Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A009507.127ON46946922920.0
TDEL0H028907.127ON44246919500.0
Kpol_1062.567.127ON45046619310.0
ZYRO0C05236g7.127ON44746918950.0
SAKL0F05346g7.127ON44746818890.0
TPHA0C043207.127ON45447018810.0
Suva_16.457.127ON47847718820.0
YPL259C (APM1)7.127ON47547718810.0
Smik_6.4667.127ON47647718540.0
KNAG0L009507.127ON46146818490.0
ADL017C7.127ON44346718340.0
Skud_16.197.127ON47647718320.0
KLLA0D14311g7.127ON44346718210.0
NCAS0E021407.127ON48146718210.0
NDAI0E036807.127ON44446818130.0
Kwal_55.208437.127ON44146618110.0
Ecym_83507.127ON44546718110.0
KLTH0F12584g7.127ON44146618090.0
CAGL0K00539g7.127ON45646917810.0
KAFR0L004707.127ON46547317490.0
Ecym_52393.165ON4644925548e-65
KLTH0F06534g3.165ON4664975032e-57
KLLA0C03894g3.165ON4754934991e-56
SAKL0C07414g3.165ON4825144991e-56
CAGL0C05203g3.165ON4755054805e-54
YOL062C (APM4)3.165ON4915184781e-53
NCAS0C035803.165ON4915104763e-53
Kwal_33.141823.165ON4674954743e-53
TDEL0D045803.165ON4825124737e-53
NDAI0G029203.165ON4865084666e-52
Kpol_1045.443.165ON4695054612e-51
SAKL0D13090g2.555ON4995454607e-51
Suva_15.1033.165ON4915114581e-50
Smik_15.963.165ON4915174562e-50
ZYRO0B04840g3.165ON4765084534e-50
Kwal_26.81462.555ON5055544476e-49
Skud_15.913.165ON4915134413e-48
TBLA0F008403.165ON4815114352e-47
ABR047W2.555ON4984894343e-47
KLTH0D07502g2.555ON5045104335e-47
ADR315W3.165ON4924074319e-47
TPHA0P006603.165ON4735044071e-43
KLLA0F25432g2.555ON5075494063e-43
Ecym_45912.555ON5015043827e-40
KNAG0K011503.165ON4745023614e-37
TDEL0B064302.555ON5253513231e-31
TPHA0I023902.555ON5593793195e-31
KAFR0A020602.555ON5403603081e-29
CAGL0K03223g2.555ON5983953055e-29
NCAS0A126502.555ON5883573046e-29
Kpol_1056.132.555ON5413672965e-28
Skud_8.262.555ON5963842966e-28
Smik_8.232.555ON6033652887e-27
ZYRO0E05874g2.555ON5493612797e-26
YHL019C (APM2)2.555ON6053882791e-25
KAFR0C010203.165ON4284972751e-25
Suva_8.332.555ON5963862781e-25
KNAG0C055502.555ON5823732781e-25
TBLA0B067602.555ON6572512016e-16
NDAI0B016102.555ON6722581937e-15
SAKL0A09218g2.522ON4732911491e-09
AGL061W2.522ON4112511312e-07
TBLA0I006202.522ON6091701277e-07
TPHA0C041302.522ON5331661251e-06
KAFR0D035602.522ON4555111241e-06
TDEL0A029702.522ON4963411232e-06
KLTH0D06556g2.522ON4563311223e-06
KLLA0D11396g3.575ON5361431213e-06
Kwal_26.79572.522ON4561531179e-06
KLLA0E18789g2.522ON4971761161e-05
ZYRO0E09746g3.575ON5381431091e-04
ZYRO0B01738g2.522ON4921611072e-04
KLTH0G00528g3.575ON6331431044e-04
Ecym_60073.575ON5371431036e-04
Kwal_47.192923.575ON5381431010.001
Kpol_1018.422.522ON5751711000.001
TBLA0E001403.575ON543143990.001
NCAS0F040103.575ON547143960.004
NDAI0B063203.575ON540125950.004
AFR274C3.575ON532143950.005
KLTH0H11770g1.388ON156136880.011
TDEL0D064303.575ON536143900.022
NDAI0G052101.388ON15683840.037
SAKL0F00594g3.575ON545143870.040
Smik_7.3713.575ON598125870.042
CAGL0A04741g3.575ON536143870.050
CAGL0L02145g2.522ON54336860.067
Skud_2.4192.522ON484155850.082
Skud_6.1423.575ON546125850.085
Suva_4.5482.522ON484155840.099
TPHA0B035701.388ON15682800.12
TPHA0G037003.575ON539142830.13
TBLA0A012601.388ON15659790.15
YFR051C (RET2)3.575ON546125830.15
ZYRO0E05236g1.388ON15662780.21
Suva_12.63.575ON546125810.24
TDEL0B061901.388ON15679770.29
SAKL0D08074g1.388ON15687770.32
AFR124W1.388ON15682760.36
CAGL0B04983g1.388ON15679760.37
YBR288C (APM3)2.522ON483152790.39
Kpol_380.133.575ON535142770.65
Smik_2.4302.522ON484152770.69
KLLA0F22814g1.388ON15659740.70
KNAG0A069702.522ON50545770.77
YLR170C (APS1)1.388ON15668731.1
Smik_12.2321.388ON15659721.1
Ecym_72662.522ON51766751.3
Kpol_507.73.575ON533142741.7
NCAS0C05130singletonON53455741.8
Kwal_26.94485.28ON551111732.0
Kpol_1061.211.388ON15655702.2
Skud_12.2361.388ON15655702.4
NDAI0K019302.522ON612176722.8
Kwal_14.26071.388ON15662693.1
KLLA0B06545g1.505ON14854683.3
KNAG0I013901.388ON15662693.5
KAFR0I020801.388ON15677683.8
TDEL0B007508.822ON418110713.8
KAFR0J001303.575ON543126713.9
Suva_10.2681.388ON15655684.2
NCAS0A087901.388ON15676684.4
KAFR0C049007.8ON536161687.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A00950
         (469 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   887   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   755   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   748   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   734   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   732   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   729   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   729   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   729   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   718   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   716   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   711   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   710   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   706   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   706   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   702   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   702   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   702   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   701   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   690   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   678   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   218   8e-65
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   198   2e-57
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   196   1e-56
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   196   1e-56
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   189   5e-54
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   188   1e-53
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   187   3e-53
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   187   3e-53
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   186   7e-53
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   184   6e-52
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   182   2e-51
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   181   7e-51
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   181   1e-50
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   180   2e-50
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   179   4e-50
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   176   6e-49
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   174   3e-48
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   172   2e-47
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   171   3e-47
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   171   5e-47
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   170   9e-47
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   161   1e-43
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   160   3e-43
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   151   7e-40
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   143   4e-37
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   129   1e-31
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   127   5e-31
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   123   1e-29
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   122   5e-29
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   121   6e-29
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   118   5e-28
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   118   6e-28
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   115   7e-27
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   112   7e-26
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   112   1e-25
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   110   1e-25
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   111   1e-25
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   111   1e-25
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    82   6e-16
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    79   7e-15
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    62   1e-09
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    55   2e-07
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    54   7e-07
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    53   1e-06
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    52   1e-06
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    52   2e-06
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    52   3e-06
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    51   3e-06
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    50   9e-06
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    49   1e-05
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    47   1e-04
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    46   2e-04
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    45   4e-04
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    44   6e-04
Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]...    44   0.001
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    43   0.001
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    43   0.001
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    42   0.004
NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa] ...    41   0.004
AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON} S...    41   0.005
KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highl...    39   0.011
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    39   0.022
NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1....    37   0.037
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    38   0.040
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    38   0.042
CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {...    38   0.050
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    38   0.067
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    37   0.082
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    37   0.085
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    37   0.099
TPHA0B03570 Chr2 complement(834660..835130) [471 bp, 156 aa] {ON...    35   0.12 
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    37   0.13 
TBLA0A01260 Chr1 (299419..299889) [471 bp, 156 aa] {ON} Anc_1.38...    35   0.15 
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    37   0.15 
ZYRO0E05236g Chr5 complement(399318..399788) [471 bp, 156 aa] {O...    35   0.21 
Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)     36   0.24 
TDEL0B06190 Chr2 complement(1094337..1094807) [471 bp, 156 aa] {...    34   0.29 
SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {O...    34   0.32 
AFR124W Chr6 (662389..662859) [471 bp, 156 aa] {ON} Syntenic hom...    34   0.36 
CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly ...    34   0.37 
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    35   0.39 
Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}...    34   0.65 
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    34   0.69 
KLLA0F22814g Chr6 complement(2119266..2119736) [471 bp, 156 aa] ...    33   0.70 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    34   0.77 
YLR170C Chr12 complement(500579..501049) [471 bp, 156 aa] {ON}  ...    33   1.1  
Smik_12.232 Chr12 complement(447707..448177) [471 bp, 156 aa] {O...    32   1.1  
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    33   1.3  
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    33   1.7  
NCAS0C05130 Chr3 complement(1045330..1046934) [1605 bp, 534 aa] ...    33   1.8  
Kwal_26.9448 s26 complement(1221754..1223409) [1656 bp, 551 aa] ...    33   2.0  
Kpol_1061.21 s1061 complement(58801..59271) [471 bp, 156 aa] {ON...    32   2.2  
Skud_12.236 Chr12 complement(447306..447776) [471 bp, 156 aa] {O...    32   2.4  
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    32   2.8  
Kwal_14.2607 s14 complement(831030..831500) [471 bp, 156 aa] {ON...    31   3.1  
KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly ...    31   3.3  
KNAG0I01390 Chr9 complement(269809..270279) [471 bp, 156 aa] {ON...    31   3.5  
KAFR0I02080 Chr9 (426510..426980) [471 bp, 156 aa] {ON} Anc_1.38...    31   3.8  
TDEL0B00750 Chr2 (139060..140316) [1257 bp, 418 aa] {ON} Anc_8.8...    32   3.8  
KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.57...    32   3.9  
Suva_10.268 Chr10 complement(472748..473218) [471 bp, 156 aa] {O...    31   4.2  
NCAS0A08790 Chr1 (1739972..1740442) [471 bp, 156 aa] {ON} Anc_1....    31   4.4  
KAFR0C04900 Chr3 (973774..975384) [1611 bp, 536 aa] {ON} Anc_7.8...    31   7.7  

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  887 bits (2292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/469 (92%), Positives = 434/469 (92%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKLV           PPQALTNSVSWRPEGIKYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYL         
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                          PQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420
           DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420

Query: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLNG 469
           IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLNG
Sbjct: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLNG 469

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/469 (77%), Positives = 396/469 (84%), Gaps = 28/469 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           MVS I FCD KG+ +LSR+YRDDIPL+AID FA LL  LEEESSV+PPCL H GI YLFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           +H DLY+VAL+TSL+TNA+QVFTFLHKLVE + +YLK VEEES+RDNFVIIYELLDEMMD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+           PP  LTNSVSWR +GI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DIVESINM+M QQGQVLRSEIIG+V VRSRLSGMPDLKLGINDKGIF++           
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTR----------- 229

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDE-GSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIP 299
                            P TG+ +  + +K S+ ELEDLKFHQCVRLSKFENEKIITFIP
Sbjct: 230 ----------------DPETGESQVTAGKKKSSAELEDLKFHQCVRLSKFENEKIITFIP 273

Query: 300 PDGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVP 359
           PDG FELMSYRLTTP+KPLIWCDVN+ VHSKSR+EIHCRAKAQIKKKS+ANNVEILIPVP
Sbjct: 274 PDGEFELMSYRLTTPVKPLIWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVP 333

Query: 360 DDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPV 419
           DDADTPSFRYSHGSIKWVPEKNAILWKIRSF GGKEYSMAAQ+GLPSI+  EKPK KRPV
Sbjct: 334 DDADTPSFRYSHGSIKWVPEKNAILWKIRSFYGGKEYSMAAQMGLPSINGVEKPKFKRPV 393

Query: 420 QIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLN 468
           Q+KFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQ+GDDYTIRLN
Sbjct: 394 QVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQNGDDYTIRLN 442

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/466 (77%), Positives = 396/466 (84%), Gaps = 16/466 (3%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           MVS + FCD+ GK +LSR+YRDDIPL+AID F+ +L++ EEESSVVPPCL + GIHYLFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QH+D+Y+VALTTS  TN +Q+F FLH+LV V+ +YLK VEEESIRDNFVIIYELLDEMMD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+           PP ALTNSVSWR EGIKYKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DI+ESINMLM QQGQVLRSEIIGEVKV+SRLSGMPDLKLGINDKGIFSKYL         
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSK- 239

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                          P      D  ++ K SN+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 240 ---------------PVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPP 284

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG FELM+YRLTTPIKPLIWCD+NI VHSKSR+EIHCRAKAQIKKKSIANNVEILIPVPD
Sbjct: 285 DGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPD 344

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420
           DADTP+F+YSHGSIKW+PEKNAILWK+RSFAGGKEYSM AQLGLPS+D  E PK+KRPVQ
Sbjct: 345 DADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQ 404

Query: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466
           IKFQIPYFTTSGIQVRYLK+NEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 405 IKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/469 (73%), Positives = 398/469 (84%), Gaps = 22/469 (4%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           MVS++ FCD KG+ +LSR+YRDDIP++AID FA LL++LEEESSV+PPCL+H+GI YLFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY+VAL TSL+TN +QVF FLHKL+EV+ EYLK VEEES+RDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+           PP  +TNSVSWR   I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DIVESINMLM QQGQVLRSEIIG++KV+S+LSGMPDLKLGINDKGIFSKY+         
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPV-- 238

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                             +T   EG  +K +N+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 239 ------------------TTAVTEG--KKKTNIELEDLKFHQCVRLSKFENEKIITFIPP 278

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG FELM+YRL+ P+KPLIWCDVN+ VHS+SR+EIHCRA+AQIKK+SIAN+VEILIPVPD
Sbjct: 279 DGAFELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPD 338

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420
           DADTPSF+Y+HGS+KWVP+KNAILWKIRSF GGKEYSM+AQ+GLPSI+  +KPK+KRPVQ
Sbjct: 339 DADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQ 398

Query: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLNG 469
           IKFQIPYFTTSGIQVRYLK+ EPKL YKSYPWVRYITQSGDDYTI+LN 
Sbjct: 399 IKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKLNN 447

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/468 (73%), Positives = 393/468 (83%), Gaps = 21/468 (4%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S I FCDSKGK++LSR+Y+DDIP  AID F  LL++ E+ESSV+PPCL HNGI YLF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY++ +T SLSTN +Q+F FL+K+VEV++EY+K VEEESIRDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+           PP ALTNSVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           D+VESINML+TQQGQVLRSEI+G+VKV+S LSGMPDLKLG+NDKGIFS ++         
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGV----- 235

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                           +        + +K +N+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 236 ----------------EDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPP 279

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG+FELMSYRLTTPIKPLIWCD+ I VHSKSR+E+HCRAKAQIKKKS ANNVEILIPVP+
Sbjct: 280 DGDFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPE 339

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420
           DAD+P FRYSHGSIKW PEKNAILWKI+SF GGKEYSMAAQLGLPS+ D E+P +KRPVQ
Sbjct: 340 DADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQ 399

Query: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLN 468
           +KFQIPYFTTSGIQVRYLK+NEPK+QY+SYPWVRYITQSGDDYTIR+N
Sbjct: 400 VKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRMN 447

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/470 (74%), Positives = 392/470 (83%), Gaps = 19/470 (4%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           MVS I FCD+ GK +L+R+YRDDI + AIDNF+ LL++LEEE+ V+PPC+ H GIHYLFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           +H+D+Y+VALTTS  TN +Q+F FLH+LVEV+ EY+K V EES+RDNFVIIYELLDEMMD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXX--XXXPPQALTNSVSWRPEGIKYKKNEA 178
           +GIPQITETKMLK+YITQKSFKL+             PP  LTNSVSWRPEGI YKKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXX 238
           FLDI+ESINML+TQQGQVLRSEI+G V+VRSRLSGMPDLKLGIND+GIFS YL       
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240

Query: 239 XXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFI 298
                               ST   EG   K   +ELEDLKFHQCVRLSKFENEKIITFI
Sbjct: 241 SSS-----------------STPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFI 283

Query: 299 PPDGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPV 358
           PPDG F+LM+YRLTTPIKPLIWCDVNI VHSKSR+EIHCRAKAQIKKKSIANNVEILIPV
Sbjct: 284 PPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPV 343

Query: 359 PDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRP 418
           PDDADTP FRYSHGSIKW+PEKNAILWK+RSFAGGKEYSM+AQL LPS+D  E PK++RP
Sbjct: 344 PDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRP 403

Query: 419 VQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLN 468
           VQ+KFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSG+DYTIRLN
Sbjct: 404 VQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLN 453

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/477 (74%), Positives = 395/477 (82%), Gaps = 10/477 (2%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S++ FCD  GK LLSR+YRDDIPL+AID F TLL  LEE+S+++PPCL HNG+ YLFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY+VA+ TSLS NA+ +FTFLHKLVEV+S+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKLV           PP ALTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DIVESINMLMTQ+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL         
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                           +PS      +S++  N+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG F+LM+YRL+T IKPLIWCDVN+ VHS SR+EIHC+AKAQIK+KS A NVEILIPVPD
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSI---DDNEK--PK- 414
           DADTP+F+YSHGS+K+VPEK+AILWK+RSF GGKEYSM+A+LGLPSI   +D  K  PK 
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 415 ----LKRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467
               LK PVQIKFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/477 (74%), Positives = 394/477 (82%), Gaps = 13/477 (2%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S++ FCD  GK LLSR+YRDDIPL+AID F  LL  LEE+S+++PPCL HNG+ YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY+VA+ TSLS NA+ +FTFLHKLVEV+S+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKLV           PP ALTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DIVESINMLMTQ+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL         
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                           +PS      +++K  N+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 SATTSDNNTETDK---KPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPP 297

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG F+LM+YRL+T IKPLIWCDVN+ VHS SR+EIHC+AKAQIK+KS A NVEILIPVPD
Sbjct: 298 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 357

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEK-----PK- 414
           DADTP+F+YSHGS+K+VPEK+AILWKIRSF GGKEYSM+A+LGLPSI +NE      PK 
Sbjct: 358 DADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKS 417

Query: 415 ----LKRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467
               LK PVQIKFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 418 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/477 (73%), Positives = 395/477 (82%), Gaps = 12/477 (2%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S++ FCD  GK LLSR+YRDD+PL+AID F+TLL  LEE+S+++PPCL HNG+ YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY+VA+ TSL+ NA+ +FTFLHKLVEV+S+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKLV           PP ALTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DIVESINMLMTQ+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL         
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                           +PS      +S++  N+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 VSAATSDNNTDTDK--KPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 298

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG F+LM+YRL+T IKPLIWCDVN+ VHS SR+EIHC+AKAQIK+KS A NVEILIPVPD
Sbjct: 299 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 358

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEK-----PK- 414
           DADTP+F+YSHGS+K+VPEK+AILWK+RSF GGKEYSM+A+LGLPSI  ++      PK 
Sbjct: 359 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKS 418

Query: 415 ----LKRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467
               LK PVQIKFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 419 NAKLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/468 (73%), Positives = 393/468 (83%), Gaps = 7/468 (1%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S++ FCD KGK LLSR+Y+DD+PL+AID F+TLL  LE+ES+V+PPC+ HNGI YLFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY+VAL TSL+ N ++VF FLHKL+ V+ EYLK VEEESIRDNFVIIYEL+DEMMD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL            PP  L NSVSWR EGIKYKKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DIVESINML+TQ+GQVLRSEIIG VK++SRLSGMPDLKLGIND+GIF+KYL         
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                             S+  ++G  RKT N+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 PDPQEHGSGVAE------SSITNDGKKRKT-NIELEDLKFHQCVRLSKFENEKIITFIPP 293

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG F+LM+YRLTT IKPLIWCDV+I VHSKSR+EI CRAKAQIKKKS+A NV+ILIPVPD
Sbjct: 294 DGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPD 353

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420
           DADTPSF+YSHGSIK+VPE++AILWKI+SF GGKEY+M A++GLPS+D  E+PK+KRPVQ
Sbjct: 354 DADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQ 413

Query: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLN 468
           +KF+IPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSGDDYTIR+N
Sbjct: 414 VKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/467 (71%), Positives = 386/467 (82%), Gaps = 24/467 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S I FCDSKGK LLSR+Y+DDIP  AI+ F  LL++ E+ESSV+PPC + NG+ YLFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY++ LT S+S N +QVF++LHKL+EV+ EY+K VEEESI+DNFVIIYELLDEMMD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKL+           PP  LTNSVSWRPEGI YKKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           D+VESINML+TQQGQVLRSEI+G+VKV+SRLSGMPDLKLG+NDKGIF++           
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDEEGA- 239

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                                   G ++K SN+ELEDLKFHQCVRL+KFENEKIITFIPP
Sbjct: 240 -----------------------SGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPP 276

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG+FELMSYRL+TPIKPLIWCDV + VHS+SR+EIHCRAKAQIKKKS ANNVEILIPVP+
Sbjct: 277 DGDFELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPE 336

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420
           DAD+P FRYSHG+IKWVP +NAILWKI+SF GGK+YSMAA++GLPS+ DN   KLKRPVQ
Sbjct: 337 DADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQ 396

Query: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467
           IKFQIPYFTTSGIQVRYLK+NEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 397 IKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/477 (72%), Positives = 393/477 (82%), Gaps = 12/477 (2%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S++ FCD  GK LLSR+YRDDIPL+AID F TLL  LEE+S+++PPCL HNG+ YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY+VA+ TSL  NA+ +FTFLHKLVEV+S+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQI ETKMLKQYITQKSFKLV           PP ALTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DIVESINMLMTQ+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL         
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                           +PS      +S++  N+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 TSAATSDNITDTDK--KPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 298

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG F+LM+YRL+T IKPLIWCDVN+ VHS SR+EIHC+AKAQIK+KS A NVEI+IPVPD
Sbjct: 299 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPD 358

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEK-----PK- 414
           DADTP+F+YSHGS+K+VPEK+AILWK+RSF GGKEYSM+A+LGLPSI ++ +     PK 
Sbjct: 359 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKS 418

Query: 415 ----LKRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467
               LK PVQIKFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 419 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/467 (70%), Positives = 385/467 (82%), Gaps = 24/467 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S ++FCDSKGK LLSR+Y+DD+  +A+++F  LL++ E+ESSV+PPC  HNGIHY+++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           Q+ND+Y++ALT S+S NA+ +F F++KL+ V+ EY+K VEEESIRDN++IIYELLDEMMD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL            PP  LTNSVSWRPEGIKYKKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           D++ESINMLMTQQGQVLRSEI+G VKVRSRLSGMPDLKLG+NDKGIF+            
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFT------------ 228

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                          P+P       S +K SN+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 229 --------TNDQEDSPEPVV----SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPP 276

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG F+LM+YRL+TPIKPLIWCDV + VHS SR+EIHCRAKAQIKKKS+ANNVEILIP+P+
Sbjct: 277 DGEFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPE 336

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420
           DAD+P+F+YS G+IKWVPEKNAILWK  SF GGKEYSMAAQLGLPS+ D E PKLKRPVQ
Sbjct: 337 DADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQ 396

Query: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467
           IKFQIPYFTTSGIQVRYLK+ EPKLQY SYPWVRYITQSGDDYTIRL
Sbjct: 397 IKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/467 (71%), Positives = 390/467 (83%), Gaps = 18/467 (3%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S++ FCDSKG  LL+R+YRDDIP++AI+ F TLL  LEEE+++VPPCL++NG+ YLFI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHND+Y+VA+  S+S NA+Q+F FL+KLV+V+  YLK VEEESIRDNFVIIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKLV           PP+ALTNSVSWR   IKYKKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DI+ESINMLMTQ+GQ+LRSEIIGEVKV+SRLSGMPDLKLGINDKGIFSK++         
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNN-- 269

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                           + ++     + +K +N+ELEDLKFHQCVRLSKFE EKIITFIPP
Sbjct: 270 ----------------EGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPP 313

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG+FELM+YRL+T IKPLIWCD+NI VHS+SR+EIHCRAKAQIKKKS A NV+I+IPVP+
Sbjct: 314 DGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPE 373

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420
           DADTP F+YSHGSIK+VPEKN I+WKIRSF GGKEYSM+AQ+ LPSI + E+ K KRPVQ
Sbjct: 374 DADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQ 433

Query: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467
           IKFQIPYFTTSGIQV+YLK+NEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 434 IKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 480

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/468 (72%), Positives = 387/468 (82%), Gaps = 26/468 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S+I FCD KG+ LLSRKYRDDIPLTAID FA+LL  LEEESSV+PPCLT+N   YLFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QH+D+Y+VA+T  L TN ++VF FL+K+++V+ +YLK VEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKLV           PP ALT+SVSWR EGIKYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DIVESINMLMTQ+GQ+LRSEI+G VK++SRLSGMPDLKLGINDKGIFSK L         
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTE------- 233

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                                 +  +S+K + +ELEDLKFHQCVRLSKFE EKIITFIPP
Sbjct: 234 ------------------DDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPP 275

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG+FELM+YRL+T IKPLIWCD+N+ VHS SR+EIHCRAKAQIKKKS A NVEILIPVP+
Sbjct: 276 DGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPE 335

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDD-NEKPKLKRPV 419
           DADTP+F+YSHGSIKWVPEK+AILWKIRSF GGKEYSMAA+L LPS    +E+ + K+PV
Sbjct: 336 DADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPV 395

Query: 420 QIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467
           Q+KFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 396 QVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/466 (71%), Positives = 384/466 (82%), Gaps = 27/466 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S I FCD+ GK +LSR+YRDD+P +AI+ F  LL++ E+ESSVVPPCLTHNG+ Y+FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHND+Y++ ++ SLS N +QVF+FL+KLVEV++EYLK VEEESIRDNFVIIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+           PP  LT SVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           D+ ESINML+T  GQVLRSEI+G+VKVRSRLSGMPDLKLG+NDKGIF+            
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTS----------- 229

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                           +      EG S K SN+ELEDL+FHQCVRLSKFENEKII+FIPP
Sbjct: 230 ----------------EEGGNNAEGGSGKKSNIELEDLQFHQCVRLSKFENEKIISFIPP 273

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG+F+LM+YRL+TPIKPLIWCD  I VHS+SR+EIHCRAKAQIKKKS ANNVEILIPVP+
Sbjct: 274 DGDFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPE 333

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420
           DAD+P FRYSHGS+K+VPEK+AILW+I++F GGKEYS AAQLGLPS+ D E PK KRP+Q
Sbjct: 334 DADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQ 393

Query: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466
           +KFQIPYFTTSGIQVRYLKV+EPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 394 VKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/467 (71%), Positives = 385/467 (82%), Gaps = 22/467 (4%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S I FCD+KGK LLSR+Y+DDIP++AI+ F  LL++ E+ES+V+PPC +HNG+ YLFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHNDLYI+ LT S+  N +QVF+FLH LV+V+ EY+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKL+           PP +LT +VSWRPEGIKYKKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           D++ESINM+MTQQGQVLRSEI+G+VKVRSRLSGMPDLKLG+NDKGIF++           
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQ----------- 229

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                           QPS       +RK SN+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 230 -----SNEEEEDEPSSQPSI------TRKKSNIELEDLKFHQCVRLSKFENEKIITFIPP 278

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG+FELMSYRL+TPIKPLIWCD  I VHS+SRVE+HCRAKAQIK KS ANNVEILIPVP+
Sbjct: 279 DGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPN 338

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420
           DAD+P FRYSHGSIKWVPEKNAILWKI+SF GGK+YSMAA++GLPS++D      KRPVQ
Sbjct: 339 DADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQ 398

Query: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467
           IKFQIPYFTTSGIQVRYLK+NEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 399 IKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/466 (71%), Positives = 385/466 (82%), Gaps = 27/466 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S I FCD+KGK +LSR+YRDD+P +AI+ F +LL++ E+ESS+VPPCLTHNG+ YLFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHND+Y++ ++ SLS N +QVF+FL+KLVEV++EY+K VEEESIRDNFVIIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+           PP  LT SVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           D+ ESINML+T  GQVLRSEI+G+V VRSRLSGMPDLKLG+NDKGIF+            
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVESAS------ 234

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                             S+   EG   K SN+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 235 ------------------SSEATEG---KKSNIELEDLKFHQCVRLSKFENEKIITFIPP 273

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG+FELM+YRL+TPIKPLIWCD  I VHS+SR+EIHCRAKAQIKKKS ANNVEILIPVP+
Sbjct: 274 DGDFELMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPE 333

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420
           DAD+P FRYSHGS+K+VPEK+AILWKI++F GGKEYS AAQLGLPS+ D E P+ KRP+Q
Sbjct: 334 DADSPKFRYSHGSLKYVPEKSAILWKIKTFNGGKEYSFAAQLGLPSMTDAEVPRAKRPIQ 393

Query: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466
           +KFQIPYFTTSGIQVRYLK+NEPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 394 VKFQIPYFTTSGIQVRYLKINEPKLQYQSYPWVRYITQSGDDYTIR 439

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/469 (72%), Positives = 388/469 (82%), Gaps = 14/469 (2%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S+I FCD+KG+ LLSRKYRDDIP +AID F  LL   EEE++++PPC+ HNGI +LFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY+VA+ TS+S NA+ +F+FLHK++EV+SEYLK VEEESIRDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YGIPQITE KMLKQYITQKSFKL            PP +LTNSVSWRPEGIK+KKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DI+ESINMLMTQ+GQVLRSEIIGEVKV+S+LSGMPDLKLGINDKG+FSKYL         
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                             S  + +   ++++N+ELEDLKFHQCVRLSKFENEK ITFIPP
Sbjct: 241 APD-------------DSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPP 287

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG+FELMSYRL+T IKPLIWCDVNI  HSKSR+EI CRAKAQIKKKS A NVEILIPVP+
Sbjct: 288 DGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPE 347

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKP-KLKRPV 419
           DADTP F+YSHGSIK+VPEKNAILWKIR+F G KEYSMAA++GLPS +  E+  KLKRPV
Sbjct: 348 DADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPV 407

Query: 420 QIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLN 468
           Q+KFQIPYFTTSGIQVRYLK+ E  LQYKSYPWVRYIT+SGDDYTIRL+
Sbjct: 408 QVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/473 (68%), Positives = 385/473 (81%), Gaps = 14/473 (2%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S++ FCD KGK LLSRKYRDDIPL+AID F++LL   EEES+++PPC++HNGI Y+FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY+ AL TS+  N S +F FLHK+++V+  YLK VEEESIRDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFL 180
           YG+PQITETKMLK+YIT KSFKL            PP  LTNSVSWRPEGIKYKKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           DI+ESINML+TQ+GQVLRSEI+G V+V+SRLSGMPDLKLGIND+GIF+KYL         
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAK 240

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                             S+   EGS+++ +N+ELEDLKFHQCVRLSKFENEKII+FIPP
Sbjct: 241 NGDDEDADDTN-----NESSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPP 295

Query: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360
           DG F+LM+YRL+T IKPLIWCDV+I  +   R+EIHC+AKAQIKKKSIA NVEILIPVP+
Sbjct: 296 DGEFDLMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPE 352

Query: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSI--DDNEKPKL--- 415
           DAD+P F+YSHG IK++PEKN +LWKI SF GGKEYSMAAQ+GLPSI  +D+   ++   
Sbjct: 353 DADSPIFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQ 412

Query: 416 -KRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467
            K+PVQ+KF+IPYFTTSGIQVRYLKVNEPKLQYK+YPWVRYITQSGDDYTIR+
Sbjct: 413 SKKPVQVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  218 bits (554), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 151/492 (30%), Positives = 243/492 (49%), Gaps = 55/492 (11%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M+S++     +G  ++S+  +D+I L   + F    +++     V  P LT     +  I
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVE-EESIRDNFVIIYELLDEMM 119
           + N    +   +  +T+++ ++ FL+   +++  Y  D+  E+S++ +F++ YE+LD ++
Sbjct: 58  RSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY--DINSEDSLQGDFMLCYEILDIVL 115

Query: 120 DYGIPQITETKMLKQYITQKSFK---------------LVXXXXXXXXXXXPPQALTNSV 164
           D GIP+ TE   +  YI++K                  LV                 +  
Sbjct: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175

Query: 165 SWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDK 224
            WR EGI+YKKNE +LD+ E I++L+ + G +L+S + G V+  + LSGMP  + G ND 
Sbjct: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND- 234

Query: 225 GIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCV 284
                YL                         +   G     +  T +V LED KFHQCV
Sbjct: 235 -----YLSPSSNTQSSGNDGW----------AEEENGTKAIKNAITGSVILEDCKFHQCV 279

Query: 285 RLSKFENEKIITFIPPDGNFELMSYR----LTTPIK--PLIWCDVNIHVHSKSRVEIHCR 338
           +L KF+ E++I F+PPDG FELM Y     L  P K  P++       +  KS VE    
Sbjct: 280 QLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMV-----TTLKGKS-VEYRIT 333

Query: 339 AKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSM 398
            K+    K  A +VE+ IP P D        S G  K++PE+NAI+WKI  + G  E   
Sbjct: 334 LKSLFPSKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVF 393

Query: 399 AAQLGLPSIDDNEKPKLKR----PVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVR 454
           +A + +P  + N+   L++    P+ ++F+I  F+ SG+ VRYLKV E  L Y +  WV+
Sbjct: 394 SAVI-VPMGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVK 452

Query: 455 YITQSGDDYTIR 466
           YI++SG  Y +R
Sbjct: 453 YISKSG-AYEVR 463

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  198 bits (503), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 138/497 (27%), Positives = 244/497 (49%), Gaps = 63/497 (12%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M+S++     +G+ L+S+  R  +P +  + F    +++     V  P LT     +  +
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHV 57

Query: 61  QH-NDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119
           +   +L+IVA++ S + +++ ++ FL+KL  ++  +    E E ++++F+  YELLD ++
Sbjct: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIVL 115

Query: 120 DYGIPQITETKMLKQYITQK---------SF---------------KLVXXXXXXXXXXX 155
           + G+P  TE   +   ++ K         +F               + +           
Sbjct: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHD 175

Query: 156 PPQALTNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMP 215
               + +++ WR  GIKYKKNE FL++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 176 SHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVEL 275
             + G+ND    S                             P+T +         +V L
Sbjct: 236 VCRFGLNDSLSVSTPFGDNE---------------------SPTTNKKAIPKAAAGSVML 274

Query: 276 EDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEI 335
           ED KFHQCV+L KF++E+ I FIPPDG+FELM Y +   +         + +   + ++ 
Sbjct: 275 EDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDY 334

Query: 336 HCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKE 395
               K+    K  A +V++ IPVP +        S+G  K+VPE++AI+WK   + G  E
Sbjct: 335 RVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTE 394

Query: 396 YSMAAQLGLP------SIDDNEKPKLKRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKS 449
            S++A   +P      +ID   KP    P+ +KF+I  F+ SG+ VR+  V+E    YK 
Sbjct: 395 NSLSAT-AVPMKDSALNIDQWSKP----PMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKM 449

Query: 450 YPWVRYITQSGDDYTIR 466
             W++Y+++SG  Y +R
Sbjct: 450 VKWIKYLSKSG-AYEVR 465

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  196 bits (499), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 135/493 (27%), Positives = 239/493 (48%), Gaps = 46/493 (9%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLT--HNGIHYL 58
           M+S+I   ++KG  L+S+  +D +  +  D F T ++    +  V  P LT       ++
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVI---NDPHVRSPILTLGSTTFQHV 57

Query: 59  FIQHND---LYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELL 115
             + +D   +++VA++ S + ++S ++ +LHKL ++M  +  + +E+ ++D F+++YE+L
Sbjct: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAFGIN-DEDVLKDEFMLLYEIL 115

Query: 116 DEMMDYGIPQITETKMLKQYITQKSFK-------------------LVXXXXXXXXXXXP 156
           +  ++ GIPQ T+   +   +++K  +                   L             
Sbjct: 116 ELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSI 175

Query: 157 PQALTNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPD 216
             +  +   WRP G+KYKKNE +LDI E I +L+ + G +++S + G V   S LSGMP 
Sbjct: 176 ALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPL 235

Query: 217 LKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELE 276
            +LG+ND   +S +                         P  + G          +V LE
Sbjct: 236 CQLGLNDT--YSIH-GNEKSELSIVEMMSEYDIKNKKAIPNAAAG----------SVILE 282

Query: 277 DLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIH 336
           D KFHQCV+L+K+E   +I F+PPDG F+LM YR+   I         + +   S +   
Sbjct: 283 DCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYK 342

Query: 337 CRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEY 396
              ++       A +V + IPVP       F  S G  K+   +  ++WK   + G  E 
Sbjct: 343 VTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTEN 402

Query: 397 SMAAQLGLPSIDDNEKPKL---KRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWV 453
           +++ ++ +P+   +    L   + P+ + F+I  F+ SG+ VR+LK  EP+L Y+   W+
Sbjct: 403 TLSGKVAIPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWI 462

Query: 454 RYITQSGDDYTIR 466
           +YI+ SG  Y IR
Sbjct: 463 KYISHSG-AYEIR 474

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  196 bits (499), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 149/514 (28%), Positives = 247/514 (48%), Gaps = 81/514 (15%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M++++     KG+ ++S+  RD I  +  + F    +++     V  P LT     +  I
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  QHN-DLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119
           + + +L+IVA+T S + +++ ++ FL+K   ++  Y  +  EES+++ F+  YELLD ++
Sbjct: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAYGLN-SEESLKEEFMTCYELLDVVL 115

Query: 120 DYGIPQITETKMLKQYITQKSFK-----------LVXXXXXXXXXXXPPQALTNSVS--- 165
           + G+P  TE   +   ++++              L+            P+ L        
Sbjct: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSS 175

Query: 166 ------------------WRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKV 207
                             WR  GIKYKKNE FLD+ E IN+L+++ G +L+S + G V +
Sbjct: 176 SVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235

Query: 208 RSRLSGMPDLKLGINDK-----GIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQ 262
            + LSG P  + G+ND      G  S+ L                        P+ + G 
Sbjct: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAI----------PKAAAG- 284

Query: 263 DEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYR----LTTPIK-- 316
                    +V+LED KFHQCV+L++F  ++II F+PPDG+FELM Y     L  P K  
Sbjct: 285 ---------SVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKIT 335

Query: 317 PLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKW 376
           P+     N        VE     K+    K  A +V + IPVP          S+G  ++
Sbjct: 336 PIFSVRSN-----NGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRF 390

Query: 377 VPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKR----PVQIKFQIPYFTTSG 432
           VPE+NA+LWK   + G  E +++A L +P +D+     L++    P+ + F+I  F+ SG
Sbjct: 391 VPEENAVLWKFAKYQGLTENTLSA-LTVP-MDNQSSLNLQQWSRPPMSLTFEILMFSNSG 448

Query: 433 IQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466
           + VR+ KV+E    Y +  WV+YI++SG  Y +R
Sbjct: 449 LVVRFFKVSERDHSYHTVKWVKYISRSG-AYEVR 481

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  189 bits (480), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 143/505 (28%), Positives = 245/505 (48%), Gaps = 70/505 (13%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M+S++    S+G+ ++S+ +++++  +  D F    +++     V  P LT     +  I
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFR---IQVINNLDVRSPILTLGSTTFQHI 57

Query: 61  QHN----DLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLD 116
           + N    DL++V++T S + N   V+ FL+K   ++  Y  +  EE +++ F++ YELLD
Sbjct: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELYGLN-NEEFLKEEFMVCYELLD 115

Query: 117 EMM-DYGIPQITETKMLKQYITQK-------SFKLVXXXXXXXXXXXPP----------Q 158
            M+ + G P  T+   + + ++ K       +F +            P           Q
Sbjct: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175

Query: 159 ALTNSVS----------WRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVR 208
             +N+ S          WRP+GI +KKNE FL + E I++L++++G +L+S + G + + 
Sbjct: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235

Query: 209 SRLSGMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSR 268
           + LSG P  + G+ND                                P+ + G       
Sbjct: 236 THLSGTPVCQFGLNDS----------LSVKNDDYGDSFDYIKNKKAIPKAAAG------- 278

Query: 269 KTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK-PLIWCDVNIHV 327
              +V LED KFHQCV L KF+ ++II F+PPDG+ ELM Y + + I  P     +  + 
Sbjct: 279 ---SVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYS 335

Query: 328 HSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKI 387
            S + VE     K+    K  A NV + IPVP +        S+GS K+ PE+ A+LW  
Sbjct: 336 SSGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTF 395

Query: 388 RSFAGGKEYSMAAQLGLPSIDDNEKPKL------KRPVQIKFQIPYFTTSGIQVRYLKVN 441
             + G  E +++A     +I   + P+L      K P+ + F+I  F+ SG+ VRY  + 
Sbjct: 396 NKYNGLTENTLSAV----TITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIK 451

Query: 442 EPKLQYKSYPWVRYITQSGDDYTIR 466
           E + +YK+  W+RY+++SG  Y IR
Sbjct: 452 ESE-RYKTVKWIRYVSKSG-SYEIR 474

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  188 bits (478), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 144/518 (27%), Positives = 249/518 (48%), Gaps = 80/518 (15%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNF-ATLLMKLEEESSVVPPCLTHNGIHYLF 59
           M+S +    S+G+ +L++ +++ +  +  D F   ++  L+  S V+   L     H++ 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHND-LYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEM 118
            +H D L++V +T S + N++ ++ FL+KL  VM+ Y  D  EE++++ F+I++E+LD M
Sbjct: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAYRLD-REEALKEEFMIVHEMLDIM 116

Query: 119 MD-YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXP-------------------PQ 158
           +   GIP  TE   L   I Q S K V                               P+
Sbjct: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPK 173

Query: 159 ALT-------------------NSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRS 199
            LT                   N ++WRP+GI +KK+E FL + E IN+L+++ G +L+S
Sbjct: 174 FLTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKS 233

Query: 200 EIIGEVKVRSRLSGMPDLKLGINDK-GIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQP 258
            + G + + + LSG P  + G+ND  G+ S+                           Q 
Sbjct: 234 YVDGTIDITTHLSGTPICRFGLNDSLGMQSE------------------DEKKWLAQQQR 275

Query: 259 STGQDEGSSR-----KTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTT 313
            +G D G+          +V LED KFH+CV L KF    II F+PPDG+ ELM Y +  
Sbjct: 276 HSGSDFGNKNFIPKAAAGSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRD 335

Query: 314 PIK-PLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHG 372
            I  P     +  H    + ++     K+    K  A +V + IPVP          S+G
Sbjct: 336 NINLPFKVTPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNG 395

Query: 373 SIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKR----PVQIKFQIPYF 428
             K+VPE+NA++W+   + G  E +++A     S  D  +  L++    P+ ++F++  F
Sbjct: 396 HCKFVPEENAMIWRFNKYNGLTENTLSAV--TVSTSDTTQLNLQQWTRPPISLEFEVMMF 453

Query: 429 TTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466
           + SG+ VRY  ++    ++++  W++YI+++G  Y +R
Sbjct: 454 SNSGLVVRYFTISGKDSKHRAVKWIKYISKAG-SYEVR 490

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  187 bits (476), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 138/510 (27%), Positives = 250/510 (49%), Gaps = 64/510 (12%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M++++    ++G+ ++S+ ++  +  +  D F    +++     V  P LT     +  I
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QH---NDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           +    ++L+IVA++ + + +++ ++ FL+KL  ++  Y  +  EE +++ F+I++ELLD 
Sbjct: 58  KSTRGDNLWIVAVSRN-NVDSAAIWEFLYKLDSLLDSYGLN-HEEYLKEEFMIVHELLDV 115

Query: 118 MM--DYGIPQITETKMLKQYITQKSFKLVXXXXXXXX------------------XXXPP 157
           MM    GIP +TE  ++   ++ K  K +                             P 
Sbjct: 116 MMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPK 175

Query: 158 QALTNSVS------------WRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEV 205
               NS S            WRP+GI +KKNE  L + E IN+L+++ G VL++ + G +
Sbjct: 176 LLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSI 235

Query: 206 KVRSRLSGMPDLKLGINDK----GIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTG 261
            + + LSG P  + G+ND     G+ S                               T 
Sbjct: 236 DLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNF------------DKTD 283

Query: 262 QDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK-PLIW 320
           + + S     +V LED KFHQCV L KF+ ++II F+PPDG+ ELM Y +   +  P   
Sbjct: 284 KKQLSMASVGSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKV 343

Query: 321 CDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEK 380
             +  +  + + +E     K+    +  A NV + IPVP +        ++GS K++PE+
Sbjct: 344 SPIVTNTRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEE 403

Query: 381 NAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKR----PVQIKFQIPYFTTSGIQVR 436
           +A++W+   F G  E +++A + +P+  DN +  L++    P+ + F+I  F+ SG+ VR
Sbjct: 404 SAMIWRFNKFNGLTENTLSA-VTIPT-KDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVR 461

Query: 437 YLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466
           Y  + E   +YK+  W++YI++SG  Y IR
Sbjct: 462 YFTITERDQKYKAVKWIKYISRSG-SYEIR 490

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  187 bits (474), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 141/495 (28%), Positives = 245/495 (49%), Gaps = 58/495 (11%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M++++     +G+ L+S+  +  +  +  + F    +++     V  P LT     +  I
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  QH-NDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119
           +   +L+IVA++ S + +++ ++ FL++L E++ E      E  +++ F+I YELLD ++
Sbjct: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIVL 115

Query: 120 DYGIPQITETKMLKQYITQK------SFKLVXXXXXXXXXXXPP---------------- 157
           + G+P  TE   +   ++ K      +F +             P                
Sbjct: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175

Query: 158 ---QALTNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGM 214
              +A +N + WR  GIKYKKNE FL++ E I++L+++ G +L+S + G V+  + LSGM
Sbjct: 176 IASEAPSN-IPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234

Query: 215 PDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVE 274
           P  + G+ND    S                           P+ + G          +V 
Sbjct: 235 PVCRFGLNDALSVSTPFGDDDEYQVTNKKAI----------PKAAAG----------SVM 274

Query: 275 LEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK-PLIWCDVNIHVHSKSRV 333
           LED KFHQCV+L KF++E+ I FI PDG+FELM Y +   +  P     +   V S S +
Sbjct: 275 LEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-I 333

Query: 334 EIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGG 393
           +     K+    K  A +V++ IPVP +  +     S+G  K+VPE++AI+WK   + G 
Sbjct: 334 DYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGL 393

Query: 394 KEYSMAAQLGLPSIDD--NEKPKLKRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYP 451
            E S++A   +P  D   N +   + P+ +KF+I  F+ SG+ VR+  V+E    YK   
Sbjct: 394 TENSISAT-AVPMKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVK 452

Query: 452 WVRYITQSGDDYTIR 466
           W++Y+++SG  Y +R
Sbjct: 453 WIKYLSKSG-AYEVR 466

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  186 bits (473), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 144/512 (28%), Positives = 246/512 (48%), Gaps = 77/512 (15%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M+S+I    S+G+ ++++  +  +  +  D F    +++     V  P LT     +  I
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHN---DLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           + +    L++VA++ S + N+  ++ FL+KL  +M  Y    +E ++++NF+  YE+LD 
Sbjct: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKLNVIMDVY-GLTKEGTLKENFMNCYEILDT 115

Query: 118 MMDYG-IPQITE-----TKML----KQ----------YITQKSFKLVXXXXXXXXXXXPP 157
           +++ G IP  TE     +KM     KQ           +T  S  L            P 
Sbjct: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175

Query: 158 QALTNS--------------VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIG 203
               N+              +SWRP GIKYKKNE  L++ E I++L+++ G +L+S + G
Sbjct: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235

Query: 204 EVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQD 263
            + + + LSGMP  + G+ND                                P+ + G+ 
Sbjct: 236 TIDLTTHLSGMPICQFGLNDS---------LSVEFGDDSISEVEDFANKKAIPKAAAGR- 285

Query: 264 EGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSY----RLTTPIK--P 317
                    V LED KFHQCV L KF  +++I F+PPDG+ ELM Y     L  P K  P
Sbjct: 286 ---------VMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTP 336

Query: 318 LIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWV 377
           ++       +   + ++     K+    K  A +V + IPVP          S+G  K+V
Sbjct: 337 IV-----TSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFV 391

Query: 378 PEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNE---KPKLKRPVQIKFQIPYFTTSGIQ 434
           PE++A++WK   + G  E +++A + +PS D  +   +   + P+ + F+I  F+ SG+ 
Sbjct: 392 PEESAMIWKFTKYTGLTENTLSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLV 450

Query: 435 VRYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466
           VRY KV++   +Y++  W++YI++SG  Y IR
Sbjct: 451 VRYFKVSDKDERYRTAKWIKYISKSG-SYEIR 481

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  184 bits (466), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 142/508 (27%), Positives = 244/508 (48%), Gaps = 63/508 (12%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M++ I     +G+ ++S+ ++  +  +  D F    +++     V  P LT     +  I
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QH----NDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLD 116
           +     ++L++VA T + + N++ ++ FL+KL  ++ EY  + +EE +++ F+I++ELLD
Sbjct: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEYGLN-KEEYLKEEFMIVHELLD 115

Query: 117 EMM-DYGIPQITETKMLKQYITQKSFKLVXXXXXX----------XXXXXPPQALT---- 161
            M+   GIP  TE   +   ++ K  KL                       P+ L     
Sbjct: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDS 175

Query: 162 ----------NSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRL 211
                     N  SWRP+ IK+KKNE  L + E IN+L+ + G +L++ + G + +++RL
Sbjct: 176 SQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235

Query: 212 SGMPDLKLGINDK---GIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSR 268
           SG P  + G+ND    G                               + S G       
Sbjct: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVG------- 288

Query: 269 KTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYR----LTTPIK--PLIWCD 322
              NV LED KFHQCV L KF+ E+II F+PPDG+ ELM Y     L  P K  P++   
Sbjct: 289 ---NVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNS 345

Query: 323 VNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNA 382
           V     +   ++     K+    +  A  V + IPVP      +   S+G+ K+VP +NA
Sbjct: 346 V-----TGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENA 400

Query: 383 ILWKIRSFAGGKEYSMAAQLGLPSIDDNE---KPKLKRPVQIKFQIPYFTTSGIQVRYLK 439
           ++WK   + G  E +++A + +PS + N+   +   + P+ + F+I  F+ SG+ VRY  
Sbjct: 401 MVWKFNKYNGLTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFT 459

Query: 440 VNEPKLQYKSYPWVRYITQSGDDYTIRL 467
           ++E    YK+  W++Y+++SG  Y +R 
Sbjct: 460 ISEGHQNYKAVKWIKYVSKSG-SYEVRF 486

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  182 bits (461), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 139/505 (27%), Positives = 236/505 (46%), Gaps = 76/505 (15%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M++ +     KG+ ++S+  + +   +  D F    +++     V  P LT     +  I
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFR---VQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHND---LYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           + N    L++VA+T S + N+  ++ FL+K   +++ +  D  E ++++ F+  YELLD 
Sbjct: 58  RSNSRDHLWLVAVTRS-NANSGAIWEFLYKFDSLLNAFGLD-NETTLKEEFMTCYELLDL 115

Query: 118 MMDY-GIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTN--------SVS--- 165
           M++  G+P  TE   +   ++ K    +                 +        S+S   
Sbjct: 116 MLNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDT 175

Query: 166 ---------WRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPD 216
                    WRP GIKYKKNE FL+I E I++L+++   +L++ + G V + S LSG P 
Sbjct: 176 MNTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTPT 235

Query: 217 LKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRK------- 269
            + G+ND                                P      D G   +       
Sbjct: 236 CQFGLNDS--------------------------LSVDEPNYYNSDDNGFRNQQNIPRAT 269

Query: 270 TSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIKPLIWCDVNIHVHS 329
              V LED KFH+CV L KF  ++II F+PPDG+ ELM Y +   I        N+ ++S
Sbjct: 270 AGTVVLEDCKFHECVSLDKFNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNV-INS 328

Query: 330 KSRVEIHCR--AKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKI 387
           +SR  +  R   K+    K  AN+V + IPVP          S+G  ++VPE++ I+WK 
Sbjct: 329 RSRTGLDYRITLKSLFPSKLSANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKF 388

Query: 388 RSFAGGKEYSMAAQLGLPSIDDNEKPKL------KRPVQIKFQIPYFTTSGIQVRYLKVN 441
             + G  E  ++A     ++  N+  +L      + P+ + F+I  F+ SG+ VRYLK+ 
Sbjct: 389 AKYNGLTENKLSAV----TVSSNDTTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIM 444

Query: 442 EPKLQYKSYPWVRYITQSGDDYTIR 466
           E   +Y++  W++YI++SG  Y +R
Sbjct: 445 EKDQKYRTVKWIKYISRSG-SYEVR 468

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  181 bits (460), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 138/545 (25%), Positives = 232/545 (42%), Gaps = 124/545 (22%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVP--PCLTHNGIHYL 58
           M S I   D   + L+ + ++      AI N    +   ++  S  P  P   + GIH++
Sbjct: 1   MSSCIYILDETLQPLIYKNFK------AISNGEESIELFQQAHSKHPMVPVFHYKGIHFV 54

Query: 59  FIQHNDLYIVALTTSLST--------NASQVFTFLHKLVEVMSEYL--KDVEEESIRDNF 108
           +I+ +  Y ++    ++         N   + T+L     ++  Y   + +    I DNF
Sbjct: 55  YIRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNF 114

Query: 109 VIIYELLDEMMDYGIPQITETKMLKQYI-----------------TQKSFKLVXXXXXXX 151
            +IYELLDE +D+G+PQ+T+  +++ YI                 ++K            
Sbjct: 115 HLIYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESY 174

Query: 152 XXXXPPQALTNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSR 210
                 +  T+++SWRP+GI Y KNE FLD++E I   M      +R   + G ++ RS 
Sbjct: 175 MNSFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSY 234

Query: 211 LSGMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKT 270
           LSGMP LK+G+                                        +   S  K 
Sbjct: 235 LSGMPKLKIGL---------------------------------------SKITSSLPKE 255

Query: 271 SNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTT-----PIKPLIWCDVNI 325
               + + KFHQCV L   + + I++FIPPDG F+L  Y+L       P+  L+  DV  
Sbjct: 256 REQFMNNAKFHQCVSLEDLQ-KNIVSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKK 314

Query: 326 HVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPSFRYSHGSIKWV 377
               + ++ I        K ++  + + I IP+         D A  P F+   G++ + 
Sbjct: 315 EEKKRPKILISLTITTDFKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFN 374

Query: 378 PEKNAILWKIRSFAGGK---EYSMAAQLGL------------------------------ 404
              + +LW++ S  GG    E+SM  +  L                              
Sbjct: 375 LTDDLLLWEVGSIKGGHAQTEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEE 434

Query: 405 --PSIDDNEKPKLKRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDD 462
               + +NE     R V ++F+IPY+T SG++V+YLK+ E +LQY S+PWVRY T + ++
Sbjct: 435 LYKQVHENENTNRSRLVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEE 494

Query: 463 YTIRL 467
           Y  ++
Sbjct: 495 YAYQI 499

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  181 bits (458), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 136/511 (26%), Positives = 242/511 (47%), Gaps = 66/511 (12%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M+S +    S+G+ +L++ +++ +  +  D F   ++   +  S V    +    H   +
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM 60

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120
           + ++L++V +T S + N++ ++ FL+KL  VM+ Y  D  EE++++ F+I++E+LD M+ 
Sbjct: 61  RGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAYRLD-REEALKEEFMIVHEMLDIMLG 118

Query: 121 -YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALT------------------ 161
             GIP  TE   L   I Q S K +               L+                  
Sbjct: 119 GNGIPIDTE---LNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHFPKFL 175

Query: 162 --------------------NSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEI 201
                               N ++WRP+GI +KK+E FL + E +N+L+++ G +L+S +
Sbjct: 176 KKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYV 235

Query: 202 IGEVKVRSRLSGMPDLKLGINDK-GIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPST 260
            G + + + LSG P  + G+ND  G+ S+                          P+ + 
Sbjct: 236 DGTIDITTHLSGTPVCRFGLNDSLGMQSE---DQENWLSQQDQHSHNGFENKNCFPKAAA 292

Query: 261 GQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK-PLI 319
           G          +V LED KFH+CV + KF    II F+PPDG+ ELM Y +   I  P  
Sbjct: 293 G----------SVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFK 342

Query: 320 WCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPE 379
              +  H    + V+     K+    K  A +V + IPVP          S+G+ K+VPE
Sbjct: 343 ITPIVAHSARDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPE 402

Query: 380 KNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKR----PVQIKFQIPYFTTSGIQV 435
           +NA++W+   F G  E +++A     S  D  +  L++    P+ + F++  F+ SG+ V
Sbjct: 403 ENAMIWRFNKFNGLTENTLSAV--TVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVV 460

Query: 436 RYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466
           RY  ++    ++++  W++YI++SG  Y +R
Sbjct: 461 RYFTISSRDSKHRAVKWIKYISKSG-SYEVR 490

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  180 bits (456), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 140/517 (27%), Positives = 242/517 (46%), Gaps = 78/517 (15%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNF-ATLLMKLEEESSVVPPCLTHNGIHYLF 59
           M+S +    S+G+ +L++ +++ +  +  D F   ++  L+  S V+   L     H++ 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHND-LYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEM 118
            +H D L++V +T S + N++ ++ FL+KL  VM+ Y  D  EE++++ F+I++E+LD M
Sbjct: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAYRLD-REEALKEEFMIVHEMLDIM 116

Query: 119 MD-YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALT---------------- 161
           +   GIP  TE   L   I Q S K V               L+                
Sbjct: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFPK 173

Query: 162 ----------------------NSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRS 199
                                 N ++WRP+GI +KK+E FL + E +N+L+++ G +L+S
Sbjct: 174 FLKKSSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKS 233

Query: 200 EIIGEVKVRSRLSGMPDLKLGINDK-GIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQP 258
            + G + + + LSG P  + G+ND  G+ S+                             
Sbjct: 234 YVDGTIDITTHLSGTPICRFGLNDSLGMQSE-----------------DEKKWLAQQQHH 276

Query: 259 STGQDEGSS----RKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTP 314
           S G  E  +        +V LED KFH+CV L KF     I F+PPDG+ ELM Y +   
Sbjct: 277 SRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDN 336

Query: 315 IK-PLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGS 373
           I  P     +  H    + ++     K+    K  A +V + IPVP          S+G 
Sbjct: 337 INLPFKITPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGH 396

Query: 374 IKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKR----PVQIKFQIPYFT 429
            K+VPE+NA++W+   + G  E +++A     S  D  +  L++    P+ + F++  F+
Sbjct: 397 CKFVPEENAMMWRFNKYNGLTENTLSAV--TVSTSDTTQLNLQQWTRPPMSLDFEVMMFS 454

Query: 430 TSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466
            SG+ VRY  +     ++++  W++YI++SG  Y +R
Sbjct: 455 NSGLVVRYFTIFGKDSKHRAVKWIKYISRSG-SYEVR 490

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  179 bits (453), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 139/508 (27%), Positives = 234/508 (46%), Gaps = 75/508 (14%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M+++I    ++G+ ++S+ + + +  +  D F    +++     V  P LT     +  I
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHN---DLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           + N    L+IV ++ + + N+  ++ FL+K   ++  Y    +EE ++++F+I YE+LD 
Sbjct: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDV 115

Query: 118 MMDYG-IPQITETKMLKQYIT---QKSFKLVXXXXXXXXXXXPPQALTNS---------- 163
           ++  G IP  TE   +   I+    KS               P   L+ S          
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 164 ----------------VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKV 207
                             WRP GIKYKKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 208 RSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSS 267
            + LSG P  + G+ND                                P+ + G      
Sbjct: 236 TTHLSGTPICQFGLNDS---------PSVEFGDSLWLDTQEFHNKKAVPKAAAGS----- 281

Query: 268 RKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSY----RLTTPIK--PLIWC 321
                V LED KFHQCV L KF  E+II F+PPDGN ELM Y     L  P K  P++  
Sbjct: 282 -----VMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-- 334

Query: 322 DVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKN 381
                    S VE     K+    K  A +V + IPVP          S+G  K+  E+N
Sbjct: 335 -----TPCGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEEN 389

Query: 382 AILWKIRSFAGGKEYSMAAQLGLPSIDDNE---KPKLKRPVQIKFQIPYFTTSGIQVRYL 438
           A++W+   + G  E +++A + +P+ D  +   +   + P+ + F+I  F+ SG+ VRY 
Sbjct: 390 AMVWRFNKYHGLTENTLSA-VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYF 448

Query: 439 KVNEPKLQYKSYPWVRYITQSGDDYTIR 466
           +V++   +Y+   W++YI++SG  Y +R
Sbjct: 449 RVSDKDEKYRVVKWIKYISKSG-SYEVR 475

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  176 bits (447), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 147/554 (26%), Positives = 244/554 (44%), Gaps = 136/554 (24%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M SSI   D +   L+ + ++    +   + FA    ++ + S+V  P + H GI ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHNDLYIVALTT-SLSTNASQVFTFLHKLVEVMSEYLK--DVEEESIRDNFVIIYELLDE 117
             + LY V+++  SL ++      +L+    ++ +YL+   ++   I DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 MMDYGIPQITETKMLKQYI--------------------------------TQKSFKLVX 145
            +D+GIPQ+T+  +++  I                                 +KS K   
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 146 XXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFLDIVESINMLMT-QQGQVLRSEIIGE 204
                       +  T ++SWRP+GI Y KNE F+D++ES   +M  +  QV ++ I G 
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 205 VKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDE 264
           +  RS LSGMP +K+ IN      K L                                 
Sbjct: 236 IICRSYLSGMPVVKICIN------KML--------------------------------- 256

Query: 265 GSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLT-----TPIKPLI 319
               K  +  L   KFHQCV L    ++  I FIPPDG+F+L  Y++      +P+  LI
Sbjct: 257 ----KDRDQFLSSAKFHQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLI 312

Query: 320 WCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADT--------PSFRYSH 371
              V +    K +++I  + +   K ++ A  ++I +P+ D  +T        P F+   
Sbjct: 313 EYKV-VEKPKKHKLQISMKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDF 371

Query: 372 GSIKWVPEKNAILWKIRSFAGGKE---YSMAAQL-------------------------- 402
           GSI +      +LWK     GG     +SM  +                           
Sbjct: 372 GSILFNLSDGYLLWKANGMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLRE 431

Query: 403 -----GLPSIDDNEKPKLKRPVQ----IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWV 453
                 L ++   EK ++  PV+     +F++PYFT+SG++V YLK+ E +LQY+S+PWV
Sbjct: 432 GVRMEELYALAHEEKGQINNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWV 491

Query: 454 RYITQSGDDYTIRL 467
           RY T +  +Y  ++
Sbjct: 492 RYKTINDTEYAFQM 505

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  174 bits (441), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 134/513 (26%), Positives = 241/513 (46%), Gaps = 70/513 (13%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNF-ATLLMKLEEESSVVPPCLTHNGIHYLF 59
           M+S +    S+G+ +L++ +++ +  +  D F   ++  L+  S V+   L     H++ 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHND-LYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEM 118
            +H D L++V +T S + N++ ++ FL+KL  VM+ Y  D  EE++++ F+I++E+LD M
Sbjct: 59  SKHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAYRLD-REEALKEEFMIVHEMLDIM 116

Query: 119 MD-YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQAL----------------- 160
           +   GIP  TE   L   + + S K +               L                 
Sbjct: 117 LGGNGIPIDTE---LNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFPK 173

Query: 161 ---------------------TNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRS 199
                                +N ++WR  GI +KK+E FL + E +N+L+++ G +L+S
Sbjct: 174 FLKKSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKS 233

Query: 200 EIIGEVKVRSRLSGMPDLKLGINDK-GIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQP 258
            + G + + + L+G P  + G+ND  G+ S+                          P+ 
Sbjct: 234 YVDGTIDIVTHLNGTPVCRFGLNDSLGMQSE---DEKNWLAQQHQHSRSDFGNKNFLPKA 290

Query: 259 STGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK-P 317
           + G          +V LED KFH+CV + KF    II FIPPDG+ ELM Y +   I  P
Sbjct: 291 AAG----------SVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLP 340

Query: 318 LIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWV 377
                +  H    + ++     K+    K  A +V + IPVP          S+G  K+V
Sbjct: 341 FKITPIVSHSTRDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFV 400

Query: 378 PEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKR----PVQIKFQIPYFTTSGI 433
           PE+NA++W+   + G  E +++A     S  D  +   ++    P+ + F++  F+ SG+
Sbjct: 401 PEENAMIWRFNKYNGLTENTLSA--ATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGL 458

Query: 434 QVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466
            VRY  ++    ++++  W++YI++SG  Y +R
Sbjct: 459 VVRYFTISGKDSKHRAVKWIKYISKSG-SYEVR 490

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  172 bits (435), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 135/511 (26%), Positives = 234/511 (45%), Gaps = 76/511 (14%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M++++     +G+ L+ + ++  +  T  D F    +++    ++  P LT     + FI
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFR---VQVINNDNIRSPILTLGSTTFHFI 57

Query: 61  Q---HNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           +    + L++VA+T S + ++  ++ +L+KL  +M  Y     E+ ++D F++ +ELLD 
Sbjct: 58  RTTAGSKLWLVAVTRS-NADSGAIWEYLYKLNSLMEVY-GLTHEDILKDEFIVCHELLDI 115

Query: 118 MMDY-GIPQITETKMLKQYITQKSFK-----------LVXXXXXXXXXXXP---PQALT- 161
            +   G+P  TE   +   +T K  +           L            P   P+ L+ 
Sbjct: 116 TLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSR 175

Query: 162 ----------------NSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEV 205
                           +++ WR   IKYKKNE  ++++E IN+L+ +   +LR+ + G +
Sbjct: 176 NSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTI 235

Query: 206 KVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEG 265
            + + LSGMP  ++G+ND                                    T +D  
Sbjct: 236 DITAHLSGMPMCQIGMNDLSTIQG------------------------GENAHWTNEDRA 271

Query: 266 SSRKT------SNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK-PL 318
           S+R          V LE  KFHQCV L K+  + +I FIPPDG FELM Y ++  +  P 
Sbjct: 272 SNRDAMPDVSGDRVILEGSKFHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPF 331

Query: 319 -IWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWV 377
            I   V +  H  + +    + K+   +K  A NV + IPVP          S G  K++
Sbjct: 332 RITPQVTLTSHGTA-LSYAIKLKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFI 390

Query: 378 PEKNAILWKIRSFAGGKEYSMAAQ-LGLPSIDDNEKPKLKR-PVQIKFQIPYFTTSGIQV 435
           PE+N ++W    F G  E  + AQ +   SI      +  R P+ + F++  F+ +G+ V
Sbjct: 391 PEENCMVWSFHRFNGSTENHLNAQTVPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIV 450

Query: 436 RYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466
           RYLKV E  + Y +  W++YI+ +G  Y +R
Sbjct: 451 RYLKVQEKNMHYNTIKWIKYISAAG-SYEVR 480

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  171 bits (434), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 128/489 (26%), Positives = 210/489 (42%), Gaps = 124/489 (25%)

Query: 48  PCLTHNGIHYLFIQHNDLYIVALTTSLSTNASQ-VFTFLHKLVEVMSEYLKD-VEEESIR 105
           P L+H G  Y++IQ + LY ++L+  + T     VF +L +L ++  +YL + +  + I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFVIIYELLDEMMDYGIPQITETKMLKQYITQK-------------SFKLVXXXXXXXX 152
           DNF ++YEL+DE +D GIPQ+T+  +++ Y+  +               K          
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 153 XXXPPQAL-------------TNSVSWRPEGIKYKKNEAFLDIVESINMLMT-QQGQVLR 198
               P A              T+++SWRP GI Y KNE FLD+VE +  LM  ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQP 258
           +++ G +  RS LSGMP L +G+N                                    
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLNKM---------------------------------- 246

Query: 259 STGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLT-----T 313
              QD      TS V      FHQCV L +   ++ ITF+PPDG F+L  Y+L       
Sbjct: 247 -VAQDRDF---TSQVH-----FHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQ 297

Query: 314 PIKPLIWCDVNIHVHSK----SRVEIHCRAKAQIKKKSIANNVEILIPVP--------DD 361
           P+  L  C   +    +     R+ +        K +   + +++ +P+         D 
Sbjct: 298 PLIKLEECRAAVKPRRRPADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDL 357

Query: 362 ADTPSFRYSHGSIKWVPEKNAILW---KIRSFAGGKEYSMAAQLGL----------PSID 408
           +  P F+   G + +    + +LW   K +   G + ++M +Q  L            + 
Sbjct: 358 SFPPRFKCDAGCVMFNITDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLS 417

Query: 409 DNEKPKLKRPVQ----------------------IKFQIPYFTTSGIQVRYLKVNEPKLQ 446
            +  P    P Q                      + F++PY T SG++V +LK+ EP+LQ
Sbjct: 418 TSMDPLPAHPGQQLEALYNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQ 477

Query: 447 YKSYPWVRY 455
           Y+S+PW+RY
Sbjct: 478 YQSFPWIRY 486

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  171 bits (433), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 137/510 (26%), Positives = 220/510 (43%), Gaps = 138/510 (27%)

Query: 48  PCLTHNGIHYLFIQHNDLYIVALTTS-LSTNASQVFTFLHKLVEVMSEYLK--DVEEESI 104
           P +   GI Y++I  + LY V+++   L  N   +  +L+    ++ +YLK   V+   I
Sbjct: 43  PVIYSKGIIYIYILRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGI 102

Query: 105 RDNFVIIYELLDEMMDYGIPQITETKMLKQYITQKSF--KLVXXXXXXXXXXXPPQAL-- 160
            DNF +IYEL DE +DYGIPQ+T+  +++  I  ++   K+             P+ L  
Sbjct: 103 IDNFNLIYELFDESLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQS 162

Query: 161 ---------------------------TNSVSWRPEGIKYKKNEAFLDIVESINMLMT-Q 192
                                      T ++SWRP+GI Y KNE F+DI+E  + LM  +
Sbjct: 163 KENKDKADIHGFRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFK 222

Query: 193 QGQVLRSEIIGEVKVRSRLSGMPDLKLGIN----DKGIFSKYLXXXXXXXXXXXXXXXXX 248
             QV ++ + G++  RS LSGMP +++ IN    DK +F                     
Sbjct: 223 NSQVRQTFVYGKINCRSYLSGMPIVRVCINKMLKDKDLFL-------------------- 262

Query: 249 XXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMS 308
                           GSS           KFHQCV L    ++  I FIPPDG+F+L  
Sbjct: 263 ----------------GSS-----------KFHQCVSLESLSSQDYIEFIPPDGDFQLCE 295

Query: 309 YRLT-----TPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVP---- 359
           Y+L      +PI  LI   +N     K R+ +    +   K ++ A  ++I IP      
Sbjct: 296 YKLKRHINDSPIIKLIDYKIN-ERQKKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQ 354

Query: 360 ----DDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGK---EYSMAAQLGLPSIDDNEK 412
               D    P F+  HGS+ +      +LW  +   GG     YSM  +  L   +++ +
Sbjct: 355 NYKIDLTKAPRFKCDHGSVFFNLSDELLLWDAQGIKGGHGETSYSMHVEFALFDEEEHAR 414

Query: 413 -----------PKLKRPVQI------------------------KFQIPYFTTSGIQVRY 437
                      P L+    +                        +F++PY+T+SG++V Y
Sbjct: 415 KLEQIKKSMDPPPLREGAHLEELYAQVKSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEY 474

Query: 438 LKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467
           LK++E  L+Y+S+ WVRY T +  +Y  ++
Sbjct: 475 LKISEENLKYQSFSWVRYKTINDTEYAYQV 504

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  170 bits (431), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 110/407 (27%), Positives = 193/407 (47%), Gaps = 50/407 (12%)

Query: 48  PCLTHNGIHYLFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDN 107
           P LT     +  I+ +    + +    + +++ ++ FL+ + +++  Y  + EE ++ D+
Sbjct: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEE-ALLDD 103

Query: 108 FVIIYELLDEMMDYGIPQITETKMLKQYITQK--------------SFKLVXXXXXXXXX 153
           F++ YELLD ++D G+PQ TE   +   +++K              S +L          
Sbjct: 104 FMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSV 163

Query: 154 XXPPQALTNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSG 213
                   +   WR EGIKYKKNE +LD++E +++L+ + G +L++ + G V+  + LSG
Sbjct: 164 ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSG 223

Query: 214 MPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNV 273
           MP    G ND     +                          P+         + +  +V
Sbjct: 224 MPLCHFGFNDSQSLRQ------------------------RSPRRQYAPRVFGTDERESV 259

Query: 274 ELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRV 333
            LED KFHQCV+L+KF+ E++I F+PPDG FELM Y +   ++P       +   ++  +
Sbjct: 260 VLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSI 319

Query: 334 EIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGG 393
           E     ++    K  A +VE+ IP P    +     S G  K+VPE+NAI+WKI  F G 
Sbjct: 320 EYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGL 379

Query: 394 KEYSMAAQLGLPSIDDNEKPKL-------KRPVQIKFQIPYFTTSGI 433
            E +++A     +I D +           + P+ +K +I  F+T+ +
Sbjct: 380 TENTLSAV----TIADEQGHYAQVLDQWPRPPISMKLEIMMFSTAAL 422

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  161 bits (407), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 138/504 (27%), Positives = 230/504 (45%), Gaps = 70/504 (13%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M++ +    S+G  ++    +  +  T  D F   ++   E  S   P LT     +  I
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKS---PILTLGSTTFHHI 57

Query: 61  QHND---LYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           + +    L+IVA+T S + N+  ++ FL+KL  +++ Y  +  EE + + F++ YE++D 
Sbjct: 58  RSSSESKLWIVAITRS-NANSGVIWEFLYKLDSMLTAYDLN-NEEKLMEKFMVYYEMIDV 115

Query: 118 MM-DYGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXP----PQALTNS--------- 163
           M+    +P  TE   +   I+ +  K +                P+ LT +         
Sbjct: 116 MLTSNAMPINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFS 175

Query: 164 ------VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDL 217
                 + WRP GIKYKKNE FL + E IN+L+++   +L++ + G + + S LSG P  
Sbjct: 176 NITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPIC 235

Query: 218 KLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELED 277
           + G+ND      YL                           STG+       +S+V++ED
Sbjct: 236 QFGLND------YLSMTGNNISNRGDEFRHDFMDDEDL---STGR-----SSSSSVKIED 281

Query: 278 LKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEI-- 335
             FHQCV L KF +E++I F+PPDG+FELM Y +          D+NI      RV I  
Sbjct: 282 CTFHQCVSLDKFNDERLINFVPPDGSFELMRYHVRD--------DLNIPFKVTPRVSISS 333

Query: 336 -HCRAKAQIKKKSI------ANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIR 388
             C  + +I  KS+      A +  + IP+P          S G   +    N  +WK  
Sbjct: 334 SRCSMRYKIILKSLFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFN 393

Query: 389 SFAGGKEYSM------AAQLGLPSIDDNEKPKLKRPVQIKFQIPYFTTSGIQVRYLKVNE 442
            + G  E  +      ++   + S+    +P    P+ + F+I  F+ SG+ V+YLKV E
Sbjct: 394 KYKGLTENELILETVPSSSTDILSLQQWTRP----PMSMNFEIIMFSNSGLVVKYLKVME 449

Query: 443 PKLQYKSYPWVRYITQSGDDYTIR 466
              +Y+   W++Y+++SG  Y IR
Sbjct: 450 RVQKYRPVKWIKYVSKSG-SYEIR 472

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  160 bits (406), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 141/549 (25%), Positives = 231/549 (42%), Gaps = 134/549 (24%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDN-FATLLMKLEEESSVVPPCLTHNGIHYLF 59
           M S     D   + L+ R  R   P+  +D+    L   L+       P    NG HY  
Sbjct: 1   MSSCFLLLDETYEPLIRRALR---PIHFLDDAILQLQNNLKHHKGCTKPIFEGNGWHYAV 57

Query: 60  IQHNDLYI-VALTTSLSTNASQVFTFLHKLVEVMSEYLK-DVEEESIRDNFVIIYELLDE 117
           I  ++LY  + +  + S +   V  +L ++ ++  +++   + + ++RDNF +I+E+++E
Sbjct: 58  ITRDNLYFAMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNVRDNFHLIFEVIEE 117

Query: 118 MMDYGIPQITETKMLKQYITQKSFKLV--XXXXXXXXXXXPP-------------QALTN 162
             DYGI Q+T   ++  +I  +  K               PP             + +T+
Sbjct: 118 SSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYILRTMTS 177

Query: 163 SVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKLGI 221
           +VSWRP+GI Y KNE FLD++E +  +M  +  V+R+ +I G +  RS LSGMP L +G+
Sbjct: 178 AVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIGL 237

Query: 222 NDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVE-LEDLKF 280
           N                                                 NV  ++ LKF
Sbjct: 238 N--------------------------------------------KLMQKNVHFMKRLKF 253

Query: 281 HQCVRLSKF--ENEKIITFIPPDGNFELMSYRLTTPI--KPLIWCDVNIHVHSKSRVEIH 336
           H+CV L     E   +I FIPPDG FEL +Y+L  P+  +P+I    +  +  K R    
Sbjct: 254 HECVDLHTLIKEESPVIKFIPPDGEFELCNYKLNRPLLDEPVIKLQ-SFGLSQKPRKNQE 312

Query: 337 CRAKAQIKK------KSIANNVEILIPVP----------DDADTPSFRYSHGSIKWVPEK 380
            + K  +K       K+  +  E+LI +P          D    P F+   G + +    
Sbjct: 313 TQDKLLLKAAITTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITA 372

Query: 381 NAILWKIRSFAGG---KEYSMAAQLGLPSIDDNEK-----------------PKLKR--- 417
            +I+WKI +  GG   K Y +     +     +E                  PKL+R   
Sbjct: 373 GSIIWKINNLKGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWD 432

Query: 418 -----------------------PVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVR 454
                                   + + F+IPY+  SG++V Y K+ EP+L Y+S+PWVR
Sbjct: 433 QYHGKTTEYDGNENQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVR 492

Query: 455 YITQSGDDY 463
           Y T + ++Y
Sbjct: 493 YKTVNDNEY 501

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  151 bits (382), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 124/504 (24%), Positives = 217/504 (43%), Gaps = 127/504 (25%)

Query: 48  PCLTHNGIHYLFIQHNDLYIVALTTSLSTNASQV-FTFLHKLVEVMSEYL-KDVEEESIR 105
           P L +    Y+FIQ + LY ++L+  L+     V F++L++L  +  +YL +++ +  I 
Sbjct: 41  PILQNMDYDYIFIQRDGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLIT 100

Query: 106 DNFVIIYELLDEMMDYGIPQITETKMLKQYITQKSFK----------------------- 142
            NF +I+EL+DE +  G PQ+T+  +++ YI  +  K                       
Sbjct: 101 GNFHLIHELIDESIFMGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKDS 160

Query: 143 -----LVXXXXXXXXXXXPPQALTNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVL 197
                               +  T+++SWRP+GI Y KNE +LD++E +  L+  Q   +
Sbjct: 161 KKKEEDTEATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNI 220

Query: 198 RSEII-GEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXP 256
           +S  + G ++ RS LSGMP L +G+N                                  
Sbjct: 221 KSNTVYGYIQCRSYLSGMPMLTIGLNKLN------------------------------- 249

Query: 257 QPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTT--- 313
                ++E   R+ +        FHQCV L +   +K+I+F PPDG F+L +Y+LT    
Sbjct: 250 ----SENEYFMRRAN--------FHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMS 297

Query: 314 --PIKPLIWCDVNIHVHSK----SRVEIHCRAKAQIKKKSIANNVEILIPVP-------- 359
             P+  L  C V +          R+ +        K +   + + I +P+         
Sbjct: 298 DPPMIKLEDCKVKLKPRKTKDGLDRLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDV 357

Query: 360 DDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGG---KEYSMAAQLGLPSIDDNEK---- 412
           D +  P F+   G + +    + +LW++    GG   K   M ++  L + +   +    
Sbjct: 358 DLSYQPRFKCEQGKVMFNITDDYLLWEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQ 417

Query: 413 -------------PKLKRPVQ----------------IKFQIPYFTTSGIQVRYLKVNEP 443
                        P L++  Q                ++F+IPY+T SG++V +LK+ E 
Sbjct: 418 LSNSMDPKPIRRGPHLEKLYQQTHELNSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEK 477

Query: 444 KLQYKSYPWVRYITQSGDDYTIRL 467
           +LQ++S+PWVRY T + D Y  +L
Sbjct: 478 QLQFQSFPWVRYKTINHDIYAYQL 501

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  143 bits (361), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 120/502 (23%), Positives = 233/502 (46%), Gaps = 65/502 (12%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNF-ATLLMKLEEESSVVPPCLTHNGIHYLF 59
           M++++    ++G+ ++S+ ++  +  +  D F   ++  L+  S ++   L     HY+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPIL--TLGSTTFHYVR 58

Query: 60  IQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119
                L++V+++ + + N++  + FL+K   +++ Y  D  EE +++ F++ +ELLD M+
Sbjct: 59  TPGEGLWVVSVSRN-NENSAATWEFLYKFATMLAAYRLD-SEEVLKEEFMLAWELLDTMV 116

Query: 120 DYG-IPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSW------------ 166
           + G IP  T+   +   I+  S K               Q  T++ ++            
Sbjct: 117 EGGGIPSETDPHRI---ISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRAS 173

Query: 167 RPEGI-----------KYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMP 215
            P GI           + K+NE  + + ESI++L+++ G +L++ + G + + ++L G  
Sbjct: 174 NPGGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAA 233

Query: 216 DLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQD-EGSSRKTSNVE 274
             + G+ND                                 + + G + E  +     V 
Sbjct: 234 VCQFGLNDS----------------LSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVL 277

Query: 275 LEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYR----LTTPIKPLIWCDVNIHVHSK 330
           L D KFHQCV L +F+ ++II F PP+G  ELM Y     L  P K         +  + 
Sbjct: 278 LRDCKFHQCVSLERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETD 337

Query: 331 SRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSF 390
            RV I    K+    K  A NV + IPVP          S+G+ K++PE+NA++WK   +
Sbjct: 338 YRVTI----KSLFPGKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKY 393

Query: 391 AGGKEYSMAAQLGLPSIDDNE---KPKLKRPVQIKFQIPYFTTSGIQVRYLKV---NEPK 444
            G  E  ++A + +P+ D  +   +   + P+ + F+I  ++ +G+ VRY  V   +   
Sbjct: 394 NGLTENKLSA-ITVPTRDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNN 452

Query: 445 LQYKSYPWVRYITQSGDDYTIR 466
            ++K+  W++Y++ SG  Y +R
Sbjct: 453 TKFKTVKWIKYVSHSG-SYEVR 473

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  129 bits (323), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 104/351 (29%), Positives = 156/351 (44%), Gaps = 96/351 (27%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKLGIN 222
           VSWR +GI Y +NE FLD+VE +  LM     +++  +I G++  +S LSGMP LK+  N
Sbjct: 216 VSWRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN 275

Query: 223 DKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQ 282
                                                + +DE          +   KFHQ
Sbjct: 276 -----------------------------------KLSQKDEQF--------ISHSKFHQ 292

Query: 283 CVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK--PLIWCDVNIHVH---SKSRVEIHC 337
           CV      NEK I FIPPDG+F L  Y L   +K  P++   V+  V     K ++++ C
Sbjct: 293 CVTWPS-SNEKEIEFIPPDGDFVLCQYELKRHVKDQPMLKL-VSFGVKPKLKKYKIQMSC 350

Query: 338 RAKAQIKKKSIANNVEILIPVPD-------DADTPS-FRYSHGSIKWVPEKNAILWKIRS 389
             +   K ++  + + + IP+         D   P+ F+   G + +    + +LW I  
Sbjct: 351 TIETHFKARNSTSTLNLKIPLARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEV 410

Query: 390 FAGGK---EYSMAAQLGL-------------------PSIDD------------NEKPKL 415
             GG    + SMAA+  L                   P + D            NEK   
Sbjct: 411 MKGGHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPS 470

Query: 416 K---RPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDY 463
           K   R + +KF+IPY T SG+QV YLK++E +LQY+S+PWVRY T + ++Y
Sbjct: 471 KMASRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQSFPWVRYKTVNDEEY 521

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 56/96 (58%), Gaps = 4/96 (4%)

Query: 48  PCLTHNGIHYLFIQHNDLYIVALTTSL--STNASQVFTFLHKLVEVMSEYL--KDVEEES 103
           P ++ +  H++ I+ + L  V++  +   S N   + TFL +   ++ +YL    +++  
Sbjct: 43  PVISASSFHFVHIKRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNM 102

Query: 104 IRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
           + DN ++I EL+DE +D+G+ QIT+  +++ YI  K
Sbjct: 103 VLDNVLLIMELIDESIDFGVIQITDASIMRDYIRVK 138

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  127 bits (319), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 109/379 (28%), Positives = 163/379 (43%), Gaps = 117/379 (30%)

Query: 161 TNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKL 219
           T +VSWR +GI Y KNE FLD+VES+  LM  + +V+R  +I G++K +S LSGMP L++
Sbjct: 222 TMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRI 281

Query: 220 GINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLK 279
            +N                                       QD+          L   K
Sbjct: 282 ALN------------------------------------KILQDDKQF-------LGHAK 298

Query: 280 FHQCVRLS--------------------KFENEKIITFIPPDGNFELMSYRLTTPIK--P 317
           FHQCV L+                     F N+K I FIPPDG F L  Y L   +K  P
Sbjct: 299 FHQCVSLNSINIKDLEKDLEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPP 358

Query: 318 LI-WCDVNIHVH-SKSRVEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPSF 367
           +I     +I  +  K RV+I  + +   K+++  + + I IP+         D +  P F
Sbjct: 359 VINMTSFDIKPNFKKFRVQISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRF 418

Query: 368 RYSHGSIKWVPEKNAILWKIRSFAGG---KEYSMAAQLGL-------------------- 404
           +   G + +   ++ ++W+I +  GG    E  M A+  L                    
Sbjct: 419 KSDVGKVLFNISEDFLIWEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPP 478

Query: 405 -----PSI----------DDNEKPKLKRPVQ---IKFQIPYFTTSGIQVRYLKVNEPKLQ 446
                P +          +D E   LK   Q   ++F+IPY T SG++V YLK+ E  L+
Sbjct: 479 PLRNGPKLEELYEEMHENEDAEDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLK 538

Query: 447 YKSYPWVRYITQSGDDYTI 465
           Y+S+PWVRY T + D+Y  
Sbjct: 539 YQSFPWVRYKTLNDDEYAF 557

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 55/98 (56%), Gaps = 5/98 (5%)

Query: 47  PPCLTHNGIHYLFIQHNDLYIVALTTSLS---TNASQVFTFLHKLVEVMSEYLKD--VEE 101
           PP +T +  HY++++ + L+ VA    +     N   +  +L +L  ++  Y K   + +
Sbjct: 42  PPIITVSNWHYVYVKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTK 101

Query: 102 ESIRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
             I DN +++ EL+DE +D+GI Q+T+  +++ YI  K
Sbjct: 102 LLIIDNALLVTELMDESIDFGIIQMTDPSIIRDYIRVK 139

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  123 bits (308), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 99/360 (27%), Positives = 153/360 (42%), Gaps = 102/360 (28%)

Query: 163 SVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKLGI 221
           SVSWR +GI+Y KNE FLD++E +   M     +++  +I GE+  +S LSGMP LK+ +
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 222 NDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFH 281
           N K I+                                  QD+          L   KFH
Sbjct: 282 N-KIIY----------------------------------QDKQF--------LSSCKFH 298

Query: 282 QCVRLSKFENEKIITFIPPDGNFELMSYRLTT-----PIKPLIWCDVNIHVHSKSRVEIH 336
           QCV     +  K++ F+PPDG+F L  Y L       P+  LI  +V   +  K ++++ 
Sbjct: 299 QCVMPDSVDEGKVLEFVPPDGDFVLCKYELKRHVNDLPLLKLISYEVKPKL-DKYKLKLF 357

Query: 337 CRAKAQIKKKSIANNVEILIPVP--------DDADTPSFRYSHGSIKWVPEKNAILWKIR 388
              ++  KK +    + I IP+         D +     R   G I +    + +LW+I 
Sbjct: 358 VTIESTFKKTNSTTKLNIKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIG 417

Query: 389 SFAGGK-EYSMAAQLGLPSIDD-----------------NEKPKLKRP------------ 418
           +  GG  +  M A   L + ++                    PKL+              
Sbjct: 418 AMKGGNSQLKMGADFALFNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNF 477

Query: 419 --------------VQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYT 464
                         +++ F+IPY T+SG++V YLK+ EP LQY+++PWVRY T S D Y 
Sbjct: 478 TRKGESSDETKGNLIKMDFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 61/116 (52%), Gaps = 10/116 (8%)

Query: 23  DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFIQHNDLYIVALTTSLSTNASQVF 82
           DIPL+       L  K   +  V  P + +    +  IQ + LY V+ +    TN  +  
Sbjct: 27  DIPLS-------LFKKQFHKHQVTTPVIIYEDYIFTCIQRDTLYFVS-SIDCKTNILETL 78

Query: 83  TFLHKLVEVMSEY--LKDVEEESIRDNFVIIYELLDEMMDYGIPQITETKMLKQYI 136
            +L++   ++  Y  +K +++  I DN V I EL++E +D+GI QIT++ ++K YI
Sbjct: 79  HYLNEFYILLKNYFNVKQLDKNIIMDNLVPILELIEESVDFGIIQITDSNLMKDYI 134

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  122 bits (305), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 108/395 (27%), Positives = 160/395 (40%), Gaps = 142/395 (35%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMT-QQGQVLRSEIIGEVKVRSRLSGMPDLKLGI- 221
           VSWR +GI Y KNE FLD++E +  L+  + G V RS I G++  RS LSGMP LK+ + 
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 222 ----NDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELED 277
               NDK   S+                                                
Sbjct: 309 KLLQNDKQFISQ------------------------------------------------ 320

Query: 278 LKFHQCVRLSKFEN----------------------EKIITFIPPDGNFELMSYRLTTPI 315
           ++FHQCV L   E                       E  I FIPPDG+F L SY L   I
Sbjct: 321 VQFHQCVSLDSIEKVIKYAEEHSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHI 380

Query: 316 K--PLI-WCDVNIHVH-SKSRVEIHCRAKAQIKKKSIANNVEILIPVPD-------DADT 364
           +  P++  C   I     K +++I    +   K  +  + +++ IP+         D   
Sbjct: 381 RDPPMVKLCSFEITPKWKKYKLKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKK 440

Query: 365 P-SFRYSHGSIKWVPEKNAILWKIRSFAGGKEY-------------SMAAQLGL------ 404
           P  F+ S+G + +    + +LW+I    GGK +             +MAA+ GL      
Sbjct: 441 PIKFKTSNGRVVYNISDDFLLWEIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEY 500

Query: 405 -------------------PSIDD---------------NEKPKLK-RPVQIKFQIPYFT 429
                              P ++D                +KPK     + + F+IPY T
Sbjct: 501 ERERKERETSMNPPPLRTGPKLEDIYKETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCT 560

Query: 430 TSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYT 464
            SG++V YLK++E +LQY+S+PWVRY T + D+Y 
Sbjct: 561 CSGLKVEYLKIDEDQLQYQSFPWVRYKTINDDEYA 595

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 52/85 (61%), Gaps = 5/85 (5%)

Query: 57  YLFIQHNDLYIVALTTSLS---TNASQVFTFLHKLVEVMSEYL--KDVEEESIRDNFVII 111
           +++I+ + LY VA+  +      N   + T+L +L ++  +Y+  K ++   + DN +++
Sbjct: 52  FVYIKRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLV 111

Query: 112 YELLDEMMDYGIPQITETKMLKQYI 136
            EL+DE +DYGI Q+TE  ++K YI
Sbjct: 112 MELIDETLDYGIVQLTEPSIMKDYI 136

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  121 bits (304), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 99/357 (27%), Positives = 154/357 (43%), Gaps = 77/357 (21%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E +   M  +  V+R  +I GE+  RS LSGMP LK+ IN
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQ 282
                 K L                          P   +++G   K  N E + L    
Sbjct: 310 ------KILKQDVQFLSNVKFHQCVSLDSIRARSNPPAVEEDG---KKKNEEADTLG--- 357

Query: 283 CVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK--PLIWC---DVNIHVHSKSRVEIHC 337
                   N+  I FIPPDG F L  Y L   +K  P+I     ++   +H K +++IH 
Sbjct: 358 --------NKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLH-KFKIKIHV 408

Query: 338 RAKAQIKKKSIANNVEILIPVP--------DDADTPSFRYSHGSIKWVPEKNAILWKIRS 389
             +   K  +  + + + IP+         D +  P F+   G++ +      +LW++ +
Sbjct: 409 IIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEVGT 468

Query: 390 FAGG---KEYSMAAQLGLPSIDD-----------------NEKPKLKR------------ 417
             GG      SM A+  L + ++                  E PKL+             
Sbjct: 469 MNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGDSD 528

Query: 418 ----------PVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYT 464
                      + + F++PY T SG+++ YLK+ E +LQY+S+PWVRY T S D+Y 
Sbjct: 529 EVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISDDEYA 585

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEE--ESSVVPPCLTHNGI--H 56
           M SSI   D   + ++ +  R      A+ N  +L+ K +E   S+ V P    N I   
Sbjct: 1   MSSSIFILDETLEPIICKNIR------ALPNLPSLVTKFQELYRSNGVSPLPILNDIDWQ 54

Query: 57  YLFIQHNDLYIVALTTSLS-TNASQVFTFLHKLVEVMSEYLKD--VEEESIRDNFVIIYE 113
           +L I+ + L  +++  + S  N   VFT+L +  +++ +YL    +    + DNF+++ E
Sbjct: 55  FLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIE 114

Query: 114 LLDEMMDYGIPQITETKMLKQYITQK 139
           L+DE +D+G+ Q T++ ++K Y+  K
Sbjct: 115 LIDESLDFGVVQFTDSSLIKDYVRVK 140

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  118 bits (296), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 99/367 (26%), Positives = 158/367 (43%), Gaps = 110/367 (29%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMT-QQGQVLRSEIIGEVKVRSRLSGMPDLKLGIN 222
           VSWR +GI Y KNE FLD++E +  LM    G++ ++ I GE+K +  LSGMP LK+ +N
Sbjct: 216 VSWRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN 275

Query: 223 DKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQ 282
            K I                                          K     + + KFHQ
Sbjct: 276 -KLI------------------------------------------KNDEQFISNSKFHQ 292

Query: 283 CVRLSKFE------------NEKIITFIPPDGNFELMSYRLTTPIK--PLIWCDVNIHVH 328
           CV ++  +            + K I FIPPDG F L  Y L   ++  P+I    NI + 
Sbjct: 293 CVSINSLKREINNEEEENTYHGKEIEFIPPDGEFVLCKYELKRHVRDVPVIKLS-NIEIK 351

Query: 329 ---SKSRVEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPSFRYSHGSIKWV 377
               K +++IH   +   KK++  + + I IP+         D    P F+   G + + 
Sbjct: 352 PKLKKYKIQIHVTIETHFKKQNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFN 411

Query: 378 PEKNAILWKIRSFAGGKEYS---MAAQLGLPSIDD-----------------NEKPKL-- 415
              + ++W++ S  GG   S   M A+  + + ++                  E PKL  
Sbjct: 412 ISDDFLIWEVGSMKGGNGESKNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEE 471

Query: 416 ------------------KRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYIT 457
                             ++ + +KF++PY T SG++V YLK+ E ++ Y+S+PWVRY T
Sbjct: 472 IYEQTHDNRDEHDKNGISQQLLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRYKT 531

Query: 458 QSGDDYT 464
            + D+Y 
Sbjct: 532 INDDEYA 538

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 70/144 (48%), Gaps = 10/144 (6%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60
           M S +   D   + L+S+  +    LT I  F  L  K   E+   PP  T    HY+FI
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKLNYK---ENG--PPVFTVLEWHYVFI 55

Query: 61  QHNDLYIVAL---TTSLSTNASQVFTFLHKLVEVMSEYLK--DVEEESIRDNFVIIYELL 115
           + + L+ +     T    TN   +  +L +L  ++  Y     ++   + DN ++I EL+
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELI 115

Query: 116 DEMMDYGIPQITETKMLKQYITQK 139
           DE MD+GI Q+T+  ++K YI  K
Sbjct: 116 DESMDFGIVQLTDPSIIKDYIRVK 139

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  118 bits (296), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 103/384 (26%), Positives = 161/384 (41%), Gaps = 126/384 (32%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E +  LM  +  ++R  +I GE+  RS LSGMP LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 223 DKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQ 282
              I ++                          PQ  +  +                FHQ
Sbjct: 313 --KILNR-------------------------DPQFMSNSN----------------FHQ 329

Query: 283 CVRLSKFE-------------------NEKIITFIPPDGNFELMSYRLTTPIK--PLIWC 321
           CV L                       + + I F+PPDG F L  Y L   +K  P+I  
Sbjct: 330 CVSLDSINTIEKGQEKEQNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKL 389

Query: 322 -DVNIHVH-SKSRVEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPSFRYSH 371
            D  I     KS+++I  + +   K  +  + + + IP+         D +    F+ ++
Sbjct: 390 KDFEIKPKLKKSKIQILTKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANN 449

Query: 372 GSIKWVPEKNAILWKIRSFAGGKE----------------YSMAAQLGLPSIDDNEK--- 412
           G + +    + +LW+I++  G +E                 SM A+  L + ++ ++   
Sbjct: 450 GKVVFNLSDDFLLWEIQTMKGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQE 509

Query: 413 --------------PKLK------------------RPVQIKFQIPYFTTSGIQVRYLKV 440
                         PKL+                  R V I F+IPY T SG++V YLKV
Sbjct: 510 EMKTSMNPPPLRTGPKLEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKV 569

Query: 441 NEPKLQYKSYPWVRYITQSGDDYT 464
            EP+LQY+S+PWVRY T + ++Y 
Sbjct: 570 EEPQLQYQSFPWVRYKTVNDEEYA 593

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 77/145 (53%), Gaps = 12/145 (8%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEE-ESSVVPPCLTHNGIHYLF 59
           M SS+   D   + ++S+  R      A+ N +++L   ++      PP L  N   ++ 
Sbjct: 1   MSSSLFILDEDLEPVVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILFQNDWFFIH 54

Query: 60  IQHNDLYIVAL---TTSLSTNASQVFTFLHKLVEVMSEY--LKDVEEESIRDNFVIIYEL 114
           ++ + L++V++   T   + +   +  FL +   ++ +Y  +K + ++ I DN +++ EL
Sbjct: 55  LKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVLEL 114

Query: 115 LDEMMDYGIPQITETKMLKQYITQK 139
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 MDECIDFGIVQVTDPSIIKDYIRVK 139

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  115 bits (288), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 95/365 (26%), Positives = 154/365 (42%), Gaps = 88/365 (24%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E +  LM  +  ++R  +I GE+  R  LSGMP LK+ IN
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 223 DKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQ 282
                 K L                         +    +D+ +                
Sbjct: 320 ------KILNRDAQFLSNSSFHQCVSLDSIKTIEKREEKEDDDTG--------------- 358

Query: 283 CVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK--PLIWC-DVNIHVH-SKSRVEIHCR 338
              L    + K + F+PPDG F L  Y L   +K  P+I   D  I     K +++I  +
Sbjct: 359 ---LQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETK 415

Query: 339 AKAQIKKKSIANNVEILIPVP--------DDADTPSFRYSHGSIKWVPEKNAILWKIRSF 390
            +   K  +  + + + IP+         D +    F+ + G + +    + +LW+I++ 
Sbjct: 416 IQTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAM 475

Query: 391 AGGKEY----------------SMAAQLGLPSIDDNEK-----------------PKLK- 416
            G +E+                SM A+  L + ++ ++                 P+L+ 
Sbjct: 476 KGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLEE 535

Query: 417 -----------------RPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQS 459
                            + V I F+IPY T SG+++ YLKV EP+LQY+S+PWVRY T S
Sbjct: 536 LYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTS 595

Query: 460 GDDYT 464
            D+Y 
Sbjct: 596 DDEYA 600

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 57/99 (57%), Gaps = 5/99 (5%)

Query: 46  VPPCLTHNGIHYLFIQHNDLYIVAL---TTSLSTNASQVFTFLHKLVEVMSEY--LKDVE 100
            PP L+ N   ++ ++ + L+ V++   T   + +   +  FL +   ++ EY  +K + 
Sbjct: 41  APPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLT 100

Query: 101 EESIRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
           ++ I DN +++ EL+DE +D+GI Q+T+  ++K YI  K
Sbjct: 101 KDVILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  112 bits (279), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 104/361 (28%), Positives = 153/361 (42%), Gaps = 104/361 (28%)

Query: 161 TNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKL 219
           T  VSWR +GI Y KNE FLD+VE +  L   + +V+R  +I G++  +S LSGMP LK+
Sbjct: 233 TMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKI 292

Query: 220 GINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLK 279
            +N      K L                              Q    S+    V LE L 
Sbjct: 293 ALN------KLLQ--------------------------RDAQFMSHSKFHQCVALETL- 319

Query: 280 FHQCVRLSKFENEKIITFIPPDGNFELMSYRLT-----TPIKPLIWCDVNIHVHSKSRVE 334
                      NEK + FIPPDG F L  Y L      TPI  +   ++   +  K ++ 
Sbjct: 320 -----------NEKELEFIPPDGEFILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLR 367

Query: 335 IHCRAKAQIKKKSIANNVEILIPVPD-------DADTPS-FRYSHGSIKWVPEKNAILWK 386
           I    +   K ++  + + + IP+         D   P+ F+ + G + +    + +LW+
Sbjct: 368 ILLTIETHFKTRNSTSILNVKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWE 427

Query: 387 IRSFAGGK---EYSMAAQLGL-------------------PSIDDNEKPKL--------- 415
           I    GG    ++SM A+  L                   P +   E PKL         
Sbjct: 428 IGQMRGGHGETQFSMVAEFSLFNKEEFEREQEERKHSMNPPPL--REGPKLEELYAQTHS 485

Query: 416 -KRP-----------VQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDY 463
            K P           V + F+IPY T SG++V YLK+ E +LQY+S+PWVRY T S ++Y
Sbjct: 486 QKDPEVLVKSIQSQLVGMDFEIPYTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEY 545

Query: 464 T 464
            
Sbjct: 546 A 546

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  112 bits (279), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 101/388 (26%), Positives = 158/388 (40%), Gaps = 130/388 (33%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E +  LM  +  V+R  +I GE+  R  LSGMP LK+ IN
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 223 DKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQ 282
              I ++                          PQ  +                   FHQ
Sbjct: 318 --KILNR-------------------------DPQFMSNS----------------SFHQ 334

Query: 283 CVRLSKFE--------------------NEKIITFIPPDGNFELMSYRLTTPIK--PLIW 320
           CV L                        + + I FIPPDG F L  Y L   +K  P++ 
Sbjct: 335 CVSLDSINTIEKDEEKNSDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVR 394

Query: 321 C-DVNIHVH-SKSRVEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPSFRYS 370
             D  I     K +++I  + +   K  +  + + + IP+         D +    F+ +
Sbjct: 395 LKDFEIKPKLKKFKIQIVTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKAN 454

Query: 371 HGSIKWVPEKNAILWKIRSFAGGKEYS-------------------MAAQLGLPSIDDNE 411
            G + +    + +LW+I++  G +E+S                   M A+  L + ++ +
Sbjct: 455 IGKVVFNLSDDFLLWEIQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYD 514

Query: 412 K-----------------PKLK------------------RPVQIKFQIPYFTTSGIQVR 436
           +                 P+L+                  + V I F+IPY T SG++V 
Sbjct: 515 RLQEEMKTSMNPPPLRTGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVE 574

Query: 437 YLKVNEPKLQYKSYPWVRYITQSGDDYT 464
           YLKV EP+LQY+S+PWVRY T S ++Y 
Sbjct: 575 YLKVEEPQLQYQSFPWVRYKTVSDEEYA 602

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 76/145 (52%), Gaps = 12/145 (8%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEE-ESSVVPPCLTHNGIHYLF 59
           M SS+   D   + L+S+  R      A+ N +++L   ++      PP L+ N   ++ 
Sbjct: 1   MSSSLFILDENLEPLVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILSQNDWFFIH 54

Query: 60  IQHNDLYIVAL---TTSLSTNASQVFTFLHKLVEVMSEY--LKDVEEESIRDNFVIIYEL 114
           ++ + L+ V++   T   + +   +  FL +   ++ +Y  ++ + +  I DN +++ EL
Sbjct: 55  LKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLEL 114

Query: 115 LDEMMDYGIPQITETKMLKQYITQK 139
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 IDECIDFGIVQVTDPSIIKDYIRVK 139

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  110 bits (275), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 111/497 (22%), Positives = 219/497 (44%), Gaps = 99/497 (19%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLT--HNGIHYL 58
           M+S+I     +G+ ++S+ YR++I  +  + F    +++    +V  P LT      H++
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFR---IQVINNFNVRSPILTLGSTTFHHI 57

Query: 59  FIQHND-----LYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYE 113
               ND     L++V +  + + N++ ++ FL KL  ++ +Y     E  ++D F+ ++E
Sbjct: 58  RSTANDPTDDELWLVCVNRN-NANSAAIWEFLQKLNLILQQY-GITSESKLKDEFMTVHE 115

Query: 114 LLDEMM-DYGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPQALTNSVSWRPEGI- 171
           +LD M+   GI Q T+   LK  + + S K +                 N++   P    
Sbjct: 116 ILDNMLLGTGIIQNTD---LKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANF 172

Query: 172 ---------KYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGIN 222
                     +KKNE F  + ES+N+L+++ G +L++ + G+++++S L+G P  +  + 
Sbjct: 173 SLIPTNRHDAHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFELV 232

Query: 223 DKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQ 282
           D                                                  ++ D KF Q
Sbjct: 233 D-----------------------------------------------DQTKITDFKFDQ 245

Query: 283 CVRLSKFENEKIITFIPPDGNFELMSY-----RLTTPIK--PLIWCDVNIHVHSKSRVEI 335
           C+   +    + +     DG  E+++Y     ++  P K  P++          K  V+ 
Sbjct: 246 CIEKVQ---SRTVRVAATDGELEIVNYHVRDDKINIPFKITPIVST-------VKDTVDY 295

Query: 336 HCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKE 395
               K+   K   A +V + IPVP +        S+G  K+  E+NA++W    F G  E
Sbjct: 296 RISLKSLFPKNLSATDVVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTE 355

Query: 396 YSMAAQLGLPSIDDNEKPKLK---RP-VQIKFQIPYFTTSGIQVRYLKV-NEPKLQYKSY 450
            +++A   +   D  +   L+   RP +Q+ F+I  ++ SG+ +R L + ++ K +YK+ 
Sbjct: 356 NTLSA---ITIADGRQIMNLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKAS 412

Query: 451 PWVRYITQSGDDYTIRL 467
            W++YI+++G  Y +R 
Sbjct: 413 RWIKYISRAG-SYEMRF 428

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  111 bits (278), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 101/386 (26%), Positives = 154/386 (39%), Gaps = 129/386 (33%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E +  LM  +  ++R  +I GE+  R  LSGMP LK+ IN
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 223 DKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQ 282
                                            PQ                 + + KFHQ
Sbjct: 312 ---------------------------KLLNRDPQ----------------FMSNSKFHQ 328

Query: 283 CVRLSKFE------------------NEKIITFIPPDGNFELMSYRLTTPIK--PLIWCD 322
           CV L                      + K I FIPPDG F L  Y L   +K  P+I   
Sbjct: 329 CVSLDSINIIEEEGRDTDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQ 388

Query: 323 VNIHVH---SKSRVEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPSFRYSH 371
               +     K +++I  + +   K  +  + + + IP+         D +    F+ + 
Sbjct: 389 -GFEIKPKLKKFKIQIITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANL 447

Query: 372 GSIKWVPEKNAILWKIRSFAGGKE---------------YSMAAQLGLPSIDDNEK---- 412
           G + +    + +LW+I +  G +E                SM A+  L + ++ ++    
Sbjct: 448 GKVVFNLSDDFLLWEIGTMKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEE 507

Query: 413 -------------PKLK---------------------RPVQIKFQIPYFTTSGIQVRYL 438
                        PKL+                     + V + F+IPY T SG++V YL
Sbjct: 508 LKTSMNPPPLRTGPKLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYL 567

Query: 439 KVNEPKLQYKSYPWVRYITQSGDDYT 464
           KV EP+LQY+S+PWVRY T S D+Y 
Sbjct: 568 KVEEPQLQYQSFPWVRYKTISDDEYA 593

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 76/145 (52%), Gaps = 12/145 (8%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEE-ESSVVPPCLTHNGIHYLF 59
           M SS+   D   + L+S+  R      AI N +++L   ++      PP L+ NG  ++ 
Sbjct: 1   MSSSLFILDEDLEPLVSKNIR------AIPNLSSILSSFKQCYHRDSPPILSQNGWFFIH 54

Query: 60  IQHNDLYIVAL---TTSLSTNASQVFTFLHKLVEVMSEY--LKDVEEESIRDNFVIIYEL 114
           ++ + L+ +++   T   + +   +  FL +   ++ +Y  +  + +  I DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 115 LDEMMDYGIPQITETKMLKQYITQK 139
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYIRVK 139

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  111 bits (278), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 94/373 (25%), Positives = 153/373 (41%), Gaps = 119/373 (31%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FL+++E +   M     V++  +I GE++ +  LSGMP+LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 DKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVE---LEDLK 279
                                                         K  N +   L + K
Sbjct: 313 ----------------------------------------------KIVNEDKQFLANCK 326

Query: 280 FHQCVRLSKFE--NEKIITFIPPDGNFELMSYRLTTPIK--PLIWCDVNIHVHSKSRVEI 335
           FHQCV L+  E  + K + F+PPDG F L  Y L   ++  P++   VN  V  K +   
Sbjct: 327 FHQCVSLASLESSDHKDVEFVPPDGEFTLCRYELKRHVRDEPMVKL-VNFEVKPKLKKFK 385

Query: 336 HCRA---KAQIKKKSIANNVEILIPVP--------DDADTPSFRYSHGSIKWVPEKNAIL 384
                  +   K  +  + + + +P+         D +     +   G+I +    + +L
Sbjct: 386 LKLLLTIETHFKTTNATSKLALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLL 445

Query: 385 WKIRSFAGGK---EYSMAAQLGLPSIDD-----------------NEKPKLKR------- 417
           W++ S +GG    + SM  +  L + ++                  E PKL+        
Sbjct: 446 WEVGSMSGGHGETQLSMGVEFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHE 505

Query: 418 ----------PVQ----------------IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYP 451
                     PV                 + F++PY T+SG++V YLK+ EP+L+Y+S+P
Sbjct: 506 DDDDDDGNTEPVAEHRLQPRTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFP 565

Query: 452 WVRYITQSGDDYT 464
           WVRY T S  +Y 
Sbjct: 566 WVRYTTLSDAEYA 578

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 54/100 (54%), Gaps = 3/100 (3%)

Query: 43  SSVVPPCLT-HNGIHYLFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYL--KDV 99
            S  PP +  H+   + +IQ + L  V++   + T   +   +L    EV+  YL  K +
Sbjct: 38  GSNAPPVIDYHDLFTFTYIQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVL 97

Query: 100 EEESIRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
           ++  + DN V+I EL++E +D+G  Q+T++ +L  YI  K
Sbjct: 98  DKNIVTDNSVLISELIEETIDFGAIQVTDSGLLADYIKMK 137

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 109/251 (43%), Gaps = 59/251 (23%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E    +M  +  ++R  +I G++  R  LSGMP LK+ +N
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 223 DKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQ 282
                 K L                                           L  L+FHQ
Sbjct: 347 ------KLLQKDQQF-------------------------------------LSQLRFHQ 363

Query: 283 CVRLSKFENEKIITFIPPDGNFELMSYRLTTPIK-----PLIWCDVNIHVHSKSRVEIHC 337
           CV L   +N++I  FIPPDG F L  Y L   +K      LI  ++   +  K +++I+ 
Sbjct: 364 CVSLETIQNKEI-EFIPPDGEFILCEYELKRHVKDPPNIKLISFEIKPKL-KKFKIQINL 421

Query: 338 RAKAQIKKKSIANNVEILIPVP--------DDADTPSFRYSHGSIKWVPEKNAILWKIRS 389
                 K ++  + + + IP+         D   +P F+ + G +K+    + +LW+I S
Sbjct: 422 SITTFFKVQNSTSILNLKIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGS 481

Query: 390 FAGGKEYSMAA 400
             GG   ++ A
Sbjct: 482 MKGGHGENIKA 492

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 33/45 (73%)

Query: 419 VQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDY 463
           + + F+IPY+  SG++V YLK+ E +L Y+S+PWVRY T +  DY
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRYKTTNDKDY 653

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 70/146 (47%), Gaps = 13/146 (8%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFAT---LLMKLEEESSVVPPCLTHNGIHY 57
           M+S I   D   + L+S+  R      AI NF +   L  K    ++   P ++ N  ++
Sbjct: 1   MLSCIFILDENLEPLISKNIR------AIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 58  LFIQHNDLYIVALTT--SLSTNASQVFTFLHKLVEVMSEYLKD--VEEESIRDNFVIIYE 113
           + I+ + L  +         ++   +  +L K   ++  +LK   +    I DN ++I E
Sbjct: 55  IQIKRDSLIFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIME 114

Query: 114 LLDEMMDYGIPQITETKMLKQYITQK 139
           L+DE +D+GI Q+T+  ++K Y+  K
Sbjct: 115 LIDESIDFGIIQMTDPNIIKDYVRVK 140

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 79.0 bits (193), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 106/258 (41%), Gaps = 36/258 (13%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEII-GEVKVRSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E +   M  +  ++R  +I GE+  +  LSGMP LK+ IN
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DKGIFSKYLXXXXX-XXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFH 281
                 K L                          +   G D  +  +  N +  D K  
Sbjct: 355 ------KILQNDSQFLSNAHFHQCVSLDSLHLQSAEDDDGDDNANVNENENHDERDRK-- 406

Query: 282 QCVRLSKFENEKIITFIPPDGNFELMSYRLTT-----PIKPLIWCDVNIHVHSKSRVEIH 336
                      K I FIPPDG+F L  Y L       P+  L   D+   + SK +++IH
Sbjct: 407 -----------KEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL-SKYKLKIH 454

Query: 337 CRAKAQIKKKSIANNVEILIPVP--------DDADTPSFRYSHGSIKWVPEKNAILWKIR 388
              +   K  +  + + + IP+         D +    F+   G + +    N ++W+I 
Sbjct: 455 VIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWEIG 514

Query: 389 SFAGGK-EYSMAAQLGLP 405
           S  GG  E +M+     P
Sbjct: 515 SMKGGHGEVTMSMMAEFP 532

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 38/46 (82%)

Query: 419 VQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYT 464
           ++I F+IPY+T SG+++ YLK+ EP+LQY+S+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 80/169 (47%), Gaps = 36/169 (21%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEE------------ESSVVPP 48
           M S I   D   + +L++  R      +I N   LL+K +E            + S V P
Sbjct: 1   MSSCIFILDENLEPILNKNIR------SIGNNFELLLKFQEIYRKQQNEIHNNDDSKVLP 54

Query: 49  CLTHN---------------GIHYLFIQHNDLYIVALTTSLSTNASQV-FTFLHKLVEVM 92
            L  N               G  +L I+ + L  V++  + S N+  + F++L +  +++
Sbjct: 55  ILNTNDYGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLL 114

Query: 93  SEYLK--DVEEESIRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
             YL    +++  + DNF+++ ELLDE +D+GI Q T++ ++K YI  K
Sbjct: 115 KSYLNVTKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYIRVK 163

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 110/291 (37%), Gaps = 84/291 (28%)

Query: 53  NGIHYLFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYL-KDVEEES-IRDNFVI 110
           +G+ Y  +Q  ++         + N  + F FL  +  ++++Y  KDV + S I  N+  
Sbjct: 72  DGLRYWCLQRTEI-----GEGSTPNPVEPFVFLQTVDTILNQYFGKDVLKASKITKNYDR 126

Query: 111 IYELLDEMMDYGIPQITETKMLKQYITQKS-FKLVXXXXXXXXXXXPPQALTN------- 162
           +  L + M+D G P IT+   LK+ +  K+ F  V              A  N       
Sbjct: 127 VTLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGNQMFSKHS 186

Query: 163 ----------------SVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQV-----LRSEI 201
                           +V WR  G+KY  NE ++D+ E++N+++ +         +   I
Sbjct: 187 SNSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSI 246

Query: 202 IGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTG 261
            GEV  +  LS  P ++L +N                                    + G
Sbjct: 247 DGEVGFKCYLSENPLVELDLN------------------------------------TNG 270

Query: 262 QDEGSSRKTSNVELEDLKFHQCVRLSKFE-NEKIITFIPPDGNFELMSYRL 311
            D G              FH+CVR    + +   + FIPPDG+F LM Y +
Sbjct: 271 HDLGIP-----------AFHRCVRTEGSDFHPGTLRFIPPDGDFCLMEYNI 310

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/251 (21%), Positives = 94/251 (37%), Gaps = 72/251 (28%)

Query: 84  FLHKLVEVMSEYLKDVEEESIR---DNFVIIYELLDEMMDYGIPQITETKMLKQYI---- 136
           FL +  +V+ EY  D E  +++   +N   +  LL  M+D G   +T++  L+Q +    
Sbjct: 41  FLAQYHQVLIEYF-DKEALTVKKLVNNADRLALLLHAMLDAGEVAVTDSNRLRQLVPLRN 99

Query: 137 --------TQKSFKLVXXXXXXXXXXXPPQA-----LTNSVSWRPEGIKYKKNEAFLDIV 183
                     K+                P A        +V WR    +Y  NE ++D+V
Sbjct: 100 DLSTILNSATKTLANTVKYADSKQLFGAPVATGKVEAGQTVPWRTADCRYVNNEIYVDLV 159

Query: 184 ESINMLMTQQGQ---VLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXX 240
           E++N  + Q+G    ++   + G++ V+  LSG P ++L +                   
Sbjct: 160 ETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKL------------------- 200

Query: 241 XXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300
                                       +TS   L++   H+CV L +      + F+PP
Sbjct: 201 ----------------------------RTSGHPLDNSALHRCVELGE-AGVATMNFVPP 231

Query: 301 DGNFELMSYRL 311
           DG F L  Y +
Sbjct: 232 DGRFTLAEYAI 242

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 70/170 (41%), Gaps = 53/170 (31%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQG------------------QVLRSEIIGEV 205
           V WR   +KY  NE ++D++E I+++  ++                   +++R++IIGE+
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 206 KVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEG 265
            VRS LS  P +++ + D+                                   TG  E 
Sbjct: 316 NVRSYLSDNPMVEVTLVDRN-----------------------------YSDQKTGWSEN 346

Query: 266 SSRKTSNVELEDLKFHQCVRLS--KFENEKI--ITFIPPDGNFELMSYRL 311
              K  N+ L    FH CV +   K  N+    I FIPPDG F LM Y +
Sbjct: 347 DLFKQLNLGLP--MFHDCVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 69/166 (41%), Gaps = 63/166 (37%)

Query: 163 SVSWRPEGIKYKKNEAFLDIVESINMLMTQQG----------QVLRSEIIGEVKVRSRLS 212
           +V WR   + +  NE +LD+VESI++++  +           +++   IIG+  V+S L+
Sbjct: 201 AVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLN 260

Query: 213 GMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSN 272
           G P +++ I+  G                                               
Sbjct: 261 GNPIVEMKIDMAG----------------------------------------------- 273

Query: 273 VELEDLKFHQCVRL------SKFENEKIITFIPPDGNFELMSYRLT 312
            +LE +  H+CV+        +FEN K+I F+PPDG+F+L  Y + 
Sbjct: 274 NDLESIFLHECVKSKDVDKDQEFENTKLIKFLPPDGSFKLFDYNIN 319

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 108/511 (21%), Positives = 193/511 (37%), Gaps = 102/511 (19%)

Query: 1   MVSSISFCDSKGKQLLSRKYRDDIP------LTAIDNFATLLMKLEEESSVVPPCLTHNG 54
           M  +   CD+K  QL+ +   D I       LT I +    ++ +E   +V         
Sbjct: 1   MYIAFYICDTK-NQLVFQYLCDSIAPHFSKLLTRIHSLCPEVLDVETRGNVSKDL----K 55

Query: 55  IHYLFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLK--DVEEESIRDNFVIIY 112
           I+  F   N+L   ALT     +  +    L  +  ++ EY    ++    I +N+  + 
Sbjct: 56  IYRYFSATNNLNYYALTIVSRHHDLEPHHVLESIDTLLVEYFNKTNLTTTKIMNNYDRMT 115

Query: 113 ELLDEMMDYGI---PQITETKMLKQYITQKSFK--LVXXXXXXXXXXXPPQALTNSV-SW 166
            L D ++D GI         K+  Q   +  F   +            P + + N V  W
Sbjct: 116 ILFDLLIDGGIIDGNNFYMNKLRNQIPLKNDFSNFINDAAKSLQKGQAPSKTVDNEVVPW 175

Query: 167 RPEGIKYKKNEAFLDIVESINMLMTQQGQ------VLRSEIIGEVKVRSRLSGMPDLKLG 220
           R + IK  +NE ++D+ E++ + + +  +      +L   I G V V S + G+P L++ 
Sbjct: 176 RSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPMLEVS 235

Query: 221 INDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDL-- 278
                                                                + +D+  
Sbjct: 236 F-------------------------------------------------GGCDFKDIIP 246

Query: 279 KFHQCVRLSKF--ENEKIITFIPPDGNFELMSYR--LTTPIKPLIWCD-VNIHVHSKSRV 333
           KFH CV +++F   +  II FIPPDG F+LM Y   L++    LI C+  N   +S    
Sbjct: 247 KFHDCVEVNEFLTNDGNIIKFIPPDGKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDEF 306

Query: 334 EIHCRAKAQIKKKSIANNVEILIPVPDDADTPSF--------RYSHGSIKWVPEKNAILW 385
           EI        K   I NN+++ +   +               R+ +G   W+ +   +  
Sbjct: 307 EITLNINKSNKVPKI-NNLQVCLNFENREGQSKVKILRNTHGRFEYGKNTWIFDSELLTG 365

Query: 386 KIRSFAGG--KEYSMAAQLGLPS----IDDNEKPKLKRPV---QIKFQIPYFT-TSGIQV 435
            +    G   +E       G+      I    +P+L+  +   Q + Q+P  T  S I +
Sbjct: 366 TLPVLRGCVEEETKNEEDGGIDGEGRRILSKLRPELRSVIMSFQYEGQLPSGTRVSSINI 425

Query: 436 RYLKVNEPKLQYKSYPWVRYITQSGDDYTIR 466
           R    + P+ Q + +  V+Y+T++  +Y IR
Sbjct: 426 RNDSTSNPQRQ-QLFKGVKYVTKTS-NYEIR 454

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 82/341 (24%), Positives = 133/341 (39%), Gaps = 103/341 (30%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLR----------SEIIGEVKVRSRLSG 213
           V WR  G+KY  NE ++D+ ESI+++  + G+  R            I G+  V+  LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 214 MP--DLKLGI--NDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRK 269
            P  DL+L +  ND G+                               P+          
Sbjct: 271 NPTVDLQLDLAGNDLGV-------------------------------PA---------- 289

Query: 270 TSNVELEDLKFHQCVRLSKFENEK--IITFIPPDGNFELMSYR--LTTP----------I 315
                     FH+CV L   +N     + FIPPDG F LM Y   L TP           
Sbjct: 290 ----------FHECVELDNHQNPSNCDLRFIPPDGRFNLMQYSIDLDTPRIQQTRRFNHT 339

Query: 316 KPLIWCDVNIHVHSKS-RVEI-----HCRAKAQIKKKSIANNVEILIPVPDDADT----P 365
             L+  D    + +K+   EI     + R  A I+   I  +V++     +D++T     
Sbjct: 340 VGLVTIDFADQLGNKTDEFEITVNISNSREVANIEDLRI--DVQLQSNTDEDSETDFKIK 397

Query: 366 SFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKR--PVQIKF 423
             R +HG        N+++    S+   K+        L    ++ +P+L R   V   +
Sbjct: 398 VLRNTHGRF-----DNSVVPGQGSWIFDKDTPTGTLPVLRGCVESTEPRLLRVQRVTASY 452

Query: 424 QIPYFTTSGIQVRYLKVNEPKLQYKS---YPWVRYITQSGD 461
            +     SGI+V+ + + +  L  KS   +  V+Y T++GD
Sbjct: 453 SLSGQLASGIRVKAINIGQ--LTTKSNRPFKGVKYATKTGD 491

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 72/331 (21%), Positives = 120/331 (36%), Gaps = 83/331 (25%)

Query: 157 PQALTNSVSWRPEGIKYKKNEAFLDIVESINMLM-----TQQGQVLRSEIIGEVKVRSRL 211
           P A    V WR  G+KY  NE ++D+VE++++++     T +   +R  + G V  RS L
Sbjct: 179 PAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSHL 238

Query: 212 SGMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTS 271
           SG P + L +  +                                    G D G      
Sbjct: 239 SGNPVIALNLRLR------------------------------------GHDLGMP---- 258

Query: 272 NVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRL---TTPIKPLIWCDVNIHVH 328
                    HQC   S       + F+PPDG F+LM Y +   +   K  ++ ++ + V 
Sbjct: 259 -------ALHQCCLDSYQGRPDQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNIGL-VS 310

Query: 329 SKSRVEI-----HCRAKAQIKKKSIANNVEILI------PVPDDADTPSFRYSHGSIKWV 377
              R E+            I     A  V+ L+      P+P +      R +HG  +  
Sbjct: 311 PDYRTELGDLGDEFEVNLNIAGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENC 370

Query: 378 PEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQI------KFQIPYFTTS 431
              N   W        KE        L    +N   +  R +Q+      + ++P    S
Sbjct: 371 ASNNIGKWVF-----DKETPTGTLPVLRGCLENATREQVRALQLSVSYTNRGELP----S 421

Query: 432 GIQVRYLKV-NEPKLQYKSYPWVRYITQSGD 461
           GI+V  + + +      K +  V+YI ++GD
Sbjct: 422 GIKVDSVDILSGLSKNIKPFKGVKYIAKTGD 452

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 70/143 (48%), Gaps = 8/143 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V ++S    KGK LLSR++RD   D  +  + NF TL+    ++ + V        + Y
Sbjct: 2   VVLAVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSSKQHTFVE----DEHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   +D YI+ L T+L +N  Q    L+  V+ +   LK + EE + D+   I    DE
Sbjct: 58  VYKPFDDYYII-LITNLHSNIIQDMDTLNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +K ++  +S
Sbjct: 117 IITMGYKENLSLTQIKTFLAMES 139

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 60/153 (39%), Gaps = 52/153 (33%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLM---TQQGQV--LRSEIIGEVKVRSRLSGMPDLK 218
           V WR  G+KY  NE ++D+VE+I++++    + GQ+  +R  I G V  RS L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDL 278
           L +N                                      G D G             
Sbjct: 246 LKLNLH------------------------------------GHDLGVP----------- 258

Query: 279 KFHQCVRLSKFENEKIITFIPPDGNFELMSYRL 311
             H C +     + + + F+PPDG F LM Y +
Sbjct: 259 ALHPCCQAQYTGSPENLQFVPPDGKFRLMQYTI 291

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 72/176 (40%), Gaps = 63/176 (35%)

Query: 162 NSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMP--DLKL 219
           + V WR  GI Y  NE F+D+ E IN ++ ++G++L   I G + + + LSG P  ++KL
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 220 GINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLK 279
           G+ D                                             K S++   +  
Sbjct: 267 GLLD--------------------------------------------HKLSHL---NTT 279

Query: 280 FHQCVRLSKFE--NEKI------ITFIPPDGNFELMSYRLTTPIKPLIWCDVNIHV 327
           FH+C+   K    N+ I      +TF+PPDG   L  Y L     PL+  D N+ +
Sbjct: 280 FHRCILEDKANSINDLIAGKFTKLTFVPPDGRTRLCQYTL-----PLVKRDSNLGI 330

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 69/143 (48%), Gaps = 8/143 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V + S     GK LLSR++R+   D  L  + NF +L+  L  E + V      N + Y
Sbjct: 2   VVLAASITTRSGKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFVE----GNHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   +D YI+ L T+  +N  +  + L+ L + ++  L   +E  I D+   I    DE
Sbjct: 58  VYRPFDDYYII-LITNRQSNIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +   +  +  Y+T +S
Sbjct: 117 VVIMGYKENLSSTQVTTYLTMES 139

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 64/161 (39%), Gaps = 53/161 (32%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQG-----QVLRSEIIGEVKVRSRLSGMPDLK 218
           V WR   +KY  +E ++DI+E+++++          Q++   I G+V V+S LSG P ++
Sbjct: 192 VPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE 251

Query: 219 LGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDL 278
           + ++  G                                                E+   
Sbjct: 252 MDMDLAG-----------------------------------------------NEMYAP 264

Query: 279 KFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIKPLI 319
             HQCV + +  +   + FIPPDGN  L++Y +   + P +
Sbjct: 265 SMHQCVEMPQ-GSPSSLCFIPPDGNCNLLNYTIDLDMNPKV 304

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 65/143 (45%), Gaps = 8/143 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V ++S    +GK LLSR++RD   D     + NF  L+ K   + + V        + Y
Sbjct: 98  VVIAVSIVTRQGKPLLSRQFRDISKDRVTELLSNFQGLVAKSSSQHTFVED----EHVRY 153

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   +D YI+ L T+  +N  Q    L    + M+ YL   +E  I +N   I    DE
Sbjct: 154 VYKPFDDYYII-LITNRQSNIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDE 212

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +  Y++ +S
Sbjct: 213 VITMGYKENLSISQINTYLSMES 235

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 66/143 (46%), Gaps = 8/143 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V ++S     GK LLSR++RD   D  +  + NF  L+     E + V        + Y
Sbjct: 2   VVLAVSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHTFV----EEEHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++I  +D YI+ L T+  +N  Q    L+   + ++  LK   EE + ++   I    DE
Sbjct: 58  IYIPFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +  +++ +S
Sbjct: 117 IISLGYKESLSLSQINTFLSMES 139

>Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]
           {ON} YFR051C (RET2) - vesicle coat component [contig
           344] FULL
          Length = 538

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 65/143 (45%), Gaps = 8/143 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V ++S    +GK LLSR++R+   D     + NF  L+ K   + + V        + Y
Sbjct: 2   VVIAVSIVTRQGKPLLSRQFREISKDRVTELLSNFQGLVAKSSSQHTFVE----DEHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   +D YI+ L T+  +N  Q    L    + M+ YL   +E  I +N   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDLDTLKIFSQTMNTYLSSFDEHEIFENAFEILSSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +  Y++ +S
Sbjct: 117 VITMGYKENLSMTQINTYLSMES 139

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 68/171 (39%), Gaps = 75/171 (43%)

Query: 166 WRPEGIKYKKNEAFLDIVESINML----------MTQQGQVLRSEIIGEVK----VRSRL 211
           WR + +K+  NE ++D+VES++++          +T+  Q ++  + G +K    V+S L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 212 SGMP----DLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSS 267
           +G P     L+L  ND G                                PS        
Sbjct: 263 NGNPLVELQLELSGNDIG-------------------------------HPS-------- 283

Query: 268 RKTSNVELEDLKFHQCVRLSKF----ENEKI--ITFIPPDGNFELMSYRLT 312
                       FH+CV + ++    +N  I  + FIPPDG F LM Y +T
Sbjct: 284 ------------FHECVDIDEYLKNIDNSSISSLKFIPPDGKFTLMDYTIT 322

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 64/143 (44%), Gaps = 8/143 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V + S     GK LLSR++ D   D  +  + NF  L+ K   E + V        + Y
Sbjct: 2   VVLAASITTRNGKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVED----EHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           L+   +D Y++ +T   S N  Q  + L    + M+ YL   +E  I +N   I    DE
Sbjct: 58  LYKPFDDYYLIIITNRQS-NIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      ++ Y+T +S
Sbjct: 117 IIVMGYKENLTMAQVETYLTMES 139

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 66/143 (46%), Gaps = 8/143 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V + S     GK LLSR++R+   D  +  + NF  L+  +  + + V        + Y
Sbjct: 2   VVLAASITTRNGKPLLSRQFRELTKDRVMELLSNFQGLVSSISSDHTFVE----DEHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   +D YI+ L T+  +N  Q  + L+   + ++ YL   +E  + DN   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDLSTLNLFSQTVNSYLSSYDETELYDNAFEILSSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +  Y++ +S
Sbjct: 117 IVVMGYKENLTAAQVSTYLSMES 139

>NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa]
           {ON} Anc_3.575 YFR051C
          Length = 540

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V + S     GK LLSR++RD   D  +  + NF  L+  +  + + V        + Y
Sbjct: 2   VVLAASITTRHGKPLLSRQFRDLTKDRVMELLSNFQGLVANISSDHTFVE----DEHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   +D YI+ L T+  +N  Q  + L+   + ++  L + +E  I DN   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIVQDLSTLNLFSQTVNSSLSNFDENEIYDNAFEILSSFDE 116

Query: 118 MMDYG 122
           ++  G
Sbjct: 117 IVVMG 121

>AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR051C
           (RET2)
          Length = 532

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 66/143 (46%), Gaps = 8/143 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V ++S     GK L+SR+++D   D  +  + NF  L+     + + V        + Y
Sbjct: 2   VVLAVSITTRSGKPLVSRQFKDISRDRIMELLSNFQGLVANSSRQHTFVE----EEHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   +D YI+ L T+  +N  Q    L+   + ++ +LK   E+ I DN   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSHLKGFSEDEILDNAFDILGSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +  +++ +S
Sbjct: 117 IISLGCKENLSLSQINTFLSMES 139

>KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170C APS1 Small subunit of the clathrin- associated
           adaptor complex AP-1 which is involved in protein
           sorting at the trans-Golgi network homolog of the sigma
           subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 62/136 (45%), Gaps = 17/136 (12%)

Query: 9   DSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFIQHNDLYIV 68
           DSKGK  +SR+             AT+++  + +   +     H  +   + ++  LY +
Sbjct: 26  DSKGKSKISRE------------LATMVLARKAKMCNILEYQDHKVV---YKRYASLYFI 70

Query: 69  ALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM--DYGIPQI 126
              +S S N       +H+ VE M  Y  +V E  I  NF   YE+L+E++  D  + + 
Sbjct: 71  CGISSDSDNELLTLEVIHRYVEAMDSYFNNVCELDIIFNFTKAYEILNEVLVCDGSMTET 130

Query: 127 TETKMLKQYITQKSFK 142
           ++  +L+  +T  S +
Sbjct: 131 SKQAILRSVMTMDSLE 146

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 66/143 (46%), Gaps = 8/143 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V + S     GK LLSR++R+   D  L  + NF +L+  +  + + V        + Y
Sbjct: 2   VVLAASITTRTGKPLLSRQFREITKDRVLELLSNFQSLVTNISSDHTFVE----DEHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   +D YI+ L T+  +N     + L+   + ++ YL   +E  I +N   I    DE
Sbjct: 58  VYRPFDDYYII-LITNRQSNIIMDLSTLNLFSQTVNSYLSSYDEAEIFENAFEILSSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +  Y++ +S
Sbjct: 117 IVVMGYKENLSITQVNTYLSLES 139

>NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1.388
          Length = 156

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM- 119
           ++  LY +   T    N       +HK VE M +Y  +V E  I  NF   Y++L+EM+ 
Sbjct: 63  RYASLYFICGITPDVDNELLTLEIIHKYVETMDQYFGNVCELDIIYNFTKAYDILNEMIM 122

Query: 120 -DYGIPQITETKMLKQYITQKSF 141
            D  + + ++T +LK   T  S 
Sbjct: 123 CDGSLAETSKTVVLKDVRTMDSM 145

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 545

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 64/143 (44%), Gaps = 8/143 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V ++S     GK LLSR++RD   D     + NF  L+      SS     +    + Y
Sbjct: 2   VVLAVSITTRSGKPLLSRQFRDISKDRVTELLSNFQGLVAN----SSSQHTFVEDEHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   +D YI+ L T+  +N  Q    L+   + ++  L+  +E  I +N   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDLDTLNLFSQTVNSSLRSFDENEIFENAFEILGSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      +  +++ +S
Sbjct: 117 IIAMGYKENLSLTQINNFLSMES 139

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 8/125 (6%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V + S    +GK LLSR+++D   D  L  + NF  L+ ++  + + V        + Y
Sbjct: 55  VVLAASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVTEISSDHTFV----EDKHVRY 110

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   ++ YI+ L T+  +N  +  + L+   + ++ YL   +++ I  N   I    DE
Sbjct: 111 VYRPFDNYYII-LITNRQSNIIKDLSTLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDE 169

Query: 118 MMDYG 122
           ++  G
Sbjct: 170 IVSMG 174

>CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051c RET2
          Length = 536

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 8/143 (5%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V + S     GK LLSR++R+   +  +  + NF  L+  +  + +     L    + Y
Sbjct: 2   VVLAASITTRNGKPLLSRQFRELTKERTMELLSNFQGLVSNISSDHTF----LEDEHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   ++ YI+ L T+  +N  Q  + L+     ++ YL   +E  I DN   I    DE
Sbjct: 58  VYRPFDNYYII-LITNRQSNIIQDLSTLNLFSSTVNSYLASYDELEIFDNSFEILSSFDE 116

Query: 118 MMDYGIPQITETKMLKQYITQKS 140
           ++  G  +      ++ Y+  +S
Sbjct: 117 IVTMGYKENLSISQVETYLAMES 139

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 3/36 (8%)

Query: 280 FHQCV-RLSKFENEKI--ITFIPPDGNFELMSYRLT 312
           FH CV + S  + EKI  ++FIPPDG F LM Y + 
Sbjct: 314 FHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQYNIN 349

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 61/155 (39%), Gaps = 55/155 (35%)

Query: 164 VSWR-PEGIKYKKNEAFLDIVESINMLMTQQGQVLR---SEIIGEVKVRSRLSGMPDLKL 219
           V WR  +  K++ NE ++D++E+ +++   +   LR     I G V VRS L+  P + +
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 220 GINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLK 279
            +N                                    + G D G              
Sbjct: 259 KLN------------------------------------TMGNDIGVP-----------T 271

Query: 280 FHQCVRLSKFENEKI---ITFIPPDGNFELMSYRL 311
            H+CV + K + E +   ITFIPPDG F L+ Y +
Sbjct: 272 LHECVEI-KDDGEFLPSNITFIPPDGKFRLLEYSV 305

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 37.4 bits (85), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 60/125 (48%), Gaps = 8/125 (6%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V + S    +GK LLSR+++D   D  L  + NF  L+ ++  + + V        + Y
Sbjct: 2   VVLAASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFV----EDKHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   ++ YI+ L T+  +N  +    L+   + ++ YL   +++ I  N   I    DE
Sbjct: 58  VYRPFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDE 116

Query: 118 MMDYG 122
           ++  G
Sbjct: 117 IVSMG 121

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 37.0 bits (84), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 61/155 (39%), Gaps = 55/155 (35%)

Query: 164 VSWRPEGI-KYKKNEAFLDIVESINMLMTQQGQVLR---SEIIGEVKVRSRLSGMPDLKL 219
           V WR     K++ NE ++D++E+ ++++ ++   LR    +I G V VRS L+  P + +
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSV 258

Query: 220 GINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLK 279
            +N  G                                                E+    
Sbjct: 259 KLNTMG-----------------------------------------------NEIGIPS 271

Query: 280 FHQCVRLS---KFENEKIITFIPPDGNFELMSYRL 311
            H+CV ++   +F    I TFIPPDG F L+ Y +
Sbjct: 272 LHECVEINDDGEFTPSNI-TFIPPDGKFRLLEYSI 305

>TPHA0B03570 Chr2 complement(834660..835130) [471 bp, 156 aa] {ON}
           Anc_1.388 YLR170C
          Length = 156

 Score = 35.4 bits (80), Expect = 0.12,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 2/82 (2%)

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++ ++  LY +   +  S N       +H+ VE M  Y  +V E  I  NF   Y +LDE
Sbjct: 60  VYRRYASLYFICGISQNSDNELLTLEIVHRYVETMDTYFGNVCELDIIFNFEKAYNILDE 119

Query: 118 MM--DYGIPQITETKMLKQYIT 137
           M+  D  I + +++ +L    T
Sbjct: 120 MIMCDGSITETSKSNVLNNIKT 141

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 65/142 (45%), Gaps = 8/142 (5%)

Query: 2   VSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYL 58
           V + S     GK LLSR++ +   D  +  + NF  L+  +  + + V        + Y+
Sbjct: 3   VLAASITTRNGKPLLSRQFVEMSKDRVMELLSNFQGLVANISSDHTYVED----EHVRYV 58

Query: 59  FIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEM 118
           +   +D Y++ L T+  +N  Q  + L+   + ++ YL   +E  I +N   I    DE+
Sbjct: 59  YKPFDDYYLI-LMTNRQSNIIQDLSTLNLFSQTVNYYLNSFDENEIFENAFEILSSFDEI 117

Query: 119 MDYGIPQITETKMLKQYITQKS 140
           +  G  +    + +  YI+ +S
Sbjct: 118 IVMGHKENLTIQQVNNYISMES 139

>TBLA0A01260 Chr1 (299419..299889) [471 bp, 156 aa] {ON} Anc_1.388
           YLR170C
          Length = 156

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%)

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119
           ++  LY +   T+   N   +   +H+ VE M  Y  +V E  I  NF   Y++LDEM+
Sbjct: 63  RYASLYFICGITAEVDNELLILEVIHRYVEAMDSYFGNVCELDIIFNFSKAYDILDEMI 121

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 60/125 (48%), Gaps = 8/125 (6%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V + S    +GK LLSR+++D   D  L  + NF  L+ ++  + + V        + Y
Sbjct: 2   VVLAASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   ++ YI+ L T+  +N  +    L+   + ++ YL   +++ I  N   I    DE
Sbjct: 58  VYRPFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDE 116

Query: 118 MMDYG 122
           ++  G
Sbjct: 117 IVSMG 121

>ZYRO0E05236g Chr5 complement(399318..399788) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%)

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++ ++  LY +   T  + N       +H+ VE M  Y  +V E  I  NF   Y +LDE
Sbjct: 60  VYRRYASLYFICGITPEADNELLTLEIIHRYVETMDTYFGNVCELDIIFNFGKAYAILDE 119

Query: 118 MM 119
           M+
Sbjct: 120 ML 121

>Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)
          Length = 546

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V + S    +GK LLSR+++D   D  L  + NF  L+ ++  + + V        + Y
Sbjct: 2   VVLAASITTRQGKPLLSRQFKDLSKDRVLELLANFQNLVAEISSDHTFVED----KHVRY 57

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++   ++ YI+ L T+  +N  +    L+   + ++ YL    ++ I  N   I    DE
Sbjct: 58  VYRPFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFHDQEIFHNAFEILSSFDE 116

Query: 118 MMDYG 122
           ++  G
Sbjct: 117 IVSMG 121

>TDEL0B06190 Chr2 complement(1094337..1094807) [471 bp, 156 aa] {ON}
           Anc_1.388 YLR170C
          Length = 156

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++ ++  LY +   T    N       +H+ VE M  Y  +V E  I  NF   YE+L+E
Sbjct: 60  VYRRYASLYFICGITPEYDNELLTLELIHRYVETMDSYFGNVCELDIIFNFSRAYEILNE 119

Query: 118 MM--DYGIPQITETKMLKQ 134
           M+  D  I +  + ++L+Q
Sbjct: 120 MIMCDGSIAESGKAEVLQQ 138

>SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 50  LTHNGIHYLFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFV 109
           L +N    ++ ++  LY V   +    N       +H+ VE M  Y  +V E  I  NF 
Sbjct: 52  LEYNDHKVVYKRYASLYFVCGVSPDKDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFN 111

Query: 110 IIYELLDEMM--DYGIPQITETKMLKQ 134
             Y +LDE++  D  I + ++ ++LK 
Sbjct: 112 KAYSILDEVLICDGSITETSKKEVLKH 138

>AFR124W Chr6 (662389..662859) [471 bp, 156 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR170C (APS1)
          Length = 156

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 2/82 (2%)

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE--M 118
           ++  L+ V   +    N       +H+ VE M  Y  +V E  I  NF   Y +LDE  M
Sbjct: 63  RYASLFFVCGISPEEDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFTRAYNILDELIM 122

Query: 119 MDYGIPQITETKMLKQYITQKS 140
            D    + ++T +LK   T  S
Sbjct: 123 CDGSFVESSKTDVLKNMATMDS 144

>CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170c APS1 Clathrin coat assembly protein AP19
          Length = 156

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           +F ++  LY +   T    N       +H+ VE M  Y ++V E  I  NF   Y++LDE
Sbjct: 60  VFRRYASLYFICGITIGHDNELLTLELIHRYVETMDTYFENVCELDIIFNFHKAYDILDE 119

Query: 118 --MMDYGIPQITETKMLKQ 134
             M D  I + ++ ++L  
Sbjct: 120 LVMCDGAIAESSKKEVLHH 138

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 58/152 (38%), Gaps = 50/152 (32%)

Query: 164 VSWR-PEGIKYKKNEAFLDIVESINMLMTQQGQVLR---SEIIGEVKVRSRLSGMPDLKL 219
           V WR     K++ NE ++D++E+ +++  ++   LR     I G V VRS L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 220 GINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLK 279
            +N                                    + G D G       VE+ D  
Sbjct: 259 KLN------------------------------------TMGNDIGIPSLHDCVEINDGV 282

Query: 280 FHQCVRLSKFENEKIITFIPPDGNFELMSYRL 311
           F          +   ITFIPPDG F L+ Y +
Sbjct: 283 F----------SPSNITFIPPDGKFRLLEYSV 304

>Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}
           complement(21263..22870) [1608 nt, 536 aa]
          Length = 535

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 63/142 (44%), Gaps = 8/142 (5%)

Query: 2   VSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYL 58
           V + S     GK LLSR++ +   D  +  + NF  L+  +  + + V        + Y+
Sbjct: 3   VLAASITTRSGKPLLSRQFTEITKDRVMELLSNFQGLVANISSDHTYVES----EHVRYV 58

Query: 59  FIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEM 118
           +   +D Y++ L T+  +N  Q  + L+   + ++ YL   +E  I +N   I    DE+
Sbjct: 59  YKPFDDYYLI-LVTNRQSNIIQDLSTLNLFSQTVNYYLNSFDEGEIFENAFEILSSFDEI 117

Query: 119 MDYGIPQITETKMLKQYITQKS 140
           +  G  +      +  Y+  +S
Sbjct: 118 IVMGNKEDLTISQVNTYLAMES 139

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 58/152 (38%), Gaps = 53/152 (34%)

Query: 164 VSWR-PEGIKYKKNEAFLDIVESINMLMTQQGQVLR---SEIIGEVKVRSRLSGMPDLKL 219
           V WR     K++ NE +LD++E+ +++  ++   +R     I G + VRS L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPSTGQDEGSSRKTSNVELEDLK 279
            +N                                    + G D G              
Sbjct: 259 KLN------------------------------------TMGNDIGIP-----------S 271

Query: 280 FHQCVRLSK--FENEKIITFIPPDGNFELMSY 309
            H+CV ++     +   ITFIPPDG F L+ Y
Sbjct: 272 LHECVEINDGGVFSPSNITFIPPDGKFRLLEY 303

>KLLA0F22814g Chr6 complement(2119266..2119736) [471 bp, 156 aa]
           {ON} highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%)

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119
           ++  LY +A     S N       +H+ VE M  Y  +V E  I  NF   Y +LDEM+
Sbjct: 63  KYASLYFIAGIDLDSDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFSKAYSILDEMI 121

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 4/45 (8%)

Query: 272 NVELEDLKFHQCVRLSKF----ENEKIITFIPPDGNFELMSYRLT 312
             +L     H CV L        +   + FIPPDG F LM Y +T
Sbjct: 279 GCDLGTPALHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSVT 323

>YLR170C Chr12 complement(500579..501049) [471 bp, 156 aa] {ON}
           APS1Small subunit of the clathrin-associated adaptor
           complex AP-1, which is involved in protein sorting at
           the trans-Golgi network; homolog of the sigma subunit of
           the mammalian clathrin AP-1 complex
          Length = 156

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%)

Query: 52  HNGIHYLFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVII 111
           +N    ++ ++  LY +   T    N       +H+ VE M  Y  +V E  I  NF  +
Sbjct: 54  YNDHKVVYKRYASLYFIVGMTPDVDNELLTLEIIHRFVETMDTYFGNVCELDIIFNFSKV 113

Query: 112 YELLDEMM 119
           Y++L+EM+
Sbjct: 114 YDILNEMI 121

>Smik_12.232 Chr12 complement(447707..448177) [471 bp, 156 aa] {ON}
           YLR170C (REAL)
          Length = 156

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119
           ++  L+ +   TS   N       +H+ VE M  Y  +V E  I  NF  +Y++L+EM+
Sbjct: 63  RYASLFFIVGVTSDVDNELLTLEVIHRFVETMDTYFGNVCELDIIFNFNKVYDILNEMI 121

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESINMLMTQQG----QVLRSEIIGEVKVRSRLSGMPDLKL 219
           V WR   +    NE ++D+VE++ + + Q       V    I G++ ++  L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 220 GINDKG 225
            ++  G
Sbjct: 255 NLHSAG 260

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 64/142 (45%), Gaps = 8/142 (5%)

Query: 2   VSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYL 58
           V S +     GK LLSR++++   +  +  + NF  L+ K    SS     +    + Y+
Sbjct: 3   VLSAAIMTRGGKPLLSRQFKELTKERVIELLSNFQGLVSK----SSSDHTYVEDEHVRYV 58

Query: 59  FIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEM 118
           +   +D Y++ L T+  +N  Q  + L+   + ++ YL   +EE I  N   I    DE+
Sbjct: 59  YRPFDDYYLI-LVTNRQSNIIQDLSTLNLFSQSVNYYLNSFDEEEIFINAFEILSSFDEI 117

Query: 119 MDYGIPQITETKMLKQYITQKS 140
           +  G  +      +  Y+  +S
Sbjct: 118 IVMGNKENLTVSQVNTYLAMES 139

>NCAS0C05130 Chr3 complement(1045330..1046934) [1605 bp, 534 aa]
           {ON} 
          Length = 534

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 7/55 (12%)

Query: 335 IHCRAKAQ---IKKKSIANNVEILIPVPDDADTPSFRYS----HGSIKWVPEKNA 382
           I C  ++    I   +I NN ++LI + D   TP  R S    +G I ++ EKN 
Sbjct: 71  IMCFGQSNYGSISSTTITNNAQLLIQIKDSGTTPGLRTSELLNYGFISFIGEKNV 125

>Kwal_26.9448 s26 complement(1221754..1223409) [1656 bp, 551 aa]
           {ON} YMR296C (LCB1) - Probable component of serine
           palmitoyltransferase, which catalyzes the first step in
           biosynthesis of long-chain sphingolipids [contig 73]
           FULL
          Length = 551

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 13/111 (11%)

Query: 43  SSVVPPCLTHNGIHYLFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEE 102
           ++ V P  T  G     I  ++   VAL  +L  + S V+ F H  +E + E L  ++E 
Sbjct: 214 AASVIPAFTKRGD---VIVADNRITVALQNALQLSRSTVYYFNHNDMESLEELLDQLQER 270

Query: 103 SIRDN-------FVIIYELLDEMMDY-GIPQITETKMLKQY--ITQKSFKL 143
            ++DN       F++   L   + D   +P++ E K   +Y  +  ++F L
Sbjct: 271 EVKDNLPTIPRKFIVTEGLFHSLGDIPNLPKLVELKRKYKYRLVVDETFSL 321

>Kpol_1061.21 s1061 complement(58801..59271) [471 bp, 156 aa] {ON}
           complement(58801..59271) [471 nt, 157 aa]
          Length = 156

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 25/55 (45%)

Query: 65  LYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119
           LY V   T    N       +H+ VE M  Y  +V E  I  NF   Y +LD+M+
Sbjct: 67  LYFVCGITQEVDNELLTLEVIHRFVETMDTYFGNVCELDIIFNFEKAYNILDDML 121

>Skud_12.236 Chr12 complement(447306..447776) [471 bp, 156 aa] {ON}
           YLR170C (REAL)
          Length = 156

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 65  LYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119
            +IV +T  +  N       +H+ VE M  Y  +V E  I  NF  +Y++L+EM+
Sbjct: 68  FFIVGVTPDID-NELLTLEIIHRFVETMDTYFGNVCELDIIFNFNKVYDILNEMI 121

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 61/176 (34%), Gaps = 77/176 (43%)

Query: 164 VSWRPEGIKYKKNEAFLDIVESI-----NMLMTQQGQ-------------------VLRS 199
           V WR   IK  KNE ++D+ E I     N +  ++G+                   ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 200 EIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLXXXXXXXXXXXXXXXXXXXXXXXXPQPS 259
            I G + VRS L+G P +++ +N                                    +
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLN------------------------------------T 342

Query: 260 TGQDEGSSRKTSNVELEDLKFHQCVRLS---KFENEKI---ITFIPPDGNFELMSY 309
            G D G+              H CV L      +++K+   + FIPPDG F L  Y
Sbjct: 343 CGNDMGTP-----------SLHPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>Kwal_14.2607 s14 complement(831030..831500) [471 bp, 156 aa] {ON}
           YLR170C (APS1) - clathrin-associated protein complex,
           small subunit [contig 224] FULL
          Length = 156

 Score = 31.2 bits (69), Expect = 3.1,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 30/62 (48%)

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++ ++  LY +   +    N       +H+ VE M  Y  +V E  I  NF   YE+L+E
Sbjct: 60  VYKRYASLYFICGISPDVDNELLTLEVIHRYVEAMDSYFNNVCELDIIFNFNKAYEILNE 119

Query: 118 MM 119
           ++
Sbjct: 120 VL 121

>KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly
           similar to uniprot|Q00381 Saccharomyces cerevisiae
           YJR058C APS2 Small subunit of the clathrin- associated
           adaptor complex AP-2 which is involved in protein
           sorting at the plasma membrane related to the sigma
           subunit of the mammalian plasma membrane clathrin-
           associated protein (AP-2) complex
          Length = 148

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%)

Query: 85  LHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQ 138
           +H  VEV+  +  +V E  I  NF   Y ++DEM   G  Q T  K L + I Q
Sbjct: 90  IHLFVEVLDSFFGNVCELDILFNFYKTYLVMDEMFIAGEIQTTSKKELLERIGQ 143

>KNAG0I01390 Chr9 complement(269809..270279) [471 bp, 156 aa] {ON}
           Anc_1.388 YLR170C
          Length = 156

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%)

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++ ++  LY +   T    N       +H+ VE M  Y  +V E  I  NF   Y++L+E
Sbjct: 60  IYRRYASLYFIIGITPNVDNELLCLDLVHRYVETMDVYFGNVCELDIIFNFAKAYDILNE 119

Query: 118 MM 119
           M+
Sbjct: 120 MV 121

>KAFR0I02080 Chr9 (426510..426980) [471 bp, 156 aa] {ON} Anc_1.388
           YLR170C
          Length = 156

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117
           ++ ++  LY +   +S   N       +H+ VE M  Y  +V E  I  NF   Y++L+E
Sbjct: 60  VYRRYASLYFICGISSDIDNELLTLEIIHRYVETMDTYFGNVCELDIIFNFSKAYDILNE 119

Query: 118 MM--DYGIPQITETKML 132
           M+  D  I + ++  +L
Sbjct: 120 MIMCDGSIAETSKKDIL 136

>TDEL0B00750 Chr2 (139060..140316) [1257 bp, 418 aa] {ON} Anc_8.822
           YMR268C
          Length = 418

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 46/110 (41%), Gaps = 21/110 (19%)

Query: 47  PPCLTHNGIHYLFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRD 106
           PP  T   I  LF+ HN + +     SL  N+++ F +    V+V S    D     + D
Sbjct: 111 PPNYTQRDIKSLFLDHNAVALSVRFPSLRYNSNRRFAY----VDVTSTEEADRITAELND 166

Query: 107 NFVIIYELL---------DEMMDYG--------IPQITETKMLKQYITQK 139
             V  Y L+          +  DYG        I Q+  TKM +Q++ Q+
Sbjct: 167 KEVETYRLVVKKSNPIEKSKRSDYGASERREIMIRQLDITKMNEQFLQQE 216

>KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 62/126 (49%), Gaps = 8/126 (6%)

Query: 1   MVSSISFCDSKGKQLLSRKYRD---DIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHY 57
           +V + S   S GK LLSR+++D   D  L  + NF  L+  L+  S+     +  + + Y
Sbjct: 2   VVLAASITTSNGKPLLSRQFKDLSRDRVLELLSNFQNLV-SLKHSSN--HTFVEDDHVRY 58

Query: 58  LFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKD-VEEESIRDNFVIIYELLD 116
           ++   +D YI+ L T+  +N  Q  + L+   + ++ +L +  ++  I +    I    D
Sbjct: 59  VYKPFDDFYII-LITNRQSNIVQDLSTLNLFSQTINAFLNNQFDQYEIYNKAFEILSSFD 117

Query: 117 EMMDYG 122
           E++  G
Sbjct: 118 EIVSMG 123

>Suva_10.268 Chr10 complement(472748..473218) [471 bp, 156 aa] {ON}
           YLR170C (REAL)
          Length = 156

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 65  LYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMM 119
            +IV +T  +  N       +H+ VE M  Y  +V E  I  NF  +Y++L+EM+
Sbjct: 68  FFIVGVTPDVD-NELLTLEVIHRFVETMDTYFGNVCELDIIFNFNKVYDILNEMV 121

>NCAS0A08790 Chr1 (1739972..1740442) [471 bp, 156 aa] {ON} Anc_1.388
          Length = 156

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 2/76 (2%)

Query: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE--M 118
           ++  LY +   T    N       +H+ VE M  Y  +V E  I  +F   Y++L+E  M
Sbjct: 63  RYASLYFICGITPEVDNELLTLEVIHRYVETMDSYFGNVCELDIIFHFTKAYDILNELIM 122

Query: 119 MDYGIPQITETKMLKQ 134
            D  + + ++ ++LK 
Sbjct: 123 CDGSLAETSKKEILKN 138

>KAFR0C04900 Chr3 (973774..975384) [1611 bp, 536 aa] {ON} Anc_7.8
           YOR372C
          Length = 536

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 71/161 (44%), Gaps = 20/161 (12%)

Query: 278 LKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIKPLIWCDVNIH---VHSKSRVE 334
           L+F +   L+K  N+K+ T +  D +    +Y+  TP K   +    ++   V+  S   
Sbjct: 308 LRFTKNTILTKTPNKKLKTKMINDNDNIQNNYKKDTPAKKTSYKSNELNDDIVYGSSPTT 367

Query: 335 IHCRAK---------AQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKW-VPEKNAIL 384
           I   +          A+I   ++ NN+   +P+   + TP    S  S    VPE    L
Sbjct: 368 IQLNSSVTKSVSKLDAKIPNLTVENNLLRRLPL---SPTPKSNISLISEGLTVPE----L 420

Query: 385 WKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQIKFQI 425
            K+ SF   +  S+++ L +P+     KPK  +  Q KFQ+
Sbjct: 421 PKMGSFKSERTLSISSNLSMPNTIKTVKPKKNKAKQPKFQV 461

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,218,494
Number of extensions: 1980637
Number of successful extensions: 5748
Number of sequences better than 10.0: 135
Number of HSP's gapped: 5741
Number of HSP's successfully gapped: 246
Length of query: 469
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 356
Effective length of database: 40,524,141
Effective search space: 14426594196
Effective search space used: 14426594196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)