE+LKK+F TF DA+V VQLYNFI R P Q  +KYEF
Sbjct: 531 LFLLQSDFPLQDWKINSEHGWLLAEQLKKNFTTFQDADVAVQLYNFINRSPNQPTEKYEF 590

Query: 572 ETFEEVMLAPLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQAD 631
           + F+EVMLAPL+LF+PQ+ KL+++   +  KN  ++ QLP SRD+FT+ELNDW S++Q +
Sbjct: 591 KLFDEVMLAPLALFFPQIFKLIRT---SSDKNSSLEFQLPESRDLFTNELNDWNSLSQFE 647

Query: 632 CLNKNLYSETSDEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXXX 691
               NLY    D++ +LK+ L  H  +++++D+ +    I   N+  LEK          
Sbjct: 648 SKEGNLYCNLDDDLEILKKILQAHNMIDQLQDKPENYGNISKENFAPLEKAIIQSIANAS 707

Query: 692 XXLDISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIK 751
              D++++NSFYSNIL+VGG +KIP+LDFIL DRI IWRP LLS  SFP FYKKLTK IK
Sbjct: 708 ITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIK 767

Query: 752 ELPNY--GKTNKTSEEEE-SLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRN 808
           +L ++     +KT EE +  L++ I E +  E +     +E Q  N+  FP+SI+P PR+
Sbjct: 768 DLESHFVNAPDKTEEENKLVLQRQIKEKVVEELDEQHQNIENQNGNEHVFPISIIPPPRD 827

Query: 809 MDPAELIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           M+PA +IWKGASVLAQIKLVEELF+T  DWD+HGSRILQ+KCIFTY
Sbjct: 828 MNPALIIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 873

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/766 (53%), Positives = 547/766 (71%), Gaps = 15/766 (1%)

Query: 99  DYGETPLADTKIPSKKNPKIDSSK---NKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIE 155
           D    P   T    KK PK+D +K    KK  LHLLEKRRLGR            + GIE
Sbjct: 121 DKRAPPAVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIE 180

Query: 156 KIETLTVNPTGLFQPAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDF 215
           K+ET T+  TGLFQP MLINQKNYSSDYLKKD QIFA+R+RK +R N  +  S  NTPD 
Sbjct: 181 KVETTTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTSQISSTNTPDV 240

Query: 216 QEGRG----EANQAAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKN 271
            + +     EA+ A  +++I+L DP+ TIVIHPGS  +KIG+ +D +P+++P+CVAVPK 
Sbjct: 241 IDLKSLPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKK 300

Query: 272 QFLDTVSELNDNFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNS 331
                 SE  +N    ++QSE+F+  K+E+ K+F+ERMR+YKRKV  N HEQV+SFN+NS
Sbjct: 301 WLDLENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENS 360

Query: 332 KPEDVTEKNDIEDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTL 391
           KPE ++EKND   +  WI D  K Y+GSDA+RC  E F+IR PF  GGSFN+++PYY++L
Sbjct: 361 KPEIISEKNDPSPI-EWIFDDSKLYYGSDALRCVDEKFVIRKPF-RGGSFNVKSPYYKSL 418

Query: 392 SELLSEVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNA 451
           +EL+S+V + L H L S+T  +K + F+ YK+VLVI DIF+KSH+E   R+LL E+QF A
Sbjct: 419 AELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQA 478

Query: 452 VAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFS 511
           VAIIQESLATCYGAG+ +STCVVN+GA +TRIACVDEG+++E S ++LDYGGDDIT+LF+
Sbjct: 479 VAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFA 538

Query: 512 ILLLQSGFPYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEF 571
           + LLQS FP  D  I++ H W+LAE+LKK+F TF DA+V VQLYNF+ R P Q  +KYEF
Sbjct: 539 LFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEF 598

Query: 572 ETFEEVMLAPLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQAD 631
           + F+EVMLAPL+LF+PQ+ KL+++   + +KN  ++ QLP SRD+FT+ELNDW S++Q +
Sbjct: 599 KLFDEVMLAPLALFFPQIFKLIRT---SSHKNSSLEFQLPESRDLFTNELNDWNSLSQFE 655

Query: 632 CLNKNLYSETSDEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXXX 691
               NLY + +D++ +L R L+ H  +++++D+ +        N+  LEK          
Sbjct: 656 SKEGNLYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANAS 715

Query: 692 XXLDISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIK 751
              D++++NSFYSNIL+VGG +KIP+LDFIL DRI IWRP LLS  SFP FYKKLTK IK
Sbjct: 716 ITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIK 775

Query: 752 ELPNY--GKTNKTSEEEESLKKA-IDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRN 808
           +L  +     +KT +E + + +A I E I  E E     +E Q  N+  FPVSI+P PR+
Sbjct: 776 DLEGHYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRD 835

Query: 809 MDPAELIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           M+PA +IWKGASVLAQIKLVEELF+T +DWD+HGSRILQ+KCIFTY
Sbjct: 836 MNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881

>Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON}
           YOR141C (REAL)
          Length = 879

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/767 (53%), Positives = 551/767 (71%), Gaps = 17/767 (2%)

Query: 99  DYGETPLADTKIPSKKNPKIDSSK---NKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIE 155
           D    P A T    KK PK+D +K    KK  LHLLEKRRLGR            + GIE
Sbjct: 119 DKRAQPTAQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIE 178

Query: 156 KIETLTVNPTGLFQPAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDF 215
           K+E  T+  TGLFQP +LINQKNYSSDYLKKD QIFA+R+RK +R N  T  S  NTPD 
Sbjct: 179 KVEATTLPATGLFQPLLLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDV 238

Query: 216 QEGRG----EANQAAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKN 271
            + +     E + A  +++I+L DP+ TIVIHPGS  +KIG+ +D +PI++P+CVAVPK 
Sbjct: 239 VDMKSLPNSEPSTAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIVVPNCVAVPK- 297

Query: 272 QFLDTVSELND-NFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKN 330
           ++L+  ++ N+ N +  + QSE+F+  K+E+ K+F+ERMR+YKRKV  N HEQV+SFN++
Sbjct: 298 KWLNLANDQNEGNISLQRKQSEEFESIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNES 357

Query: 331 SKPEDVTEKNDIEDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRT 390
           SKPE V+ KND   +  WI D  K Y+GSDA+RC  E F+IR PF  GG FNI++PYY++
Sbjct: 358 SKPEVVSVKNDPSPI-EWIFDDSKLYYGSDALRCVDEKFVIRKPF-KGGCFNIDSPYYKS 415

Query: 391 LSELLSEVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFN 450
           L+EL+S+V + L + L S+T  +K + F+ YK+VLVI D+F+KSH+E   R+LL E+QF 
Sbjct: 416 LAELISDVIKLLEYALDSETLNVKPTKFNQYKVVLVIPDVFKKSHVETFIRVLLTELQFQ 475

Query: 451 AVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLF 510
           AVAIIQESLATCYGAG+ +STCVVN+GAT+TRIACVDEG+++E+S V+LDYGGDDIT+LF
Sbjct: 476 AVAIIQESLATCYGAGISTSTCVVNIGATETRIACVDEGTVLENSAVTLDYGGDDITRLF 535

Query: 511 SILLLQSGFPYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYE 570
           ++LLLQS FP  D  IN+ H W+LAE+LKK+F TF DA++ VQLYNFI R P +  +KYE
Sbjct: 536 ALLLLQSDFPLQDWKINSEHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNKPTEKYE 595

Query: 571 FETFEEVMLAPLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQA 630
           F+ F+EVMLAPL+LF+PQ+ KL+++      KN  ++ QLP SRD+FT+ELNDW S++Q 
Sbjct: 596 FKLFDEVMLAPLALFFPQIFKLIRA---PSGKNSSLEFQLPESRDLFTNELNDWNSLSQF 652

Query: 631 DCLNKNLYSETSDEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXX 690
           +    +LY   +D++ +L +TL+ H  +++++D+ +K       N T LEK         
Sbjct: 653 ESKEGDLYCNLNDDLKILNKTLDAHTMIDQLQDKPEKYGSTSKENLTPLEKAIIQSITNA 712

Query: 691 XXXLDISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLI 750
               D+++++SFYSNIL+VGG +KIP+LDFIL DRI IWRP LLS  SFP FYKKLTK I
Sbjct: 713 SVTADVTRMSSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSTSFPQFYKKLTKEI 772

Query: 751 KELPNY--GKTNKTSEE-EESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPR 807
           K+L ++      KT EE ++ L+  I+E +  E +     +E Q  N+  FP+SI+P PR
Sbjct: 773 KDLESHFVSAPEKTEEENKQVLQLQINEKVVAELDEQHQSIEHQNGNEHLFPISIIPPPR 832

Query: 808 NMDPAELIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           +M+PA +IWKGASVLAQIKLVEELF+T  DWD+HGSRILQ+KCIFTY
Sbjct: 833 DMNPALIIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 879

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/753 (53%), Positives = 545/753 (72%), Gaps = 17/753 (2%)

Query: 113 KKNPKIDSSK---NKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGLFQ 169
           KK PK+D +K    KK  LHLLEKRRLGR            + GIEK+E  T+  TGLFQ
Sbjct: 137 KKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGLFQ 196

Query: 170 PAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQE----GRGEANQA 225
           P MLINQKNYSSDYLKKD QIFA+R+RK +R N  T  S  NTPD  +       E + A
Sbjct: 197 PLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDVVDLKNLSHTEPSTA 256

Query: 226 AQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELN-DNF 284
             +++I+L DP+ TIVIHPGS  +KIG+ +D +PI++P+CVAVPK ++L+  +  N DN 
Sbjct: 257 PLNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIIVPNCVAVPK-KWLNLGNGPNEDNI 315

Query: 285 NYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDIED 344
           +  ++QS++F+  K+E+ K+F+ERMR+YKRKV  N HEQV+SFN+NSKPE ++EKND   
Sbjct: 316 SLQREQSDEFENIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISEKNDPSP 375

Query: 345 VNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLVH 404
           +  WI D  K Y+GSDA+RC  E F++R PF  GGSFNI +PYY +L+EL+S+V + L +
Sbjct: 376 I-EWIFDDSKLYYGSDALRCVDEKFVVRKPF-QGGSFNINSPYYESLAELISDVTKLLEY 433

Query: 405 ILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYG 464
            L S+T  +K++ F+ YK+VLVI D+F+K+H+E   R+LL E+QF AVA+IQESLATCYG
Sbjct: 434 ALASETLNVKSTKFNQYKVVLVIPDVFKKNHVETFIRVLLTELQFQAVAVIQESLATCYG 493

Query: 465 AGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTDL 524
           AG+ +STCVVN+GAT+TRIACVDEG+++E S V+L+YGGDDIT+LF++LLLQS FP  D 
Sbjct: 494 AGISTSTCVVNIGATETRIACVDEGTVLEHSAVTLNYGGDDITRLFALLLLQSDFPLQDW 553

Query: 525 NINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLAPLSL 584
            I+  H W+LAE+LKK+F TF DA++ VQLYNFI R P Q  +KYEF+ F+EVMLAPL+L
Sbjct: 554 KIDTKHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNQPSEKYEFKLFDEVMLAPLAL 613

Query: 585 FYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSETSDE 644
           F+PQ+ KL++S   +  KN  ++ QLP SRD+FT+ELNDW S++Q +    +LYS  +D+
Sbjct: 614 FFPQIFKLIRS---SSGKNSNLEFQLPESRDLFTNELNDWNSLSQFESKEGDLYSNLNDD 670

Query: 645 ISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXXXXXLDISKINSFYS 704
           + +L + L  H  +++I+D+ +   +    N+  LEK             D++++NSFYS
Sbjct: 671 LKILNKILEAHTIIDQIQDKPENYGDTSKENFAPLEKAIIQSIANASITADVTRMNSFYS 730

Query: 705 NILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNY--GKTNKT 762
           NIL+VGG +KIP+LDFIL DRI IWRP LLS  SFP FYKKLTK IK+L ++     +KT
Sbjct: 731 NILIVGGTSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLESHFVNAPDKT 790

Query: 763 SEE-EESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGASV 821
            EE ++ ++  I + +  E +     +E Q  N+  FPVSI+P PR+M+PA +IWKGASV
Sbjct: 791 EEENKQVMQSQIKDKVVAELDEQHQNIENQNGNEHLFPVSIIPPPRDMNPALIIWKGASV 850

Query: 822 LAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           LAQIKLVEELF+T  DWD+HGSRILQ+KCIFTY
Sbjct: 851 LAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 883

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/755 (49%), Positives = 527/755 (69%), Gaps = 27/755 (3%)

Query: 115 NPKIDSSKNKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGLFQPAMLI 174
           N    +++NKK   HLLEKRRLGR            ++GIE+++   +  TGLF   +L+
Sbjct: 134 NATPSTTENKKVPRHLLEKRRLGRLKAAEAFAAKLKKTGIERVDNSHLQQTGLFGQMLLV 193

Query: 175 NQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEANQAA-------- 226
           NQKN SSDYLKKD Q+FA+R RK +R N   +T+ N TPD  + +   N ++        
Sbjct: 194 NQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTAN-TPDVVDLKALNNGSSASLVDEVL 252

Query: 227 --QDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQ-FLDTVSELNDN 283
              D+DI+  DP+TTIVIHPGS++LKIG+A+D  P+++PSCVA+PKN  + + V EL+ +
Sbjct: 253 NKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLYSENVRELSID 312

Query: 284 FNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDIE 343
                + SE+    K +L +SF+ERMR+YKRK+Q N HE+V +FN+ +KPE V +KND  
Sbjct: 313 ---KIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHG 369

Query: 344 DVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLV 403
            +  WIN+  K YFG +A RC+KENFIIRYPF  GGS N+++PYY +L ELLS+V     
Sbjct: 370 RI-EWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLNLDSPYYSSLPELLSDVTRLFE 428

Query: 404 HILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCY 463
           + LT     +  +     K++LVI D+FEKSH+E ++R+LL EMQF AVAI+QESLA CY
Sbjct: 429 YALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACY 488

Query: 464 GAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTD 523
           GAG+ +++C+VN+GATQT IACVDEG+++E+S++ LDYGGDDIT+LF++ LL++ FP+ D
Sbjct: 489 GAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQD 548

Query: 524 LNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLAPLS 583
           L++++ H W LAE+LKK++ TF DAN+TVQLYNF+KR+PG++ +KYEF+ F+EV+LAPL+
Sbjct: 549 LDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFDEVILAPLA 608

Query: 584 LFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSETSD 643
           LFYP + + LK  +L       ++ QLP SRD++T  +NDW+S++Q  CL+ +LY+  ++
Sbjct: 609 LFYPDIFQELK--KLDSKNKFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGNTN 666

Query: 644 EISMLKRTLNIHLNLEEIRD----EIDKEHEIPNSNYTSLEKXXXXXXXXXXXXLDISKI 699
           E+ ++ + LNI+ + EE       E+D        NY  LEK            +D+SK+
Sbjct: 667 ELDIITKVLNINSSTEEYEGLETTEVDGRE-----NYVPLEKAIIQSITNACVSMDVSKM 721

Query: 700 NSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNYGKT 759
           N FY+NI++VGG + IP LDF+L DRI IWRP+ L   +FP F+K ++K +KE+ +  K 
Sbjct: 722 NQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSKA 781

Query: 760 NKTSEEEESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGA 819
           + T EEEE +K++I ELI+TE   Y   +E Q + D  +PV++LP PR+M+P  L WKGA
Sbjct: 782 STTPEEEEKIKQSIKELIETELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKGA 841

Query: 820 SVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           SVLAQIKL+EELFVT  DWDM GSRILQ+KC+FTY
Sbjct: 842 SVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876

>NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {ON}
           Anc_5.477 YOR141C
          Length = 863

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/756 (50%), Positives = 527/756 (69%), Gaps = 16/756 (2%)

Query: 111 PSKKNPKIDSSK---NKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGL 167
           P KK  K++ +K    KK  LHLLEKRRLGR            + GIEK+E++ V  TG+
Sbjct: 112 PQKKVQKVEPNKVPLGKKVPLHLLEKRRLGRIKAAKEFAKKLKEIGIEKVESVPVPMTGM 171

Query: 168 FQPAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTP---DFQEGRGEAN- 223
           FQP +LINQKNYSSDYL+KD QIFA+R RK +R N     S +NTP   D Q  R  +N 
Sbjct: 172 FQPLLLINQKNYSSDYLRKDEQIFALRERKTLRSNTTQNISSSNTPEVTDLQSVRETSNF 231

Query: 224 --QAAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELN 281
                 +++I L DP+TTIVIHPGS FLK+G+A D  P LIP+CVA+PK  F +T    +
Sbjct: 232 TTANGNNDEILLNDPNTTIVIHPGSSFLKVGFALDEVPELIPNCVALPKTDFNNTNIIKS 291

Query: 282 DNFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKND 341
              + + + +EKF+  K E+ +SF+ERMR+YKR++Q NGH+QV+SFN+ SKPE +  +ND
Sbjct: 292 KQTSVNIEDNEKFESLKAEMEESFEERMRYYKRRIQPNGHDQVVSFNRLSKPESLPVQND 351

Query: 342 IEDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEF 401
              ++ WI D  K+++G DA+RC+ ENFI RYPF  GGSFN  +  Y++L +LLS+V   
Sbjct: 352 PAHID-WITDGTKRFYGDDALRCTDENFIKRYPFKKGGSFNTSSNSYKSLQDLLSDVVGL 410

Query: 402 LVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLAT 461
           +   L+SD F +K+S FS YK+VLVI D FEKSH+E+  RLL+ E+QF AVAIIQESL+ 
Sbjct: 411 IEGTLSSDKFNIKSSQFSQYKVVLVIPDSFEKSHVELFIRLLVTELQFQAVAIIQESLSV 470

Query: 462 CYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPY 521
           CYG+G+G STCVVNVG+ +T +ACVDEG ++++S+++LDYG +D+TKLF+  LL   FPY
Sbjct: 471 CYGSGLGGSTCVVNVGSKETTVACVDEGIVLDNSLITLDYGSNDVTKLFAKFLLDCDFPY 530

Query: 522 TDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVP-GQIPQKYEFETFEEVMLA 580
            + ++N+   W LAE+L K  VTF DA++TVQL NFIKR P G   +K +F+ FEEVMLA
Sbjct: 531 KNWDLNSTEGWRLAEELMKQCVTFQDADITVQLSNFIKRTPRGNTVEKLDFKVFEEVMLA 590

Query: 581 PLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSE 640
           PL+LFYP++ KLL+S++ ++ +N +++ QLP SRDIFT ++NDW+S++Q DC+N   + +
Sbjct: 591 PLALFYPEIFKLLRSKE-SEEQNAELEYQLPPSRDIFTDKINDWRSLSQNDCINHQTFCD 649

Query: 641 TSDEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXXXXXLDISKIN 700
             DE  +LK+ ++    LE   D   +E +    N+T L+K            LD+SK+ 
Sbjct: 650 IHDEYELLKKAVDCPNTLETFMDNPPEEKK-STFNFTPLDKAIVESITTASLGLDVSKMA 708

Query: 701 SFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNYGKTN 760
           +FYSNIL+VGGG+KIP  D +L DR+ IWRPRLLS+ +F  FY++LTK +KEL +  KT 
Sbjct: 709 TFYSNILVVGGGSKIPGFDLMLMDRVNIWRPRLLSLRAFTHFYRELTKQLKELQSL-KTG 767

Query: 761 KTSEE--EESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKG 818
              EE  E+ L + I ELIKTE   Y  ++EQQ+ N+ F PV ++PSP  +DP  + WKG
Sbjct: 768 DGEEEIKEDELNEKISELIKTELTKYLEVIEQQSGNEHFLPVEVIPSPNEIDPGSIAWKG 827

Query: 819 ASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           ASVLAQIKLVEELF+T  DWD+HG+RILQ+K I TY
Sbjct: 828 ASVLAQIKLVEELFITNGDWDVHGNRILQYKSILTY 863

>TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {ON}
           Anc_5.477 YOR141C
          Length = 882

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/754 (50%), Positives = 512/754 (67%), Gaps = 29/754 (3%)

Query: 125 KFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGLFQPAMLINQKNYSSDYL 184
           K    +LE+RRLGR            ++GIEK E   +  TGLF+P  L+NQKN SSDYL
Sbjct: 134 KMSTSVLERRRLGRQRAAAAYAIKLQKTGIEKKENDNIQSTGLFRPIPLVNQKNCSSDYL 193

Query: 185 KKDSQIFAMRNRKEIRENAQTTTSLN------------NTP---DFQEGRGEANQAAQDE 229
           K +SQIFA+R RK +R N       +            NTP   D +    E+N +  DE
Sbjct: 194 KTNSQIFALRERKVLRNNTNIININSGNNSNSTSGTTANTPEVSDLKNVNSESNVSLIDE 253

Query: 230 --------DINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELN 281
                   +I   DP+TTIVIHPGS++LKIG+A+D +P++IP+CVA PKN      SE  
Sbjct: 254 TILKNNPDNIVFDDPTTTIVIHPGSRYLKIGFAKDDSPLVIPNCVAFPKNSLY---SENV 310

Query: 282 DNFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKND 341
           +    SK++S+ F   KN++ +SF++RMR+YKRK+Q N HE+V SFN  SKPE V +K +
Sbjct: 311 EETIVSKEESDNFKTKKNQIQQSFRDRMRYYKRKIQNNSHERVRSFNIQSKPEKVEDKTE 370

Query: 342 IEDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEF 401
              V  WI +P K Y+G +A RCSK+ FIIRYPF+ GGSFNI +PYY +L E++ ++   
Sbjct: 371 YNRV-EWITNPDKIYYGEEASRCSKDAFIIRYPFVKGGSFNITSPYYNSLPEIIGDISNL 429

Query: 402 LVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLAT 461
             + L+ D F LK S++S YKI+LVI DIFEKSHLE MFR+LL EM+F AVAI+QESLA 
Sbjct: 430 FEYALSQDRFNLKPSEYSKYKIILVIPDIFEKSHLETMFRVLLKEMKFQAVAIMQESLAA 489

Query: 462 CYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPY 521
            YGAG+G +TC+VN+GATQTR+AC+DEG++ E S+++LDYGGDDITKLF  LLLQ+ FPY
Sbjct: 490 SYGAGIGGATCIVNIGATQTRVACIDEGTVSEHSLITLDYGGDDITKLFLHLLLQNEFPY 549

Query: 522 TDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLAP 581
            DL+IN++H W   E LKK FVTF DAN+TVQLYNFIK  PG   +K EF+ F+EV+ AP
Sbjct: 550 QDLDINSSHGWRQIENLKKQFVTFEDANITVQLYNFIKNKPGAQAEKLEFKVFDEVINAP 609

Query: 582 LSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSET 641
           L LFYP++ +++  E   +  N++++ QLP S D++T E +DW+S++Q  CL+ + YS  
Sbjct: 610 LGLFYPEIFRIMAEENEKRRVNKKLQDQLPPSTDLYTEERDDWRSLSQVQCLDNDTYSGN 669

Query: 642 SDEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXXXXXLDISKINS 701
            +++ ++ + LN +LNL+++ D I+ +      NYTSL+K            +D SK+  
Sbjct: 670 DNDLDVITKLLNANLNLDDM-DLINNDQNENEKNYTSLDKAIIQSITNAVVTMDTSKMTQ 728

Query: 702 FYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNYGKT-N 760
           FY+NI++VGG + IPSLDFIL DRI IWRPR+LS   FP+F++ L K +K+     K+ N
Sbjct: 729 FYNNIMVVGGSSSIPSLDFILTDRINIWRPRILSSREFPSFFRNLVKQVKDFNTANKSNN 788

Query: 761 KTSEEEESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGAS 820
           +  E EE  KK I ELIKTE + Y   LE Q +N+   PVS+LP P +MDP+ L WKGAS
Sbjct: 789 RPEEGEEEQKKGIAELIKTELKKYKDNLESQNANEHLLPVSVLPPPADMDPSVLNWKGAS 848

Query: 821 VLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           VL Q+KL+EEL+VT ADWDM GSRILQ+KC+F Y
Sbjct: 849 VLGQLKLIEELYVTNADWDMLGSRILQYKCLFPY 882

>CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141c ARP8
           Actin-related protein
          Length = 837

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/770 (47%), Positives = 506/770 (65%), Gaps = 38/770 (4%)

Query: 113 KKNPKIDSSK---NKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGLFQ 169
           +K P +D  K    KK  LHLLEKRRLGR              GIE++E L +  +GLF 
Sbjct: 78  QKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFS 137

Query: 170 PAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEANQAAQD- 228
           P  LINQKNYSSDYL+KD   FA+R RK++R +    ++   T +   G   A+ A+   
Sbjct: 138 PVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGSGAQSASMASSAS 197

Query: 229 --------------EDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFL 274
                         EDI+  DP  TIVIHPGS  +KIG A D  P+ IP+ VAVP++Q +
Sbjct: 198 LDALVDTDTKLQSVEDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQVV 257

Query: 275 DTVSELNDN-FNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKP 333
           + V E   N  N   D  ++F E  N+L  +FKERM++YKRK+Q+N HEQV SFN NSKP
Sbjct: 258 NPVDETPVNVLNIELD--DQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKP 315

Query: 334 EDVTEKNDIEDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSE 393
           E+V++KND   ++ WI +  KKY+G DA RC  + FI+R PF   G FN+E+  Y ++ +
Sbjct: 316 EEVSDKNDQGKID-WIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQD 374

Query: 394 LLSEVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVA 453
           LL +V E +   L+SD F +  S++  YK V+VI D+F+KSHLE   RLLLNEM F +VA
Sbjct: 375 LLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVA 434

Query: 454 IIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSIL 513
           ++QESLATCYGAG+ + TCVVN+GA Q RIACVD+G+I++DS V+LDYGG+D+T L +IL
Sbjct: 435 LMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAIL 494

Query: 514 LLQSGFPYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFET 573
           L QS FPY + N++  + W  AE  KK FVTF DA++ VQL+NFIKRVPG   +KY+F+ 
Sbjct: 495 LQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSEKYDFKV 554

Query: 574 FEEVMLAPLSLFYPQVLKLLKSEQ--LAKYKNEQVKKQLPASRDIFTSELNDWKSIAQAD 631
           F+EV+LAPL LFYP++ K ++  Q   AK     + KQ+  SRDI+T+ LNDW+SI Q D
Sbjct: 555 FDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRD 614

Query: 632 CLNKNLYSETSDEISMLKRTLNIHLNLEE-----IRDEIDKEHEIPNSNYTSLEKXXXXX 686
           C    +Y +  D++ +++  L+++ ++E+     I +  DK+  +P      L+K     
Sbjct: 615 CEENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIEENTDKKCFVP------LDKAIVQS 668

Query: 687 XXXXXXXLDISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKL 746
                  +DISKI+ FYSNI++VGGGA IP+LDFIL DRI IWRP +L ++SFP FYK L
Sbjct: 669 ITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSL 728

Query: 747 TKLIKELPNYGKTNK--TSEEEESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILP 804
           TK +K++    K+N    S+E+E  +++I  L+K E +     LE   S D FF V +LP
Sbjct: 729 TKQLKDIQTSNKSNTGDKSQEQEVAERSI-ALVKVELDKLVASLEIPNSGDHFFTVGVLP 787

Query: 805 SPRNMDPAELIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           +PRN+DP+ L WKGASVLAQIKL+EEL+++  DWD+HG+R+LQ+KCIF Y
Sbjct: 788 APRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/793 (47%), Positives = 504/793 (63%), Gaps = 72/793 (9%)

Query: 100 YGETPLADTKIPSKKNPKIDSSKNKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIET 159
           YG+T +A TK+P                 HLLE+RR+GR            + GIEKIE 
Sbjct: 84  YGKT-MAGTKVPK----------------HLLERRRIGRIKAAEAFAKKLKKIGIEKIEN 126

Query: 160 LTVNPTGLFQPAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGR 219
           +T+  TGLFQP  LINQKNYSSDY++KD QIFA+R RK +R +     +  +TP   +  
Sbjct: 127 ITLPQTGLFQPLNLINQKNYSSDYIRKDDQIFALRERKTLRSSTNANNNNTSTP---KAV 183

Query: 220 GEANQAAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPK---NQFLDT 276
            +      D++I+L DP++TI+I PGS+ +KIG+A D  P+LIP+ VA+PK   ++   T
Sbjct: 184 VDLKTGVMDDEIDLNDPNSTIIIQPGSETMKIGFALDETPLLIPNLVAIPKKDDSKGPST 243

Query: 277 VSELNDNFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDV 336
            S+LN       +QSE+F++ KNEL  +FKERMR+YKR++Q N HEQV SFN+N++PE +
Sbjct: 244 ESKLN------TEQSEEFEDLKNELHSTFKERMRYYKRRIQPNSHEQVKSFNRNAQPETI 297

Query: 337 TEKNDIEDVNRWINDPQKKYFGSDAIRCSKENFIIRYPF---INGGSFNIEAPYYRTLSE 393
            + ND   + RWI    K Y+G+DA+ C +  F  R PF    NG  FN+    Y ++ E
Sbjct: 298 LDNNDPARI-RWITQNDKVYYGNDALLCPESFFSHRKPFGTCRNGALFNLMGSSYSSVQE 356

Query: 394 LLSEVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVA 453
           LL +V + L+    +   + K  D   YK +LVI D+FEKSH+E M RLLL E+ FNAVA
Sbjct: 357 LLGDVIK-LIEFGLNKLLEAKNKD--KYKAILVIPDLFEKSHVEEMIRLLLTELPFNAVA 413

Query: 454 IIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSIL 513
           IIQESLATCYGAG+ +STCVVNVGA++T ++C+DEG ++E+S+++L+YGGDDIT+LFS+L
Sbjct: 414 IIQESLATCYGAGISTSTCVVNVGASETSVSCIDEGVVLENSLINLNYGGDDITRLFSVL 473

Query: 514 LLQSGFPYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFET 573
           L  + FPY D N+ +   W +AE LKK  VT  DA+VTVQL NF+KRV  +  +KYEF+T
Sbjct: 474 LKMNNFPYQDWNVESIAGWNIAETLKKQIVTLQDADVTVQLSNFMKRVFNEPTEKYEFKT 533

Query: 574 FEEVMLAPLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCL 633
           F+EVMLAPL+LF P++   L++E+    KN  ++ QLP S+D+FT ELNDW+S+ Q  C 
Sbjct: 534 FDEVMLAPLALFAPRIFSYLRNEE---SKNSTLQYQLPESKDLFTHELNDWRSMTQEACK 590

Query: 634 NKNLYSETSDEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXXXXX 693
           N   Y + SDE+ +L   L +   LE  + E     +    N   L+K            
Sbjct: 591 NNGSYCDISDELQLLTALLEVDSKLEAFQSEATTTLD-NKRNMLPLDKAIIQSITDACLS 649

Query: 694 LDISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKEL 753
           LD SK++SFYSNIL+VGG + IP+ DF+L DRI IWRPRLLS++SFP FYK L+K IK+L
Sbjct: 650 LDPSKMDSFYSNILVVGGSSNIPAFDFMLTDRINIWRPRLLSLSSFPQFYKNLSKEIKDL 709

Query: 754 ------------------PNYGKTNKTS--------------EEEESLKKAIDELIKTEF 781
                             P  G +   +              E  + L   I++LIKT+ 
Sbjct: 710 EMESQSTAKLQAQTGSVVPTTGSSTPLATNAGNDGETMADLNEVSKKLSSNINDLIKTKL 769

Query: 782 EAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGASVLAQIKLVEELFVTTADWDMH 841
           + Y   +E Q SN+ +FPV ++P PR+M  A L WKGASVLAQIKLVEELF+T  DWDMH
Sbjct: 770 QDYISNVESQNSNEHYFPVGVVPPPRDMSAAILSWKGASVLAQIKLVEELFITNLDWDMH 829

Query: 842 GSRILQHKCIFTY 854
           GSRILQHKCIFTY
Sbjct: 830 GSRILQHKCIFTY 842

>Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141C
           (ARP8) - actin-related protein [contig 130] FULL
          Length = 775

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/746 (47%), Positives = 485/746 (65%), Gaps = 29/746 (3%)

Query: 114 KNPKIDSSKNKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGLFQPAML 173
           K P     +N K   HLLEKRRLGR              GIEK +   ++  GLF+P  L
Sbjct: 54  KKPDPQVKQNTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSL 113

Query: 174 INQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEANQAAQDEDINL 233
           INQKNYSSDYLK+D QIFAMR RK +R NA  + S  + PD      + +Q + D D  L
Sbjct: 114 INQKNYSSDYLKRDDQIFAMRERKSLR-NATASQSTPDMPD------DDDQESVDGDSEL 166

Query: 234 GDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELNDNFNYSKDQSEK 293
                TIVIHPGSK LKIG+A D  P  IPSCVAVPK         L        D +E+
Sbjct: 167 N----TIVIHPGSKSLKIGFATDVLPQSIPSCVAVPKRS-----QSLQGETKQPHD-TEE 216

Query: 294 FDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDIEDVNRWINDPQ 353
           + E K+ + + FKERMR+YKRK+  N H+ V++FN    PE + E ND+  ++ WI+ P 
Sbjct: 217 YQETKDSIQQDFKERMRYYKRKIIPNSHDIVVNFNSRVSPEIIPEHNDLHRID-WIDQPS 275

Query: 354 KKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLVHILTSDTFQL 413
           + Y+G +A RC   +F +R+PF  G  FNIE+P Y +L ELL++VCE L   L+     +
Sbjct: 276 RPYYGKEATRCLPSHFTVRHPFWKG-RFNIESPDYSSLQELLNDVCELLKFALSQPKIDV 334

Query: 414 KTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCV 473
           K S  S+YK+V+V+ D+++K+++E   RLLL ++ F AVAIIQESLA+CYGAG+G STCV
Sbjct: 335 KPSQISNYKVVIVVPDLYDKAYVETFIRLLLVDLNFQAVAIIQESLASCYGAGIGESTCV 394

Query: 474 VNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTDLNINAAHDWI 533
           V++GAT T+IACVDEG + E+SI++LDYGGDDIT+LF+  LL+S FPY DL++++   W 
Sbjct: 395 VDIGATTTKIACVDEGLVNENSIINLDYGGDDITRLFARFLLESNFPYQDLDLDSPQGWS 454

Query: 534 LAEKLKKDFVTFHDANVTVQLYNFIKRVPGQI-PQKYEFETFEEVMLAPLSLFYPQVLKL 592
           L E+LK+ + TF DA+VT+QLYNFIKR+PG+   +K+EF+ F+EVM AP+ LF+P V  L
Sbjct: 455 LVEQLKEKYTTFQDADVTIQLYNFIKRIPGKPGAEKFEFKVFDEVMTAPMGLFFPHVFPL 514

Query: 593 LKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSETSDEISMLKRTL 652
           LK +      NE VK QLP S+D+FT + N+ KS++Q  C  KN Y +   ++ +L++ L
Sbjct: 515 LKEQN--NPTNEYVKSQLPRSKDMFTCKDNNLKSVSQLACQKKNTYCDMGRDLDILQKLL 572

Query: 653 NIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXXXXXLD--ISKINSFYSNILLVG 710
           N+   +EE +       E     YT+LEK            LD   +K   FYSNIL+VG
Sbjct: 573 NLPSEIEEYQSAASANVE---PAYTALEKAIIESITNACVSLDNNHAKAAQFYSNILVVG 629

Query: 711 GGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNYGKTNKTSEEEESL- 769
           G +K PSLDFIL DRI IWRPRLLSVN+ PTF+ +++K +KE     K ++  EEEE L 
Sbjct: 630 GSSKFPSLDFILTDRINIWRPRLLSVNTLPTFHNQVSKQVKEFEQTNKLSEIKEEEELLS 689

Query: 770 -KKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGASVLAQIKLV 828
            KK + + IK E ++Y   ++    N+S FP+++LP+PR MDPA L WKG SV A++KL+
Sbjct: 690 QKKKLAKTIKMELQSYWEGVDALGGNESVFPINVLPAPREMDPALLTWKGGSVFARLKLI 749

Query: 829 EELFVTTADWDMHGSRILQHKCIFTY 854
           EEL+V+  DWD+  SRILQ+KCIF Y
Sbjct: 750 EELYVSANDWDVLNSRILQYKCIFDY 775

>SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 794

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/774 (46%), Positives = 499/774 (64%), Gaps = 41/774 (5%)

Query: 103 TPLADTKIPSK-----KNPKIDSSKNKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKI 157
           TPL+ T +P       K P       KK  +HLLEKRRLGR              GIEK 
Sbjct: 40  TPLSMTPVPPATSGKVKKPDTHIPPGKKVPMHLLEKRRLGRIKAAEEFAKKLKTIGIEKR 99

Query: 158 ETLTVNPTGLFQPAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSL-------- 209
           +   +  TGLF+P +LINQKNYSSDYLKKD QIFAMR RK +R       +         
Sbjct: 100 DNSALQQTGLFKPLLLINQKNYSSDYLKKDDQIFAMRERKSLRNPNSGNGNGNTGNNAVS 159

Query: 210 NNTPDF---QEGRGEANQAAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCV 266
           N TP+    +E   + + A   +D+N      TIVIHPGSKFLKIG+A D  P  +PSC+
Sbjct: 160 NATPEVIPEEEDNDDNDDAEGTDDLN------TIVIHPGSKFLKIGFATDVLPQSVPSCI 213

Query: 267 AVPKNQFLDTVSELNDNFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLS 326
           A+P+       +  N   +    +  +FD  K+ + + FKERMR+YKRKV  N H+ V++
Sbjct: 214 AIPR-------ATKNSVRSPQIREPSEFDGLKSAIQQDFKERMRYYKRKVIPNAHDAVIN 266

Query: 327 FNKNSKPEDVTEKNDIEDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAP 386
           FN   +PE + E ND+  V  WI +   +++G +A RC   +F +RYPF  G SFN+E+P
Sbjct: 267 FNSKVEPELIHEHNDLHRV-EWIQNGSNQFYGEEATRCLPSHFTLRYPFARG-SFNVESP 324

Query: 387 YYRTLSELLSEVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNE 446
           YY +  ELL +V   L + L  +   +    F++YKIVLVI D+++K+++E    LLL +
Sbjct: 325 YYMSFQELLGDVQSLLEYCLKQEKIDVTKQQFANYKIVLVIPDLYDKNYVETFIHLLLVQ 384

Query: 447 MQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDI 506
           M F AVAIIQESLAT YGAG+ +STCVV++GAT T+IACVDEG+++ +S V+LDYGGDDI
Sbjct: 385 MGFQAVAIIQESLATTYGAGISNSTCVVDIGATSTKIACVDEGTVLGNSAVTLDYGGDDI 444

Query: 507 TKLFSILLLQSGFPYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQI- 565
           T+LFS  LLQS FPY D +++  H W+LAE LKK+F TF DANV VQLYNFIKR PG+  
Sbjct: 445 TRLFSQFLLQSKFPYDDWDLSTPHGWMLAESLKKEFTTFQDANVAVQLYNFIKRTPGEAN 504

Query: 566 PQKYEFETFEEVMLAPLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWK 625
            QKYEF+ F+EVMLAP+++F+P++L LL  ++    +   V  Q P S+DI+T   N+ +
Sbjct: 505 AQKYEFKVFDEVMLAPMAMFFPKILSLLNPQKTQ--QEHYVTNQFPRSKDIYTLRDNNPR 562

Query: 626 SIAQADCLNKNLYSETSDEISMLKRTLNIHLNLEEIRDE-IDKEHEIPNSNYTSLEKXXX 684
           SI+Q +C     Y + + ++ +L++ LN+   ++E  +  + K+H   + N T LEK   
Sbjct: 563 SISQRECHENKTYCDMTRDLDILQKILNLPDEIDEYSNSNLSKKHH--HDNITPLEKAIV 620

Query: 685 XXXXXXXXXLD--ISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTF 742
                    LD  +S++ +FYSN+L+VGGG+K PSLDFIL DRI IWRPRLLSVN+  TF
Sbjct: 621 ESITNASISLDNNMSRLGNFYSNLLVVGGGSKFPSLDFILTDRINIWRPRLLSVNTISTF 680

Query: 743 YKKLTKLIKELPNYGKTNKTSEEEE--SLKKAIDELIKTEFEAYGPILEQQASNDSFFPV 800
           YKK+T+ IK+     K ++ ++ E+  +LKK + +++K E ++Y   ++    N++ FP+
Sbjct: 681 YKKVTQQIKDFEQENKVSEVTDPEQLATLKKKLLKMVKLELQSYWESVDALGGNENVFPI 740

Query: 801 SILPSPRNMDPAELIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           ++LP PR+MDPA L WKG SVLA+IKLVEEL++T  DWD+ GSRILQ+KCIF Y
Sbjct: 741 NVLPPPRDMDPAVLTWKGGSVLARIKLVEELYITAKDWDVLGSRILQYKCIFDY 794

>KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.477
           YOR141C
          Length = 934

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/797 (44%), Positives = 495/797 (62%), Gaps = 71/797 (8%)

Query: 120 SSKNKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGLFQPAMLINQKNY 179
           S+  KK  LHLLEKRRLGR            Q GIEK+++ T+  TG  +P ++INQKNY
Sbjct: 147 SAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQKNY 206

Query: 180 SSDYLKKDSQIFAMRNRKEIRE---------------NAQTTTSLNNTPDFQEGRGEANQ 224
           SSDY++KD QIFA+R RK +R                N     S ++TP+          
Sbjct: 207 SSDYIRKDDQIFALRERKFLRSAGTSNTTTTTTNNGSNTNGVGSASHTPEVATSTIPNEF 266

Query: 225 AAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELNDNF 284
             + +DI+  D +TTIVI PGS+ +KIG+A D  P++IP+CVAVP +      + + +  
Sbjct: 267 TLKSDDIDFTDATTTIVIQPGSESIKIGFATDETPLVIPNCVAVPHSG----ETPIGNAA 322

Query: 285 NYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDIED 344
           N ++DQ ++F ++K EL  SFKERMR YKR+VQ + ++QV +FN+ +KPE + ++ND   
Sbjct: 323 NLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEIIEDQNDPAK 382

Query: 345 VN-RWINDPQKK---YFGSDAIRCSKENFIIRYPFINGGS-----FNIEAPYYRTLSELL 395
           +  R   DPQ+    Y G +A+ C +E+++ R PF  G S     FN++   Y +L+ LL
Sbjct: 383 IAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPF--GCSEGKYLFNLDEKRYTSLAALL 440

Query: 396 SEVCEFLVHILTSDTFQLKTSDFSS-----YKIVLVISDIFEKSHLEVMFRLLLNEMQFN 450
            +V   L H +      LK  D  +     YK VLVI D+FEKSH+E M RLLL+E+ FN
Sbjct: 441 CDVSRLLEHAIDK---LLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRLLLSELPFN 497

Query: 451 AVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLF 510
           AVAI+QESLATCYG+G+ +STCVVNVGAT T++ACVDEG +VE+SI++L+YGGDDI+KLF
Sbjct: 498 AVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISKLF 557

Query: 511 SILLLQSGFPYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYE 570
           ++LLL S FPY + +I++    ++AE LKK+ +TF DA++T QL+NFIKRVPG   +K E
Sbjct: 558 AVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPGLPTEKIE 617

Query: 571 FETFEEVMLAPLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQA 630
           F+TF+EV+LAPL+LFYP++  LLK  +     N ++K QLP SRD+FT++ N+WKS+++ 
Sbjct: 618 FKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKANNWKSLSEM 677

Query: 631 DCLNKNLYSETSDEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXX 690
           DC    LYS+   E  +L   L I+   E    +     E    N T+L+K         
Sbjct: 678 DCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTELNLTALDKSVIQSITNA 737

Query: 691 XXXLDISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLI 750
              L+  K+ SFYSNIL+VGG + IP  D IL+DRI +WRP+L+++ SFP FY +L K I
Sbjct: 738 TLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNELVKEI 797

Query: 751 KELPNYGKTNKTS---------------------------------EEEESLKKAIDELI 777
           K+L    KT+  +                                  +E  L + I +LI
Sbjct: 798 KDLETSAKTSSAAIVTGGTATATPAPVLNDDDAPKEVPEVKETSSDAKEYELNEKIQKLI 857

Query: 778 KTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGASVLAQIKLVEELFVTTAD 837
           +   E Y   +E+Q  N+ F PVS+ P+P NM+P+ L W+GA VLAQIKL+EELFVT  D
Sbjct: 858 EERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELFVTNID 917

Query: 838 WDMHGSRILQHKCIFTY 854
           WD+HGSR+LQHKCIFTY
Sbjct: 918 WDVHGSRVLQHKCIFTY 934

>KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141C ARP8
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin- remodeling enzyme
           complexes
          Length = 775

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/746 (45%), Positives = 475/746 (63%), Gaps = 29/746 (3%)

Query: 114 KNPKIDSSKNKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGLFQPAML 173
           K P   + +  K   HLLEKRRLGR              GIEK +   ++  GLF+P  L
Sbjct: 54  KKPDPHAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSL 113

Query: 174 INQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEANQAAQDEDINL 233
           INQKNYSSDYLK+D QIFAMR RK +R NA    +   TPD  E   +       E ++ 
Sbjct: 114 INQKNYSSDYLKRDDQIFAMRERKSLR-NANANQA---TPDMPEDDDQ-------ESVDG 162

Query: 234 GDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELNDNFNYSKDQSEK 293
              + TIVIHPGS+ LKIG A +  P  IP CVAVPK          +D+    +   E+
Sbjct: 163 ESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKR------PRTSDSTPEPQVDEEE 216

Query: 294 FDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDIEDVNRWINDPQ 353
           +   K  + + FKERMR+YKRKV  N H+  ++FN    PE + E ND+  V+ WI D  
Sbjct: 217 YISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLHRVD-WIQDAS 275

Query: 354 KKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLVHILTSDTFQL 413
           K Y+G DA RC   +F +R+PF  G  FNIE+P Y +L ELL +V E L   L+     +
Sbjct: 276 KCYYGKDATRCLPSHFTVRHPFWKG-RFNIESPDYGSLQELLVDVSELLKFALSQPKIDV 334

Query: 414 KTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCV 473
           + S   +YK+V+V+ D F+K+++E   RLL+ +++F AVA+IQESLA+CYGAG+G STCV
Sbjct: 335 RPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCV 394

Query: 474 VNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTDLNINAAHDWI 533
           V++GAT T+IACVDEG ++++S+++LDYGGDDITKLF+  LL+S FPY DL++N+   W 
Sbjct: 395 VDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWS 454

Query: 534 LAEKLKKDFVTFHDANVTVQLYNFIKRVPGQI-PQKYEFETFEEVMLAPLSLFYPQVLKL 592
           L E+LK+ + TF DA+VT+QLYNFIKR+P +   +K+EF+ F+EVM AP+ LF+P +L+L
Sbjct: 455 LMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHILRL 514

Query: 593 LKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSETSDEISMLKRTL 652
           LK + +    N+ V  QLP S+D+FT + N+ KS++Q  C  K  Y +   ++ +L++ L
Sbjct: 515 LKDKNVP--VNKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHRDLDILQKLL 572

Query: 653 NIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXXXXXLD--ISKINSFYSNILLVG 710
           N+   +EE +       E     YT LEK            LD   SK  +FYSNIL+VG
Sbjct: 573 NLPSEIEEYQSSTCANLE---PAYTPLEKAIVESITNACVSLDNNHSKAANFYSNILVVG 629

Query: 711 GGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNYGKTNKTSEEEE--S 768
           G +K  SLDFIL DRI IWRPRLLSVN+ PTF  +++K +KE     K ++  +EEE  +
Sbjct: 630 GSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQKLSEIKDEEELAA 689

Query: 769 LKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWKGASVLAQIKLV 828
            KK + + IK E ++Y   ++    N+S FP ++LP+PR MDPA L WKG SV A++KL+
Sbjct: 690 QKKKLAKTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALLTWKGGSVFARLKLI 749

Query: 829 EELFVTTADWDMHGSRILQHKCIFTY 854
           EEL+V+ +DWD+ GSRILQ+KCIF Y
Sbjct: 750 EELYVSESDWDILGSRILQYKCIFDY 775

>AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR141C (ARP8)
          Length = 791

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/771 (45%), Positives = 488/771 (63%), Gaps = 37/771 (4%)

Query: 104 PLADTKIPSKKNPKIDSSKNKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVN 163
           P  + K+   +     + + KK   HLLEKRRLGR            + GIEK + L ++
Sbjct: 38  PTTEGKVSKPETAGAAAGQGKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNLHIS 97

Query: 164 PTGLFQPAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEAN 223
            TGLF+P  LINQKNYSSDYL+KD QIF+MR RK +R       + +  P      GE +
Sbjct: 98  QTGLFRPLPLINQKNYSSDYLRKDDQIFSMRERKSLRSGNVNPVNSSQPPTLLAEAGEDD 157

Query: 224 -QAAQDED-INLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELN 281
            +   DED I+  + + TIVIHPGS+ LKIG + D  P+ +PSCVAV +         L 
Sbjct: 158 LKLNGDEDGIDDTEDANTIVIHPGSRSLKIGLSTDVFPLSVPSCVAVARR----ASQRLE 213

Query: 282 DNFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKND 341
               Y KD  E F E+  ++   FKERMR+YKRK+  N HEQVLS+N  ++PE + E ND
Sbjct: 214 PQQRYDKD--EDFMEHLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSRAQPEKIPEHND 271

Query: 342 IEDVNRWINDPQKK--YFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVC 399
           +  +  WI D  +   Y+G  A RC  ENF+IRYPF NG +FN+E P Y +L ELL++V 
Sbjct: 272 LHRIE-WIKDAPEGTIYYGEGAERCLPENFVIRYPFSNG-AFNVECPDYSSLQELLNDVT 329

Query: 400 EFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESL 459
           + +   L+     +  S F +YK++L+I D+FEK+++E M RLLL+EM F AVA+IQESL
Sbjct: 330 KLITFALSETKLGISRSQFPNYKVILIIPDLFEKNYVEQMIRLLLSEMNFQAVALIQESL 389

Query: 460 ATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGF 519
           ATCYGAG+ +STCV+++GA++T+I+CVDEG ++++S + L YGGDDIT+LF  LLLQS F
Sbjct: 390 ATCYGAGLSNSTCVIDIGASETKISCVDEGQVIQNSCIRLSYGGDDITRLFVELLLQSNF 449

Query: 520 PYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKR---VPGQIPQKYEFETFEE 576
           PY D N+N    WILAE+LKK  +TF DA+V VQL+NF KR   VPG   +K+EF+ F E
Sbjct: 450 PYPDWNLNTRQGWILAEQLKKTHITFQDADVAVQLFNFFKREPSVPGA--EKFEFKLFNE 507

Query: 577 VMLAPLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKN 636
           VM++P++ FYPQ+L  LK    A   N+ + +QLP SRD +T + ++ KSIAQ       
Sbjct: 508 VMISPMAYFYPQILSFLKP---ATSYNKYMAQQLPESRDPYTYKPDNPKSIAQESAFTGK 564

Query: 637 LYSETSDEISMLKRTLNIHLNLEEI------RDEID--KEHEIPNSNYTSLEKXXXXXXX 688
           +Y++ + ++ ++++ ++++  +E +      R   D  K +    SNYT L+K       
Sbjct: 565 VYTDINKDLDIIRKLVSVNDEVEALTSGPSERTSGDTIKTNTRRASNYTPLDKAIIESVT 624

Query: 689 XXXXXL--DISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKL 746
                L  ++SK+ +FYSN+L++GG +K+P LD IL DRI IWRPRLLSV++ P  YKK+
Sbjct: 625 TASVLLGDNMSKLVNFYSNLLVIGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVVYKKV 684

Query: 747 TKLIKELPNYGKTNKTSEEEE---SLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSIL 803
           ++++K++ N  K N    EEE   S KK I   IK E E Y    E     +  +P+++L
Sbjct: 685 SEMVKQVENEIKKNNPESEEEIAQSRKKLIKS-IKIELENY---WESVDPYEHVYPIAVL 740

Query: 804 PSPRNMDPAELIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           P PR MDP+ L WKG SV  +IKL EEL++T  DW+M GSRIL++KCIF Y
Sbjct: 741 PPPREMDPSMLTWKGGSVFGRIKLCEELYITAMDWEMLGSRILKYKCIFDY 791

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/774 (44%), Positives = 492/774 (63%), Gaps = 45/774 (5%)

Query: 106 ADTKIPSKKNPKIDSSKNKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPT 165
            + K+   +   + S+++KK   HLLEKRRLGR            + GIEK + + ++ T
Sbjct: 22  TEGKVTKPETGGVASTQSKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNIHISQT 81

Query: 166 GLFQPAMLINQKNYSSDYLKKDSQIFAMRNRKEIRE---NAQTTTS--LNNTPDFQEGRG 220
           GLF+   LINQKNYSSDYL+KD QIF+MR RK +R    N+ T +S  L   PD Q+   
Sbjct: 82  GLFRVHSLINQKNYSSDYLRKDDQIFSMRERKNLRSGNVNSITNSSQPLIALPDVQDDEV 141

Query: 221 EANQAAQDEDINLGDPS--TTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVS 278
           + N    DED  L D +   TIVIHPGS+ LKIG + D  P+ IPSCVA+ +++ ++  S
Sbjct: 142 KTNG---DED-GLDDTADTNTIVIHPGSRSLKIGLSTDVFPLSIPSCVAIARSEQVEVPS 197

Query: 279 ELNDNFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTE 338
           +         D  E+F     ++   FKERMR+YKRK+  N HEQVLS+N   +PE + E
Sbjct: 198 QPR------YDNDEEFMGNLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSKCQPEKIPE 251

Query: 339 KNDIEDVNRWI---NDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELL 395
            ND+  +  WI   +   K Y+G  A RC  E F++RYPF NG SFN+++P Y +L ELL
Sbjct: 252 HNDLHRI-EWIKKSDASTKVYYGEYAERCLPEGFLLRYPFANG-SFNVKSPNYNSLQELL 309

Query: 396 SEVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAII 455
           ++V   +   L+     +  S FSSY +VL+I D+FEKS++E M RLL++EM F AVA+I
Sbjct: 310 NDVVNLITFALSETKLNISKSQFSSYNVVLIIPDLFEKSYVEQMIRLLISEMDFQAVALI 369

Query: 456 QESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLL 515
           QESLA+CYGAG+ +STCV+++G ++T+I+CVDEG ++++S + L YGGDDITKLF+ LLL
Sbjct: 370 QESLASCYGAGLSNSTCVIDIGGSETKISCVDEGQVIQNSCIKLSYGGDDITKLFAELLL 429

Query: 516 QSGFPYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPG-QIPQKYEFETF 574
           QS FPY D N+N    W+LAE+LKK+ +TF DA+V VQL+NF KR P     +KYEF+ F
Sbjct: 430 QSNFPYEDWNLNTRQGWLLAEQLKKNHITFQDADVAVQLFNFFKRNPNISGAEKYEFKLF 489

Query: 575 EEVMLAPLSLFYPQVLKLLKSE-QLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCL 633
            EVM++P++ FYPQ+L LLK   ++ KY    V++QLP SRD +T + +D +S++    L
Sbjct: 490 NEVMVSPMAYFYPQILALLKPPVEVNKY----VQQQLPPSRDPYTCKPDDPQSVSNLGSL 545

Query: 634 NKNLYSETSDEISMLKRTLNIHLNLEEI----RDEIDKEHEIPN----SNYTSLEKXXXX 685
           +   Y+E S ++ ++++ ++I   +E +     D    +  + N    SNY  L+K    
Sbjct: 546 SGKWYTEMSKDLDIVRKLISITDKVEALSANSSDGTASDTIVENTEEVSNYMPLDKAIIE 605

Query: 686 XXXXXXXXL--DISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFY 743
                   L  ++SK+ +FYSN+L+VGG +K+P LD IL DRI IWRPRLLSV++ P  Y
Sbjct: 606 SVTNAAVLLGDNMSKLTNFYSNLLIVGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVIY 665

Query: 744 KKLTKLIKELPNYGKTNKTSEEEE---SLKKAIDELIKTEFEAYGPILEQQASNDSFFPV 800
           KK++ ++K++ +  K N    EEE   S KK I   IK E E Y    E     +  +P+
Sbjct: 666 KKISDMVKQVESEIKKNNVESEEEIQQSRKKLIKS-IKIELENY---WESVDPYEHVYPI 721

Query: 801 SILPSPRNMDPAELIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           ++LP PR MDP+ L WKG SV  +IKL EEL++T  DW+M GSRIL++KCIF Y
Sbjct: 722 TVLPPPREMDPSMLTWKGGSVFGRIKLCEELYITEMDWEMLGSRILKYKCIFDY 775

>NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.477
           YOR141C
          Length = 974

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/661 (49%), Positives = 454/661 (68%), Gaps = 21/661 (3%)

Query: 113 KKNPKIDSSK---NKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGLFQ 169
           KK PK+D  K    KK  LHLLEKRRLGR            ++GIEK+E++TV PTGLFQ
Sbjct: 156 KKYPKMDPKKVPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKEAGIEKVESVTVPPTGLFQ 215

Query: 170 PAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPD--FQEGRGEANQAAQ 227
           P  LINQKNYSS YLK D QIF +R+ K ++  +   TS   TPD   +      N  + 
Sbjct: 216 PLNLINQKNYSSIYLKNDDQIFCLRDDKSLKNTSPNQTS-TATPDNIVESVATGINNKST 274

Query: 228 DEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELN------ 281
            + +NL DP+ TI+IH GS  LKIG A D NPI++P+CVA+PK ++      +N      
Sbjct: 275 GDQLNLNDPTKTIIIHTGSHSLKIGKALDENPIIVPNCVAIPKQEYEGMTRNINTKDSIP 334

Query: 282 ----DNFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVT 337
               +N   S  QS++F++ K E+  +FKERM++YKR++Q N  EQV SFNK SKPE + 
Sbjct: 335 TPPENNIFDSIAQSDEFNDLKLEIETNFKERMKYYKRRIQPNSCEQVKSFNKISKPEILP 394

Query: 338 EKNDIEDVNRWINDP-QKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLS 396
             ND + + +WIN+   K+Y+GS+A RC+  +F  R PF N GSFNI +  Y +L +LLS
Sbjct: 395 ISNDPQRI-QWINESTNKRYYGSNAERCTDLHFKTRKPFSNNGSFNIASTDYISLQDLLS 453

Query: 397 EVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQ 456
           +V   + H LTS  F LK S F  +K+VL+I D F KSH+E+   LLL  ++F AVAIIQ
Sbjct: 454 DVTNLIEHSLTSSPFDLKPSQFKEHKVVLIIPDSFGKSHVELFITLLLTHLKFQAVAIIQ 513

Query: 457 ESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQ 516
           ESLATCYGAG    TCVVN+GA+QT +ACVDEG+++E+S+VSL+YGG+DIT +F+  LLQ
Sbjct: 514 ESLATCYGAGNSVPTCVVNLGASQTTVACVDEGTVLENSMVSLNYGGNDITNIFATFLLQ 573

Query: 517 SGFPYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQ-IPQKYEFETFE 575
           + FPY + N+N+   W LAE+LK+ ++TF D +VTVQL+NFIKR+PG    +KY+F+ F+
Sbjct: 574 NDFPYHNWNLNSIEGWKLAEELKEKYITFQDMDVTVQLFNFIKRLPGMDTIEKYDFKVFD 633

Query: 576 EVMLAPLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNK 635
           +VMLAPL+LF+P++LKL+K EQ  + +N+ ++ QLP SRDI+T+++NDW+SI Q +CL  
Sbjct: 634 DVMLAPLTLFFPKILKLMK-EQQPQNRNKFLQSQLPDSRDIYTTKINDWRSITQEECLES 692

Query: 636 NLYSETSDEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKXXXXXXXXXXXXLD 695
            L+S   +E+ +LKRTL + + LE  ++    +++    NYT L+             +D
Sbjct: 693 KLFSYIDNELELLKRTLEVPILLENFQNN-SPDNKNDKLNYTPLDVAIIQSIMNASTNID 751

Query: 696 ISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPN 755
           +SK++SFYSNIL+VGGG+KIP+LDFIL DRI IWRPRLLS+ SFP FYK+L+K IK+L N
Sbjct: 752 MSKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYKELSKDIKDLQN 811

Query: 756 Y 756
           +
Sbjct: 812 H 812

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 76/103 (73%), Gaps = 5/103 (4%)

Query: 757 GKTNKTSEEEESLKKAID----ELIKTEFEAYGPILEQ-QASNDSFFPVSILPSPRNMDP 811
            +TN+  E    LK+ +D    EL+K + E Y   +E+ Q  ND + PVS++P+PR++DP
Sbjct: 872 AETNEVEEAVNKLKREMDDKINELLKEKLEEYLETVEKAQNGNDHYLPVSVVPAPRDIDP 931

Query: 812 AELIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854
           A ++WKGASVLAQ+K++EEL++T ADWD+HGSRILQ+K IF Y
Sbjct: 932 ALILWKGASVLAQLKIIEELYMTNADWDVHGSRILQYKSIFPY 974

>KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 788

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/781 (41%), Positives = 471/781 (60%), Gaps = 66/781 (8%)

Query: 110 IPSKKNPKIDSSKNKKFHLHLLEKRRLGRXXXXXXXXXXXXQSGIEKIETLTVNPTGLFQ 169
           IPSKK P+           HLLEKRRLGR              GIE+ E   +      +
Sbjct: 35  IPSKKVPQ-----------HLLEKRRLGRIKAAEEFAKKLKIIGIERQENEHIAQPITLK 83

Query: 170 PAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLN------NTPDFQEGRGEAN 223
           P  +INQKNYSS+YLK D QIF MR RK +R+  QT  S +       TP   +     +
Sbjct: 84  PVSVINQKNYSSNYLKNDDQIFYMRERKHLRQQGQTGGSSSAPAAGIGTPALDDDNMADS 143

Query: 224 QAAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVSELNDN 283
            A +D++++      +I+IHPGS F+KIG   D  P  +P+ VAVP +    TV    ++
Sbjct: 144 NAIEDDELD------SIIIHPGSSFIKIGPNYDIFPQQVPNLVAVPTHG--GTVPSPQED 195

Query: 284 FNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDIE 343
            +     +E F + K+++   FKERMR+YKR++  N  EQ  +FN  S PE V + ND  
Sbjct: 196 IS----NNEIFQQLKDDIQFDFKERMRYYKRRIMPNSTEQAAAFNAKSDPELVPDLNDFG 251

Query: 344 DVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLV 403
            +  WI D  K Y+G DA +C   +F +R PF+NG SFN+  P Y +  E+L +V + +V
Sbjct: 252 RI-EWIKDRSKSYYGHDATQCLPSDFKLRSPFLNG-SFNLNEPNYNSFQEILFDVEQLIV 309

Query: 404 HILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCY 463
             L  +   ++ + FS+Y++VL++ D+F+K+ +E M  LLL E+ F ++A+IQESLA+CY
Sbjct: 310 QSLAMEKIGIERNQFSNYRVVLIVPDLFDKTFVESMIHLLLIELDFQSIALIQESLASCY 369

Query: 464 GAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTD 523
           GAG+ +STCV+++GA QT+IACVD+G +V++S + L+YGGDDIT+LF+ +LLQ+ FPY D
Sbjct: 370 GAGLSNSTCVIDIGAKQTKIACVDDGVVVKNSALRLNYGGDDITRLFAHMLLQNKFPYAD 429

Query: 524 LNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQI----PQKYEFETFEEVML 579
            NIN  + W LAE LKK  +TF DA++ +QLY+FIKR P         KYE++ F+EVM 
Sbjct: 430 WNINEPNGWTLAETLKKQCITFQDADIAIQLYSFIKRDPYARKYTQSHKYEYKLFDEVMC 489

Query: 580 APLSLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNK--NL 637
           AP+ +F+P + +++K +Q     NE V +Q P S+DI+T + ND KS+ Q  C+ +    
Sbjct: 490 APMGIFFPDIFEVIKPKQ--HKPNEYVIRQCPRSKDIYTLKPNDTKSLTQMLCIQEPTKW 547

Query: 638 YSETSDEISMLKRTLNIHLNLE---------------EIRDEIDKEHEIPNSNYT-SLEK 681
           YS  S +I ++++ LN+  +                 +I DEI+  +    +N +  LEK
Sbjct: 548 YSNLSRDIDIVQKLLNLDTDDLDEQNDDESAGSKEETQINDEIEDINLRQYNNLSMPLEK 607

Query: 682 XXXXXXXXXXXXL--DISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSF 739
                       L  ++SK+N  YSNIL+VGG +KIP+LDFIL DRI IWRP+LLS+++ 
Sbjct: 608 AIIESITNASMLLGDNMSKLNVLYSNILIVGGSSKIPALDFILTDRINIWRPKLLSISAL 667

Query: 740 PTFYKKLTKLIKELPNYGKTNKTSEEEE------SLKKAIDELIKTEFEAYGPILEQQAS 793
            T  +K+ ++IK   +Y   NK   E        + KK + +LIK E EAY   L+   S
Sbjct: 668 STLMEKIGEVIK---SYETDNKLDLEPTDPQAAIAYKKKLSKLIKAEIEAYWDSLQTLHS 724

Query: 794 NDSFFPVSILPSPRNMDPAELIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFT 853
           +D   P++ILP P +MDP+ L WKG SV ++IKL+EEL +T  DW+M G+RILQ+KCIF 
Sbjct: 725 DDDLLPINILPPPHDMDPSMLTWKGGSVFSKIKLLEELNITKQDWNMLGNRILQYKCIFE 784

Query: 854 Y 854
           Y
Sbjct: 785 Y 785

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 436 LEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDS 495
           +E  F L LN++Q  A+ I+ E LA     G  SS  V++VGA  T +  + +G++V   
Sbjct: 113 VENYFDLALNKLQVPALQIVVEPLAVALAMG-KSSALVIDVGARGTTVTPIVDGTVVRSG 171

Query: 496 IVSLDYGGD 504
           ++   +GGD
Sbjct: 172 VMKSRFGGD 180

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 90/197 (45%), Gaps = 13/197 (6%)

Query: 403 VHILTSDTFQ--LKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLA 460
           +  L S TF   LK +DF  + +++  + +  + + + M  +   +  F AV I   S  
Sbjct: 88  METLWSHTFNDILKINDFDEHPLLITEAPLNPEKNRDKMCEVFFEKFDFAAVYIANPSTL 147

Query: 461 TCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFP 520
           + Y +G  ++ CV++ G        + EG  +  SI  +D GG D+T+     + +    
Sbjct: 148 SLYASGR-TTGCVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQFQIRK---- 202

Query: 521 YTDLNI--NAAHDWILAEKLKKDFVT---FHDANVTVQLYNFIKRVPGQIPQKYEFETFE 575
           YT +++  ++ H+ +   K K  +V+    HD +++  L     R   ++P   +    +
Sbjct: 203 YTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMS-NLNPEKIRCQFKLPDGKDLILDK 261

Query: 576 EVMLAPLSLFYPQVLKL 592
               AP  LF PQ++ L
Sbjct: 262 ARFRAPEILFRPQIMGL 278

>TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 461
           aa] {ON} Anc_2.593 YMR033W
          Length = 461

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 46/91 (50%)

Query: 416 SDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVN 475
           ++ SS  +++V    + +  LEV+ + +   +Q N   ++  SLA+ Y      + C+++
Sbjct: 103 AELSSIPLLMVAHHSWSQIQLEVITQFVFEALQINNALLLPASLASSYAMSSLQNCCIID 162

Query: 476 VGATQTRIACVDEGSIVEDSIVSLDYGGDDI 506
           +G T T I  + + + +E     + YGG  I
Sbjct: 163 IGTTHTDIIPIIDYTPLEALSSKIAYGGQLI 193

>Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON}
           complement(1914..3305) [1392 nt, 464 aa]
          Length = 463

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 63/145 (43%), Gaps = 11/145 (7%)

Query: 373 YPFINGGSFNIEAPYYRTLSELLSEVCEFLVHILTSDTFQLKTS---DFSSYKIVLVISD 429
           +P +NG   NI+A         L  +    V IL   +     S   + S+   +L+   
Sbjct: 66  HPIVNGEIVNIDA--------FLQFLKIVYVSILNEKSLSDPNSFDRELSNIPFLLISHH 117

Query: 430 IFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEG 489
            + + H+E +   +   +Q N+   +  SLA+ Y      ++C++++G T T I  V + 
Sbjct: 118 SWSQFHIEKITHFVFEALQLNSFITLPVSLASNYAMISLQNSCIIDIGETHTDIVPVIDY 177

Query: 490 SIVEDSIVSLDYGGDDITKLFSILL 514
             ++    S+ YGG  I    S +L
Sbjct: 178 LQMDHIASSIKYGGQTINDSLSKIL 202

>ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp,
           462 aa] {ON} similar to uniprot|Q05123 Saccharomyces
           cerevisiae YMR033W ARP9 Actin-related protein involved
           in transcriptional regulation; subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 462

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 89/204 (43%), Gaps = 9/204 (4%)

Query: 345 VNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLVH 404
           V + IN      + S A   S+E     +P  NG   ++EA +   L  +   +     +
Sbjct: 41  VFKTINSDGVPIYSSSATETSQE----IHPIENGSIVDLEA-FLFFLRLIYVSILSKRSN 95

Query: 405 ILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYG 464
           +   D+F    ++ S+  + +V    + +  LE + + L   ++ N   ++  +L++ Y 
Sbjct: 96  LKGPDSFD---AELSNIPVFIVTHHSWSQFQLESIVQFLFEALRVNGAMLLSTALSSTYA 152

Query: 465 AGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITK-LFSILLLQSGFPYTD 523
            G   + CV+++G   T I  V + + +     ++ YGG+ I + L  IL   SG     
Sbjct: 153 MGSLQNCCVIDIGTAHTDIIPVVDYAPLVPLTSTIPYGGNTINENLARILPELSGNTIES 212

Query: 524 LNINAAHDWILAEKLKKDFVTFHD 547
           L  ++  + +  +  K    TFH+
Sbjct: 213 LKKSSIFEVLSDDAKKSSAFTFHE 236

>ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR033W
           (ARP9); 1-intron
          Length = 464

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 75/165 (45%), Gaps = 9/165 (5%)

Query: 352 PQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLVHILTS--D 409
           P + Y   +    S E+  + YP ++G   +++   Y    +L+ +    L H +    D
Sbjct: 38  PTRVYRDEEGQLTSFESAEVVYPIVDGRIADLDGLLY--FLKLIYK--SILSHWIAEHPD 93

Query: 410 TFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGS 469
           T++   S+     ++L+    + +   E++ + +  EM+ N   ++  +L+  Y  G   
Sbjct: 94  TWEAHASNIP---MLLLTHYSWSQREQELITQYVFEEMRLNHFMVVPAALSISYAFGSIQ 150

Query: 470 STCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILL 514
           +  V+++GAT T I  + +   ++    S   GGDDI    + LL
Sbjct: 151 NCLVIDIGATHTDIVPIVDYVPLDYMAYSAPIGGDDINAKLATLL 195

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 1/105 (0%)

Query: 413 LKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTC 472
           LK S+   + +V+  + +  K + E M   L       A+ I   ++ + Y +G  ++ C
Sbjct: 100 LKVSNLGEHPLVVTEAPLNPKPNREKMCETLFESFNIPALYIANPAVLSLYASGR-TTGC 158

Query: 473 VVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQS 517
           VV  G        + EG  +  SI  +D GG DITK   + L +S
Sbjct: 159 VVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQLQLRKS 203

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 81/187 (43%), Gaps = 19/187 (10%)

Query: 412 QLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSST 471
           Q+K    S  KI+L    +    + E+M  ++  +  F  V +  +++   Y  G+ S  
Sbjct: 95  QMKFPSTSGGKILLTEPPMNPLKNRELMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG- 153

Query: 472 CVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTDLNINAAHD 531
            VV+ G   T I  V E  ++      LD  G D+T+    LL + G+ +   N +A  +
Sbjct: 154 VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF---NRSADFE 210

Query: 532 WILAEKLKKDFVTFHDANV--------TVQLYNFIKRVPGQIPQKYEFETFEEVMLAPLS 583
            +   K K  +V++ D N+        TV + N+      ++P     +  +E   AP  
Sbjct: 211 TVRQIKEKLSYVSY-DLNLDTKLARETTVLVENY------ELPDGRVIKVGQERFEAPEC 263

Query: 584 LFYPQVL 590
           LF P ++
Sbjct: 264 LFQPDLV 270

>Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}
           similar to Ashbya gossypii ABR084W
          Length = 407

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 66/153 (43%), Gaps = 6/153 (3%)

Query: 373 YPFINGGSFNIEAPYYRTLSELLSEVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFE 432
           YP  NG   N++A  Y      L  + + ++     +  +   +  S+  + L+    + 
Sbjct: 3   YPINNGSITNLDAFLY-----FLKAIYKSVLQQRIKENPEGWEAQVSNIPMFLITHYSWS 57

Query: 433 KSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIV 492
           +S  E++ + +   M+ N   I+  SLAT Y  G   +  V+++G   T I  + + + +
Sbjct: 58  QSEQEILTQFVFESMKLNNFMIMPNSLATSYAFGSLQNCVVIDIGGAHTDIIPIVDYTPL 117

Query: 493 EDSIVSLDYGGDDI-TKLFSILLLQSGFPYTDL 524
           E    S   GGD I  KL S L   S     DL
Sbjct: 118 EYLAYSAPVGGDAINAKLASFLPGWSAASIEDL 150

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 65/144 (45%), Gaps = 11/144 (7%)

Query: 374 PFINGGSFNIEAPYYRTLSELLSEVCEFLV---HILTSDTFQLKTSDFSSYKIVLVISDI 430
           P  NG   N+EA       E L  +   L+   H   +D+F+     F++  ++L+ +  
Sbjct: 66  PIENGMIINLEA-----FQEFLKYIYISLLKQKHDENADSFEY---SFTNIPLLLLNNHK 117

Query: 431 FEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGS 490
           + +  +E +   +  +++ N + ++  SL   Y      + C++++G   T I  + + +
Sbjct: 118 WSQFQMESITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYT 177

Query: 491 IVEDSIVSLDYGGDDITKLFSILL 514
            +     +L+YGG  I  +   LL
Sbjct: 178 TINHLSNTLNYGGSYINTILQKLL 201

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 85/203 (41%), Gaps = 38/203 (18%)

Query: 316 VQTNGHEQVLSFNKNSKPEDVTEKNDIEDVNRWINDPQKKYFGS----DAIRCSKENFII 371
           +Q   +  +  FN    P+ V     I+D     N  QKK FG+    D       +   
Sbjct: 13  IQNGTNTTLAGFNNVDLPQCVIPTVYIQD-----NSTQKKIFGNFELLDIASSRSNDDAG 67

Query: 372 RYPFI-----NGGSFNIEAPYYRTLSELLSEVCEFL---VHILTSDTFQLKTSDFSSYKI 423
           RY        NG  +N +A         L E  E++   V    SD + L  +  S+ K 
Sbjct: 68  RYEVFTIFDRNGLPYNWDA---------LKEQWEYIYREVLKCNSDEYPLVITIPSANKD 118

Query: 424 VLVISDIFEKSHLEVMFRLLLNEMQFNA--VAIIQESLATCYGAGVGSSTCVVNVGATQT 481
           V    +I  K + E+ F        FN   + II E LA     G  SS+ VVN+GA+  
Sbjct: 119 V---DEIILKKYFELAFE------TFNVPVLQIIIEPLAVALSLG-KSSSLVVNLGASGC 168

Query: 482 RIACVDEGSIVEDSIVSLDYGGD 504
            +  + +G++++ +++   YGGD
Sbjct: 169 NVTPIVDGTVIKHAVMKSKYGGD 191

>Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 38.5 bits (88), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 48/101 (47%)

Query: 416 SDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVN 475
           ++ S+  ++L+    + +S LE + + +   ++ N +  +  SLA  Y      + C+++
Sbjct: 104 AELSNIPLLLITHHSWSQSDLETITQYIFESLEINNLIQLPASLAATYSMISLQNCCIID 163

Query: 476 VGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQ 516
           VG   T I  + + + ++  + SL  GG  I      LL Q
Sbjct: 164 VGTYHTDIIPIVDYAQLDHLVSSLPVGGQSINDSLKKLLPQ 204

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 38.1 bits (87), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 52/105 (49%), Gaps = 1/105 (0%)

Query: 413 LKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTC 472
           L+ S    + +++  + +  K + E M  LL       AV +  +++ + Y +G  ++ C
Sbjct: 99  LQLSSLQDHPVLVTEAPLNPKKNREQMCELLFETFSVPAVYVSIQAVLSLYASGR-TTGC 157

Query: 473 VVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQS 517
           V++ G   +    V +G  +  +I  +D  G DI++L  +L+ +S
Sbjct: 158 VLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIRKS 202

>Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034W
           (REAL)
          Length = 480

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 434 SHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVE 493
           S LE  + L  ++++     I+ E LA     G  SS  V+++GA+   +  + +G +V+
Sbjct: 118 SILERYYELAFDKLKVPVFQIVIEPLAIALSMG-KSSAFVIDMGASGCNVTPIIDGIVVK 176

Query: 494 DSIVSLDYGGD 504
           +++V   +GGD
Sbjct: 177 NAVVRSKFGGD 187

>YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa]
           {ON}  ARP9Component of both the SWI/SNF and RSC
           chromatin remodeling complexes; actin-related protein
           involved in transcriptional regulation
          Length = 467

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 49/101 (48%)

Query: 416 SDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVN 475
           ++ S+  ++L+    + +S LE++ + +   ++ N +  +  SLA  Y      + C+++
Sbjct: 104 AELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNCCIID 163

Query: 476 VGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQ 516
           VG   T I  + + + ++  + S+  GG  I      LL Q
Sbjct: 164 VGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLLPQ 204

>YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}
           ARP7Component of both the SWI/SNF and RSC chromatin
           remodeling complexes; actin-related protein involved in
           transcriptional regulation
          Length = 477

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 436 LEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDS 495
           LE  + L  +++      I+ E LA     G  SS  V+++GA+   +  + +G +V+++
Sbjct: 120 LERYYELAFDKLNVPVFQIVIEPLAIALSMG-KSSAFVIDIGASGCNVTPIIDGIVVKNA 178

Query: 496 IVSLDYGGD 504
           +V   +GGD
Sbjct: 179 VVRSKFGGD 187

>Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034W
           (REAL)
          Length = 476

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 436 LEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDS 495
           LE  + L  ++++     I+ E LA     G  SS  V+++GA+   +  + +G +V+++
Sbjct: 120 LERYYELAFDKLKVPVFQIVIEPLAIALSMG-KSSAFVIDMGASGCNVTPIIDGIVVKNA 178

Query: 496 IVSLDYGGD 504
           +V   +GGD
Sbjct: 179 VVRSKFGGD 187

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 442 LLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDY 501
           L+L +++   + +I E LA     G  S+  VV+VGA++  +  + +GS+V+  I+   Y
Sbjct: 113 LVLCKLRAPVLQLISEPLAVTLSLG-RSTALVVDVGASKVTVTPIVDGSVVKTGILRSRY 171

Query: 502 GGD 504
            GD
Sbjct: 172 AGD 174

>Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/101 (20%), Positives = 49/101 (48%)

Query: 416 SDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVN 475
           ++ S+  ++L+    + +S LE + + +   ++ N +  +  SLA  Y      + C+++
Sbjct: 104 AELSNIPLLLITHHFWSQSDLERITQYIFESLEINNLIQLPASLAATYSMISLQNCCIID 163

Query: 476 VGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQ 516
           VG   T +  + + + ++  + S+  GG  I +    LL Q
Sbjct: 164 VGTYHTDVIPIVDYAQLDHLVSSIPMGGQSINESLKKLLPQ 204

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 437 EVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSI 496
           E M  LL       A+ +  +++ + Y +G  ++ CVV+ G        V +G  V  SI
Sbjct: 148 EKMCELLFESFNVPALYVSVQAVLSLYASGR-TTGCVVDCGDGCCHAVPVFDGFSVPSSI 206

Query: 497 VSLDYGGDDITKLFSILL 514
             +D  G DIT+   +LL
Sbjct: 207 RRIDIAGRDITEFLQLLL 224

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 49/102 (48%), Gaps = 1/102 (0%)

Query: 413 LKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTC 472
           L+  +   + I++  + +  +++ E M  LL       A+ +  +++ + Y +G  ++ C
Sbjct: 96  LQLQNVEDHPILITEAPLNPRNNRERMCELLFESFNVPALYVSIQAVLSLYASGR-TTGC 154

Query: 473 VVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILL 514
           VV+ G        V +G  +  SI  +D  G DIT+   +LL
Sbjct: 155 VVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLL 196

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 40/198 (20%), Positives = 85/198 (42%), Gaps = 5/198 (2%)

Query: 421 YKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQ 480
           + ++L  + +  KS+ E M +++       A  +  +++ + Y +G  ++  V++ G   
Sbjct: 101 HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGR-TTGIVLDSGDGV 159

Query: 481 TRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPY-TDLNINAAHDWILAEKLK 539
           T +  +  G  +  +I+ +D  G D+T     +L + G+ + T        D  + EKL 
Sbjct: 160 THVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD--IKEKLC 217

Query: 540 KDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLAPLSLFYPQVLKLLKSEQLA 599
              + F     T    + +++   ++P         E   AP +LF+P VL L  S    
Sbjct: 218 YVALDFEQEMQTAAQSSSVEK-SYELPDGQVITIGNERFRAPEALFHPSVLSLESSGVDQ 276

Query: 600 KYKNEQVKKQLPASRDIF 617
              N  +K  +   +D++
Sbjct: 277 TTYNSIMKCDVDVRKDLY 294

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 437 EVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSI 496
           EVM ++L       A+ I   ++ + Y +G  ++ CVV+ G        + +G  +  SI
Sbjct: 125 EVMAQVLFETFNLPALYISNPAVLSLYASGR-TTGCVVDCGEGYCSTVPIYDGFALPASI 183

Query: 497 VSLDYGGDDITK 508
           + +D GG DIT+
Sbjct: 184 MRMDIGGRDITE 195

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 431 FEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGS 490
            E   +E    L   +++   + I+ E L      G  SS+ V++VGAT   +  + +G+
Sbjct: 130 LETKIVENYMELAFEKLKVPVLQIVVEPLGIMLSTG-KSSSLVIDVGATGCTVTPIIDGT 188

Query: 491 IVEDSIVSLDYGGD 504
           I+ +SIV   + GD
Sbjct: 189 ILRNSIVKSRFAGD 202

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 324 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 359

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 339 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 340 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 375

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 437 EVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSI 496
           E M  +L     F+A+ +   ++ + Y  G  ++ CV+  G   +    V +G  +  SI
Sbjct: 128 ETMCEILYETFNFDALYVAHPAVLSLYATGQ-TTGCVLECGEGYSASTPVYQGFALPSSI 186

Query: 497 VSLDYGGDDITK 508
             +D GG DIT+
Sbjct: 187 RRIDIGGRDITQ 198

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 815 IWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKC 850
           +W G S+LA +   ++++++  ++D  G  I+ HKC
Sbjct: 340 VWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 375

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 437 EVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSI 496
           EVM ++L       A+ +   ++ + Y +G  ++ CV++ G        + +G  +  S+
Sbjct: 125 EVMAQVLFETFNLPALYVSNPAVLSLYASGR-TTGCVIDCGEGYCSTVPIYDGFALPASM 183

Query: 497 VSLDYGGDDITKLFSILLLQS 517
           + +D GG DITK     L +S
Sbjct: 184 MRMDIGGRDITKQLQFQLRKS 204

>TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2.593
           YMR033W
          Length = 472

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 66/134 (49%), Gaps = 2/134 (1%)

Query: 417 DFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNV 476
           + S+  ++L+    +    +E + + +   ++ N+  ++  SLA  +      ++ V+++
Sbjct: 113 ELSNVPLLLISHYKWSAQQIEKINQHVFEILKLNSFLMLPTSLAATHAMAALQNSIVIDI 172

Query: 477 GATQTRIACVDEGSIVEDSIVSLDYGGDDI-TKLFSILLLQSGFPYTDLNINAAHDWILA 535
           G T T I  + + S +     ++  GG+DI T L SIL   S     DL ++  ++ + A
Sbjct: 173 GKTHTDILPIVDYSQLTHFSSTIPIGGNDINTHLKSILPSLSDDQIEDLKLSNIYEVLNA 232

Query: 536 EKLKKDFVTFHDAN 549
           E  KK++   H A+
Sbjct: 233 EA-KKNYADLHQAD 245

>TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.448
           YPR034W
          Length = 482

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 49/99 (49%), Gaps = 8/99 (8%)

Query: 412 QLKTSDFSSYKIVLVISDI------FEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGA 465
           QLK  D + Y ++ ++  I       EK   E  ++L   + +   + +I   LA  +  
Sbjct: 108 QLK-CDMTEYPLLALMPVIGKDKKELEKQIKEEYYKLAFEKFRIPILYLIPSPLAIAFSL 166

Query: 466 GVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGD 504
           G   S  VV++GA   ++  + +G+I++D+++   + GD
Sbjct: 167 G-KKSALVVDIGAKTCQVTPILDGTIIKDAVMKSKFAGD 204

>Smik_13.203 Chr13 (331960..331989,332074..333447) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 35.8 bits (81), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 48/101 (47%)

Query: 416 SDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVN 475
           ++ S+  ++L+    + +S LE + + +   ++ N +  +  SLA  Y      + C+++
Sbjct: 104 AELSNIPLLLITHHSWSQSDLERITQYVFESLEINNLIQLPASLAATYSMISLQNCCIID 163

Query: 476 VGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQ 516
           VG   T I  + + + ++  + S+  GG  I      LL Q
Sbjct: 164 VGTYHTDIIPIVDYAQLDHLVSSIPIGGQSINDSLKKLLPQ 204

>Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034W
           (REAL)
          Length = 479

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 434 SHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVE 493
           S L   + L  +++      I+ E LA     G  SS  V+++GA+   +  + +G +V+
Sbjct: 118 SILRRYYELAFDKLNVPVFQIVIEPLAIALSMG-KSSAFVIDMGASGCNVTPIIDGIVVK 176

Query: 494 DSIVSLDYGGD 504
           +++V   +GGD
Sbjct: 177 NAVVRSKFGGD 187

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 35.0 bits (79), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 61/129 (47%), Gaps = 5/129 (3%)

Query: 412 QLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSST 471
           +LK  D   + +++  + +   S+ + M  LL       A+ +   ++ + Y +G   S 
Sbjct: 97  KLKLKDVDEHPVLITEAPLNPVSNRDEMCDLLFESFGVQALYVANPAVLSLYASG-KISG 155

Query: 472 CVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYTDLNINAAHD 531
           CV++ G   +    V +G  ++ +I  +D GG D+T+   + L +S    T L++  + +
Sbjct: 156 CVLDCGDGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKS----TGLSLTTSGE 211

Query: 532 WILAEKLKK 540
             L   +K+
Sbjct: 212 MELVRMIKE 220

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 35.0 bits (79), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 68/167 (40%), Gaps = 6/167 (3%)

Query: 348 WINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFLVHILT 407
           WI +P  +   S     +KE +I    +    + ++E+PY          + +   ++L 
Sbjct: 39  WIGNPLAER--SMVTVSNKETYIGNSAYERRATLHLESPYSTNAIMSWDRLEDLWDYVLL 96

Query: 408 SDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGV 467
           +   +L+      + +VL  S    K   E M  +L  +    A+   ++ + + YG G 
Sbjct: 97  N---KLEIEQLQEHPVVLTNSMSTSKKEEEKMCEVLFEKFSIPAIYCSRDPIMSLYGLGR 153

Query: 468 GSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILL 514
            ++ C V+ G     I  V +G IV  S    + GG  +T     LL
Sbjct: 154 -TTGCSVSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLL 199

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 4/105 (3%)

Query: 404 HILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCY 463
           HIL  D+ QL +     + +++  + +  +S+ E M  +        A+ +    + + Y
Sbjct: 92  HILF-DSLQLTSG--MEHPLLITEAPLNPESNKEKMLEVFFETFNIPAICVSIPGVLSLY 148

Query: 464 GAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITK 508
            +G  ++ CVV+ G        V EG  +  SI  ++ GG D+TK
Sbjct: 149 ASGR-TTGCVVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTK 192

>AGR099C Chr7 complement(924366..925283) [918 bp, 305 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR106W
           (ARP10)
          Length = 305

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 426 VISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIAC 485
           ++ DI  K  L    ++LLN ++ N+V  + + L  C  AGV S+  VV+VG  QT +  
Sbjct: 68  ILLDIPRKKRL---CQVLLNRLRVNSVVFLPDVLMACVSAGV-SNALVVDVGWEQTAVVP 123

Query: 486 VDEGSIVEDSI 496
           V +  I++  +
Sbjct: 124 VVDMRILDRDV 134

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 437 EVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSI 496
           E M  +L       AV +  +++ + Y +G  ++ CV++ G        V +G  +  SI
Sbjct: 122 EAMCEMLFETFNVPAVYVSIQAVLSLYASGR-TTGCVLDCGDGCCHSVPVFDGFSLPSSI 180

Query: 497 VSLDYGGDDITKLFSILL 514
             +D  G D+T+   +LL
Sbjct: 181 RRIDVAGRDVTEFLQLLL 198

>ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 465

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 440 FRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSL 499
           F L   +++   + I+ E LA        SS  V+++GA + +I  V +G++V+  ++  
Sbjct: 123 FELAFEKLRVPTLQIVVEPLAIALSMS-KSSALVIDIGARECKITPVIDGTVVKSGVMKS 181

Query: 500 DYGGD 504
            + GD
Sbjct: 182 KFAGD 186

>KNAG0I00150 Chr9 complement(14436..17911,17999..18065) [3543 bp,
           1180 aa] {ON} Anc_3.578 YGL251C
          Length = 1180

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 57/133 (42%), Gaps = 19/133 (14%)

Query: 341 DIEDVNRWINDPQKKY-----FGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELL 395
           +IEDV  W+    +K      F  +  + + E  +  + F N  SF  +A Y   LSE+L
Sbjct: 309 NIEDVASWLKAKNRKSAKILKFDDEYRQVTLEKHVYGFQFYNKNSFQRDAFYNTKLSEVL 368

Query: 396 SEVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAII 455
            E C+    ++   T   + S  S+ K        +   H+    R+  N+    ++ + 
Sbjct: 369 LEHCKGKPTMIFCPT---RASTVSTAK--------YLAKHVASSLRIPRNK---GSITLS 414

Query: 456 QESLATCYGAGVG 468
             ++  C+ AGVG
Sbjct: 415 DPAIQDCFNAGVG 427

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 437 EVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSI 496
           E++ +++      +A+ +   ++ + Y +G  ++ CVV+ G        + +G  +  SI
Sbjct: 125 EMIAQVMFETFNLSAIYVSDPAVLSLYASGR-TTGCVVDCGEGYCSSVPIYDGFALPASI 183

Query: 497 VSLDYGGDDITK 508
           + +D GG DIT+
Sbjct: 184 MRMDIGGGDITE 195

>SAKL0B11220g Chr2 (978268..978297,978363..979733) [1401 bp, 466 aa]
           {ON} similar to uniprot|Q05123 Saccharomyces cerevisiae
           YMR033W ARP9 Actin-related protein
          Length = 466

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 35/63 (55%)

Query: 424 VLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRI 483
           +LV    + +SH+E + + +   ++ N+  I+  +LAT Y  G   ++ V++VG  +T +
Sbjct: 111 LLVSHHSWTRSHIEQITQYVFELLEINSFMILPLALATTYAFGSLQNSLVIDVGLEKTDL 170

Query: 484 ACV 486
             +
Sbjct: 171 VPI 173

>Smik_11.264 Chr11 complement(441359..444061) [2703 bp, 900 aa] {ON}
           YKR009C (REAL)
          Length = 900

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 246 SKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVS--ELNDNFNYS 287
           SK LK  Y  DPN  ++PS   +P  Q   T+S   L DNFNY+
Sbjct: 642 SKELKYTYENDPNFQVLPSFAVIPFMQATATLSMDNLVDNFNYA 685

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 73/160 (45%), Gaps = 11/160 (6%)

Query: 438 VMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIV 497
           +M   L       ++ +   S+ + Y +G  ++ CVV+ G        + EG ++  SI 
Sbjct: 125 IMCERLFETFNIPSLYVANPSVLSLYASG-NTTGCVVDCGDGYCSSTPIYEGFVLPASIR 183

Query: 498 SLDYGGDDITKLFSILLLQSGFPYTDLNINAAHDWILAEKLKKDFVTF-HDANVTVQLYN 556
            ++ GG DIT+     + +S    + +++ ++++  +   +K+       D N + + Y 
Sbjct: 184 KMEVGGRDITEHLQFQIRKS----SGISLYSSNEKEIVRTIKEKVCYISEDFNKSEESY- 238

Query: 557 FIKR----VPGQIPQKYEFETFEEVMLAPLSLFYPQVLKL 592
           ++++       ++P   E    +E   +P  LF PQ++ L
Sbjct: 239 YLRQDEMSCKFKLPDGKELTLNKERFRSPEVLFNPQLMGL 278

>NCAS0G00340 Chr7 (57980..60643) [2664 bp, 887 aa] {ON} Anc_5.690
           YKR089C
          Length = 887

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 37/93 (39%), Gaps = 2/93 (2%)

Query: 742 FYKKLTKLIKELPNYGKTNKTSEEEESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVS 801
            Y   T  ++ L N G  N         K  IDE +K    A   +L Q   +DS+    
Sbjct: 212 LYLIRTNWVRNLGNMGNVNLYRHSYVGTKHIIDEYMKESHLAIEALLNQSEVDDSYLLGM 271

Query: 802 ILPSPRNMDPAELIWKGASV--LAQIKLVEELF 832
           +  + RN+    L+  G +   L  I ++  LF
Sbjct: 272 LQQTRRNIGKTALVLSGGATFGLFHIGVLASLF 304

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 27/139 (19%), Positives = 62/139 (44%), Gaps = 4/139 (2%)

Query: 379 GSFNIEAPYYRTLSELLSEVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEV 438
           G   ++ P    + +  S + +   H+  S    LK ++   + +++  + +    + + 
Sbjct: 68  GLLRLQYPVEHGIVQDWSGLEQLWTHVFYSS---LKLNNIGDHPMLVTEAPLNPLENRDK 124

Query: 439 MFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVS 498
           M  +L       AV +  +++   Y AG  ++ CV++ G    +   V +G  +  +I  
Sbjct: 125 MCEMLYETFNVPAVYVSIQAVLALY-AGGRTTGCVIDCGDGCCQSVPVYDGFSIPSAIRR 183

Query: 499 LDYGGDDITKLFSILLLQS 517
           +D  G D+T+   +LL +S
Sbjct: 184 IDVAGRDVTEFLQLLLRKS 202

>SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 311

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 79/157 (50%), Gaps = 14/157 (8%)

Query: 419 SSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGA 478
           SS K+V++ + +   +  E++ ++LL  +  +++  + + L TC+ +GV     V++VG 
Sbjct: 58  SSTKVVIIENVLLPLNCKELLCQVLLKRLLVSSIVFVPDVLMTCFSSGVKDGL-VIDVGW 116

Query: 479 TQTRIACVDEGSIVED-SIVSLDYGGDDITKLFSILLLQSGFPYTDLNINAAHDWILAEK 537
               +  + +  I+++ S +S   G      L  IL      P TDL+I      I+A +
Sbjct: 117 EYVAVVPILDLRILDNWSHISNKAGKFLYDNLKEILP-----PGTDLDILVPQ--IMACE 169

Query: 538 LKKDFVTFHDANVTVQLYN-FIKRVPGQI---PQKYE 570
             KDF  + + ++T ++ N F+K+  G     P +Y+
Sbjct: 170 GDKDF-QYREISITKEVRNGFLKKTIGHFDEDPLEYD 205

>KLTH0G04268g Chr7 (340594..341034) [441 bp, 146 aa] {ON} similar to
           uniprot|Q04082 Saccharomyces cerevisiae YDR437W Protein
           required for cell viability
          Length = 146

 Score = 31.2 bits (69), Expect = 5.4,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 47/111 (42%), Gaps = 11/111 (9%)

Query: 532 WILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLAPLSLFYPQVLK 591
           W LA  L   F T  DA++  ++  F + + G +PQ+Y    FE V+L  +   Y     
Sbjct: 29  WSLAPTLSA-FKT-EDASIRNEIITFTQELVGLLPQRYWIIVFECVVLMAMLFTY----- 81

Query: 592 LLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSETS 642
                 L  Y  + +   L   R I  S  N  K  +  + L+K  + E+S
Sbjct: 82  ----LGLWMYNEDVLTAPLDDMRTITDSRANVVKFASHQEFLDKYAFRESS 128

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 437 EVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSI 496
           E M ++L      +A+ +   ++ + Y +G  ++ CVV+ G        + +G  +  S+
Sbjct: 125 EQMAQVLFETFDVSALYVSNPAVLSLYASGR-TTGCVVDCGEGYCSTVPIYDGFALPASM 183

Query: 497 VSLDYGGDDITKLFSILLLQS 517
           + +D GG DIT+     L +S
Sbjct: 184 MRMDIGGADITEQLQFQLRKS 204

>NDAI0C00580 Chr3 complement(110741..112246) [1506 bp, 501 aa] {ON}
           Anc_2.593 YMR033W
          Length = 501

 Score = 32.0 bits (71), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/96 (17%), Positives = 45/96 (46%)

Query: 415 TSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVV 474
           +++ S+   +L+    + +  LE + + +   ++     ++  SL+T        + C++
Sbjct: 107 STELSNIPFLLITHYTWSQPQLEKITQFIFESLKILNAMLLPSSLSTSVAMISLQNCCII 166

Query: 475 NVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLF 510
           ++G + T I  + + + +     +L  GGD+I K  
Sbjct: 167 DIGKSHTDIIPIIDYTPLSFLASTLPMGGDNINKFL 202

>Suva_4.283 Chr4 complement(502688..503698) [1011 bp, 336 aa] {ON}
           YBR050C (REAL)
          Length = 336

 Score = 32.0 bits (71), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 12/97 (12%)

Query: 589 VLKLLKSEQLAKYK-NEQVKKQLPASR-----DIFTSE-----LNDWKSIAQADCLNKNL 637
            L+ +KS    ++K N++  K LPA+R     D +        LN WK I   +C  KN 
Sbjct: 53  CLRKVKSLSAKQWKINKKKYKSLPAARKKKYFDFYKQRNLILNLNLWKFIKFINCTGKNN 112

Query: 638 YSETSDEISMLKRTL-NIHLNLEEIRDEIDKEHEIPN 673
           Y + +  +  L++T+ N H++  +   ++D +  + N
Sbjct: 113 YDKNNKHVKHLRKTVKNDHMSPYQKAKKMDNDKRLEN 149

>TPHA0H01400 Chr8 complement(313405..316272) [2868 bp, 955 aa] {ON}
           Anc_5.690 YOR081C
          Length = 955

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 37/93 (39%), Gaps = 2/93 (2%)

Query: 742 FYKKLTKLIKELPNYGKTNKTSEEEESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVS 801
            Y   T+ ++ L N G  N   +     K  ID+ IK        +LEQ   +DS+    
Sbjct: 238 LYIIRTQWVRNLGNMGNVNLYIQSHIGTKYIIDDYIKESKICIEALLEQNELDDSYLLAI 297

Query: 802 ILPSPRNMDPAELIWKGASV--LAQIKLVEELF 832
              S RN+    L+  G     L  I ++  LF
Sbjct: 298 FQQSRRNIGRTALVLSGGGTFGLFHIGVLATLF 330

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 1/76 (1%)

Query: 439 MFRLLLNEMQFNAVAIIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVS 498
           M  +L       AV +  +++   Y AG  ++ CV++ G    +   V +G  +  +I  
Sbjct: 125 MCEMLFETFGSPAVYVSIQAVLALY-AGGRTTGCVIDCGDGCCQSVPVYDGFTLPSAIQR 183

Query: 499 LDYGGDDITKLFSILL 514
           +D  G DIT+   +LL
Sbjct: 184 IDVAGRDITEFLQLLL 199

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,424,756
Number of extensions: 4382487
Number of successful extensions: 21691
Number of sequences better than 10.0: 163
Number of HSP's gapped: 22199
Number of HSP's successfully gapped: 169
Length of query: 854
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 736
Effective length of database: 39,950,811
Effective search space: 29403796896
Effective search space used: 29403796896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)