Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A009307.125ON58657328580.0
Smik_6.4677.125ON54851716110.0
Suva_16.447.125ON54951415920.0
YPL260W7.125ON55151515920.0
Skud_16.187.125ON55052115840.0
NCAS0E021307.125ON52652615620.0
TDEL0H028707.125ON58753115640.0
SAKL0F05390g7.125ON59550615480.0
NDAI0E036707.125ON52252815280.0
CAGL0H09108g7.125ON53251915270.0
KLLA0D14355g7.125ON58851315210.0
ZYRO0C05192g7.125ON58851714930.0
KLTH0F12540g7.125ON59550514810.0
Kwal_55.208327.125ON57551514660.0
TPHA0C016107.125ON55152314560.0
Kpol_322.77.125ON53448914520.0
KNAG0L009407.125ON54951714050.0
Ecym_83527.125ON57954513880.0
KAFR0L004607.125ON51149213151e-176
ADL019W7.125ON52546012081e-160
Kpol_1062.587.125ON4913093215e-31
Suva_4.1342.325ON143639716.1
SAKL0A04620g6.208ON39277698.4
NDAI0C011505.509ON92486699.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A00930
         (586 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...  1105   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   625   0.0  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   617   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   617   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   614   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   606   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   607   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   600   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   593   0.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   592   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   590   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   579   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   575   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   569   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   565   0.0  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   563   0.0  
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   545   0.0  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   539   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   511   e-176
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   469   e-160
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   128   5e-31
Suva_4.134 Chr4 (247333..251643) [4311 bp, 1436 aa] {ON} YDL112W...    32   6.1  
SAKL0A04620g Chr1 (426819..427997) [1179 bp, 392 aa] {ON} simila...    31   8.4  
NDAI0C01150 Chr3 complement(229501..232275) [2775 bp, 924 aa] {O...    31   9.5  

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/573 (94%), Positives = 543/573 (94%)

Query: 1   MSAQLTPLASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVL 60
           MSAQLTPLASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVL
Sbjct: 1   MSAQLTPLASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVL 60

Query: 61  TKVRELDEIRKNSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPA 120
           TKVRELDEIRKNSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPA
Sbjct: 61  TKVRELDEIRKNSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPA 120

Query: 121 TYSSLSTVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSK 180
           TYSSLSTVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSK
Sbjct: 121 TYSSLSTVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSK 180

Query: 181 QEHXXXXXXXXXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRR 240
           QEH                DLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRR
Sbjct: 181 QEHELIEIENERTRNRIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRR 240

Query: 241 GLLSLASPTNDTLSKSDNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYYKS 300
           GLLSLASPTNDTLSKSDNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYYKS
Sbjct: 241 GLLSLASPTNDTLSKSDNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYYKS 300

Query: 301 LETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLM 360
           LETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLM
Sbjct: 301 LETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLM 360

Query: 361 VTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKXXX 420
           VTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYK   
Sbjct: 361 VTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKLLE 420

Query: 421 XXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDA 480
                      IHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDA
Sbjct: 421 SSEPISESLQSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDA 480

Query: 481 NGDIPEGQGILNAMLAECFDMVHELKCDAEAYSSSENATPINTDKEDSSLNLKSLNINDK 540
           NGDIPEGQGILNAMLAECFDMVHELKCDAEAYSSSENATPINTDKEDSSLNLKSLNINDK
Sbjct: 481 NGDIPEGQGILNAMLAECFDMVHELKCDAEAYSSSENATPINTDKEDSSLNLKSLNINDK 540

Query: 541 LDGSLNSDDEGKNGLSNRPQQFARDLGVHSMNS 573
           LDGSLNSDDEGKNGLSNRPQQFARDLGVHSMNS
Sbjct: 541 LDGSLNSDDEGKNGLSNRPQQFARDLGVHSMNS 573

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/517 (61%), Positives = 392/517 (75%), Gaps = 32/517 (6%)

Query: 14  HPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNS 73
           HPQIVP EEE ILN+LLEVR+ LAKLKQNRTQ+LN+K VQ TYQ VLTKVRELD+IRKNS
Sbjct: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68

Query: 74  LTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLE 133
             TPAK+A TLIH+++LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPATY+SLSTV+ LLE
Sbjct: 69  HETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128

Query: 134 HLNESRMFTMHDLRPIKERLDEIQEIVEK---SSYRNDEFNDSALVGLSKQEHXXXXXXX 190
           HLNES +FT HDL PIKERLDEI +IVE+   SS  N++ ND  L  +  +         
Sbjct: 129 HLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNER-------- 180

Query: 191 XXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTN 250
                    DLL+RAKL+ C ++++ +ES+LE+I+P+LSS+++KL+ IRRGLLSL +   
Sbjct: 181 --KKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVASAK 238

Query: 251 DTLSKS----------------DNNHIASTNHNVSDKS-HKELVLLKMKKQLVEIESQRD 293
            T+SKS                +NN +    H VS +  H++L +LK   +L E+ES RD
Sbjct: 239 KTMSKSSANINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLK--DELNELESNRD 296

Query: 294 ENGYYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIK 353
           ++G +KSLET++V + GQ ++N L+DDC+DLINDLSH  NG +  DPYLQ IY+ LIDIK
Sbjct: 297 DSGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIK 356

Query: 354 TNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYA 413
           T L NLM+TRRWTLRETDLFSYQKKL EID+ R+NGKF + + D+KGQSI+LYLLRRCYA
Sbjct: 357 TTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYA 416

Query: 414 IIYKXXXXXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRI 473
           IIYK              IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD LR 
Sbjct: 417 IIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRT 476

Query: 474 DGKFYDANGDIPEGQGILNAMLAECFDMVHELKCDAE 510
           DG FYD++G+IPEGQGILNA+LAECFD++HELK +AE
Sbjct: 477 DGIFYDSDGNIPEGQGILNALLAECFDILHELKVEAE 513

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/514 (60%), Positives = 392/514 (76%), Gaps = 27/514 (5%)

Query: 14  HPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNS 73
           HPQIVP EEE ILN+LLEVR+ LAKLKQNRTQ+LN+K VQ TYQ VLTKVRELD+IRKNS
Sbjct: 9   HPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68

Query: 74  LTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLE 133
             TPAK+A TLIH ++LHNRVDSVLDDVFQL+SLCFLTVG+KNSAPATY+SLSTV+ LLE
Sbjct: 69  HDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLLE 128

Query: 134 HLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRN--DEFNDSALVGLSKQEHXXXXXXXX 191
           HLNES +FT HDL PIKERL+EI++IVEK++  N  ++ ND  L  +  + +        
Sbjct: 129 HLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREIDNERNKNRIEE-- 186

Query: 192 XXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTND 251
                   DLL+RAKL+ C ++++ +ES+LE+I+P+LS++++KL+ IRRGLLSL +    
Sbjct: 187 --------DLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKK 238

Query: 252 TLSKSD---------NNHIASTNHNVSDKSH---KELV---LLKMKKQLVEIESQRDENG 296
           T+S+S+         +N + + N+++ D  H   +E V   L  +K +L E+ES RDE+G
Sbjct: 239 TMSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESG 298

Query: 297 YYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNL 356
            +KSLE++KV   GQ ++N L+DDC+DL+NDLSH  NG +  DP LQ IY+ LIDIKT L
Sbjct: 299 KFKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTL 358

Query: 357 ANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIY 416
            NLM+TRRWTLRETDLFSYQKKL EIDS RV GKF + T D+KGQSI+LYLLRRCYAIIY
Sbjct: 359 ENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIY 418

Query: 417 KXXXXXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGK 476
           K              +H QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD LR DG 
Sbjct: 419 KLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGI 478

Query: 477 FYDANGDIPEGQGILNAMLAECFDMVHELKCDAE 510
           FYD++G+IPEGQGILNA+LAECFD++HELK +AE
Sbjct: 479 FYDSDGNIPEGQGILNALLAECFDIMHELKVEAE 512

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/515 (60%), Positives = 391/515 (75%), Gaps = 28/515 (5%)

Query: 14  HPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNS 73
           HPQIVP EEE ILN+LLEVR+ LAKLKQNRTQ+LN+K VQ TYQ VLTKVRELD+IRKNS
Sbjct: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68

Query: 74  LTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLE 133
             TPAK+A TLIH ++LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPATY+SLSTV+ LLE
Sbjct: 69  HETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128

Query: 134 HLNESRMFTMHDLRPIKERLDEIQEIVEK---SSYRNDEFNDSALVGLSKQEHXXXXXXX 190
           HLNES +FT HDL PIKERL+EI +IVE+   S   +++ ND  L  +  +         
Sbjct: 129 HLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNER-------- 180

Query: 191 XXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTN 250
                    DLL+RAKL+ C ++++ +E +LE+I+P+LS++++KL+ IRRGLLSL +   
Sbjct: 181 --KKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAK 238

Query: 251 DTLSKSD---------NNHIASTNHNVSDKSH---KELV---LLKMKKQLVEIESQRDEN 295
            T+SKSD          N + + N +++D  H   +E V   L  +K +L E+ES RD++
Sbjct: 239 KTMSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDS 298

Query: 296 GYYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTN 355
           G +KSLE+++V  +GQ ++N L+DDC+DL+NDLSH +NG +  DPYLQ IY+ LIDIKT 
Sbjct: 299 GKFKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTT 358

Query: 356 LANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAII 415
           L NLM+TRRWTLRETDLFSYQKKL EID+ R+NGKF + + D+KGQSI+LYLLRRCYAII
Sbjct: 359 LENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAII 418

Query: 416 YKXXXXXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDG 475
           YK              IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD LR +G
Sbjct: 419 YKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEG 478

Query: 476 KFYDANGDIPEGQGILNAMLAECFDMVHELKCDAE 510
            FYD++G+IPEGQGILNA+LAECFD++HELK +AE
Sbjct: 479 IFYDSDGNIPEGQGILNALLAECFDILHELKVEAE 513

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/521 (59%), Positives = 393/521 (75%), Gaps = 28/521 (5%)

Query: 8   LASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELD 67
            +S   HPQIVP EEE ILN+LLEVR+ LAKLKQNRTQ+LN+K VQ TYQ VLTKVRELD
Sbjct: 2   FSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 61

Query: 68  EIRKNSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLST 127
           +IRKNS  TPAK+A TLIH ++LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPATY+SLST
Sbjct: 62  DIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 121

Query: 128 VQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEK---SSYRNDEFNDSALVGLSKQEHX 184
           V+ LLEHLNES +FT HDL PIKERLDEI +IVE+   S    ++ ND+ +  +  +   
Sbjct: 122 VESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNER-- 179

Query: 185 XXXXXXXXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLS 244
                          DLL+RAKL+ C ++++ +ES+LE+I+P+LS++++KL+ IRRGLLS
Sbjct: 180 --------KQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLS 231

Query: 245 LASPTNDTLSKS---------DNNHIASTNHNVSDKSH---KELV---LLKMKKQLVEIE 289
           L +    T+SKS         ++N + + ++++ D  H   +E V   L  +K +L E+E
Sbjct: 232 LVASAKKTMSKSSANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELE 291

Query: 290 SQRDENGYYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNL 349
           S RD++G +KSLET++V  +GQ ++N L+DDC+DLI+DLSH  NG +  DP+LQ  Y+ L
Sbjct: 292 SNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQL 351

Query: 350 IDIKTNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLR 409
           IDIKT L NLM+TRRWTLRETDLFSYQKKL EIDS R+NGKF + + D+KGQSI+LYLLR
Sbjct: 352 IDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLR 411

Query: 410 RCYAIIYKXXXXXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLD 469
           RCYAIIYK              IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD
Sbjct: 412 RCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLD 471

Query: 470 ELRIDGKFYDANGDIPEGQGILNAMLAECFDMVHELKCDAE 510
            LR +G FYD++G+IPEGQGILNA+LAECFD++HELK +AE
Sbjct: 472 NLRTNGIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAE 512

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/526 (58%), Positives = 388/526 (73%), Gaps = 24/526 (4%)

Query: 9   ASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDE 68
            S   HPQ VP EEEDILN+LL+VR+ L+KLKQNRTQ+LN+K VQITYQ+VLTKVRELDE
Sbjct: 5   PSNTTHPQEVPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVRELDE 64

Query: 69  IRKNSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTV 128
           IRKNS  TP+K+ATTLIH ++LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPATY+SLSTV
Sbjct: 65  IRKNSHDTPSKSATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV 124

Query: 129 QCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYR--NDEFNDSALVGLSKQEHXXX 186
           Q LLEHL+ES +FT HDL PIK+RL+EI +IVEKS  +  +++ ND        +E    
Sbjct: 125 QSLLEHLSESNIFTHHDLSPIKDRLNEISKIVEKSCGKLPDEQLNDD-------EEQNLK 177

Query: 187 XXXXXXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLA 246
                        DLL+RAKLQ C++++ Q+ES+LE+I+P+L+S ++KL+ IRRGLLSLA
Sbjct: 178 DIDTERNKNKIEQDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLLSLA 237

Query: 247 SPTNDTLSKS--------DNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYY 298
           + T   +++         +N H+ S  + V+ K H       ++ ++  +E+ RDE+G +
Sbjct: 238 ASTKKNMNQGSLTSEKELENKHLVSQEY-VNKKLHA------LEAEVQALEANRDESGKF 290

Query: 299 KSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLAN 358
           KSLETN+V   GQ ++N L+DDC DLINDLSH  NG++  DP LQ IY+ LIDIKT L N
Sbjct: 291 KSLETNEVAENGQNVLNGLLDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTTLEN 350

Query: 359 LMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKX 418
           LM+TRRWTLRETDLF+YQK+L EID++RV G+F +   D+KGQ I+LYLLRRCYAIIYK 
Sbjct: 351 LMITRRWTLRETDLFTYQKQLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAIIYKL 410

Query: 419 XXXXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFY 478
                        IH QLSTVRRCLM LKR+GGV + +ELYPYQMKLASLD LR+DGKFY
Sbjct: 411 LESSEPVSESLQPIHNQLSTVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDGKFY 470

Query: 479 DANGDIPEGQGILNAMLAECFDMVHELKCDAEAYSSSENATPINTD 524
           D+ G+IPEGQG LNA+LA CFD++HELK +AE       +   N D
Sbjct: 471 DSEGNIPEGQGTLNALLAACFDIMHELKVEAEEREEQSKSDAENND 516

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/531 (58%), Positives = 395/531 (74%), Gaps = 14/531 (2%)

Query: 1   MSAQLTPLASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVL 60
           M   L   AS + HPQ VP EEE ILN+LL VR  L +LKQNR Q+LN+K+VQ  YQ VL
Sbjct: 1   MVVSLPVAASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVL 60

Query: 61  TKVRELDEIRKNSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPA 120
           TKVRELD+IRK++  TP+ +ATTLIH ++LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPA
Sbjct: 61  TKVRELDQIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA 120

Query: 121 TYSSLSTVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSK 180
           TY+SLSTVQ LLEHLNES +FT HDLRPI+ERL EI +IVE SSY+N+   D+      K
Sbjct: 121 TYASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEK 180

Query: 181 QEHXXXXXXXXXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRR 240
                              DLL+RAKLQ C+++++  ES++E+I+P+L++I++KL+ IRR
Sbjct: 181 LPEADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRR 240

Query: 241 GLLSLASPT---NDTLSKSDNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGY 297
           GLLSLA+ +   N +L KS  +           + H    + K++ QL E+ES RDENG 
Sbjct: 241 GLLSLAASSKRSNPSLEKSPLS-----------QEHVHEQVEKLESQLTELESHRDENGK 289

Query: 298 YKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLA 357
           +KSLET+KVE +GQ ++N L+DDC+DLI+DLSH +NG I  D  LQ IY+ LIDIKT+L 
Sbjct: 290 FKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLE 349

Query: 358 NLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYK 417
           NL+VTRRWTLRETDLF++QK+L+EIDSLRV+GKF + +  +KGQSI+LYLLRRC+AIIYK
Sbjct: 350 NLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYK 409

Query: 418 XXXXXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKF 477
                         IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD+LR DGKF
Sbjct: 410 LLESSEPVSESLQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKF 469

Query: 478 YDANGDIPEGQGILNAMLAECFDMVHELKCDAEAYSSSENATPINTDKEDS 528
           YD++G+IPEGQG LNA+LAECFD+VHELK +A+  + +E+A     +++D 
Sbjct: 470 YDSDGNIPEGQGTLNALLAECFDIVHELKIEAQERAETESAQQSEAEQDDG 520

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/506 (60%), Positives = 377/506 (74%), Gaps = 18/506 (3%)

Query: 12  NNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRK 71
           +NHPQ VP EEE+ILN+ L+VR+ L+KLKQNR+QFLN+K V  TYQ VLTKVRELD+ RK
Sbjct: 3   SNHPQEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDDTRK 62

Query: 72  NSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCL 131
           +S  TPA +ATTLIH   LHNRVDSVLDDVFQLLSL FLTVG+KNSAPATY+SLSTVQ L
Sbjct: 63  SSHNTPASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRL 122

Query: 132 LEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSAL-----VGLSKQEHXXX 186
           LEHLNES +FT HDLRPIKERLDE+ EIVEK+SYRN+  N+            +Q+    
Sbjct: 123 LEHLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQEPEAQEDEQDIELK 182

Query: 187 XXXXXXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLA 246
                        DLL+RAKL+ C++++  +ES+LE+I+P L SI++KL+ IRRGLLSLA
Sbjct: 183 KADIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLLSLA 242

Query: 247 SPTN------DTLSKSDNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYYKS 300
           + T       ++L      H  S N  V+ K      L +++ +L E+ES RD +G +KS
Sbjct: 243 ASTKRNARSKESLEDKKRTHTVSPNF-VNSK------LNELQVELSELESHRDPSGKFKS 295

Query: 301 LETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLM 360
           LET+KVE  GQ ++N L+DDC+DLINDLSH  +  I  D  LQ IY NLIDIKT L NL+
Sbjct: 296 LETDKVEERGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIYDNLIDIKTTLENLL 355

Query: 361 VTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKXXX 420
           VTRRWTLRETDLF+YQK+L EID+LRV+GKF + + D+KGQSI+LYLLRRCYAIIYK   
Sbjct: 356 VTRRWTLRETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLYLLRRCYAIIYKLLE 415

Query: 421 XXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDA 480
                      IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD +R+DGKFYDA
Sbjct: 416 SSEPVSEALQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDNMRVDGKFYDA 475

Query: 481 NGDIPEGQGILNAMLAECFDMVHELK 506
           +G+IPEGQG LNA+LAECFD++HELK
Sbjct: 476 DGNIPEGQGTLNALLAECFDILHELK 501

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/528 (58%), Positives = 388/528 (73%), Gaps = 15/528 (2%)

Query: 1   MSAQLTPLASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVL 60
           MS QL+   S + HPQ+VP EEE IL +LL+VR  L  LK+NRTQ+LN++ VQ TYQ VL
Sbjct: 1   MSVQLSNYPSNSTHPQLVPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVL 60

Query: 61  TKVRELDEIRKNSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPA 120
           TKVRELDEIRKN+  TP+ +ATTLIH  +LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPA
Sbjct: 61  TKVRELDEIRKNNHATPSNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA 120

Query: 121 TYSSLSTVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSK 180
           TY+SLSTVQ LLEHLNES +FT HDL PIKERLD+I +IVE+S  +  + ++    G  +
Sbjct: 121 TYASLSTVQSLLEHLNESNIFTHHDLGPIKERLDQISKIVEESCSQEIKLDNE---GDDQ 177

Query: 181 QEHXXXXXXXXXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRR 240
                              DLL+RAKLQ C+++++++ES+LE+I+P+L+SI++KL+ IRR
Sbjct: 178 FNQYLDETELEQNQNKIEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLFQIRR 237

Query: 241 GLLSLASPT--NDTLSKS--DNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENG 296
           GLLSL +    N  LS+   D  H+ S  + ++ K      LL+++K+  ++ES RDE G
Sbjct: 238 GLLSLVASAKKNSLLSQKELDEKHLISPEY-LNKK------LLELEKEFKDLESNRDEFG 290

Query: 297 YYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNL 356
            +KSLET ++   GQ ++  L DDCNDLINDLSH  NG +  DP LQ +Y+ LI+IKT L
Sbjct: 291 KFKSLETGEIPENGQNVLKGLEDDCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTTL 350

Query: 357 ANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIY 416
             LM+TRRWTLRETDLF+YQKKL EID+LRV GKF S +SD+KGQ IILYLLRRCYAIIY
Sbjct: 351 EKLMITRRWTLRETDLFTYQKKLGEIDNLRVKGKFPSKSSDSKGQFIILYLLRRCYAIIY 410

Query: 417 KXXXXXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGK 476
           K              IH QLSTVRRCL+ +KRLGGV++ +ELYPYQMKLASLD LR DG 
Sbjct: 411 KLLECSEPVSESLQPIHNQLSTVRRCLLDIKRLGGVSNERELYPYQMKLASLDNLRKDGI 470

Query: 477 FYDANGDIPEGQGILNAMLAECFDMVHELKCDAEAYSSSENATPINTD 524
           FYD++G+IPEGQG LNA+LA CFD+VHE+K +AEA + S N T  N D
Sbjct: 471 FYDSDGNIPEGQGTLNALLAACFDIVHEMKVEAEANNKS-NDTSDNDD 517

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/519 (58%), Positives = 376/519 (72%), Gaps = 48/519 (9%)

Query: 9   ASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDE 68
            S  NHPQ VP EEE ILN+LLEVR+ L+KLK+NRTQ+LN+K V  TYQ VLT+VRELD 
Sbjct: 8   VSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDG 67

Query: 69  IRKNS--LTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLS 126
           IRK+S  +T     ATTLIHD+ +HNRVDSVLDDVFQLLSLCFLTVG+KNSAPATY+SLS
Sbjct: 68  IRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 127

Query: 127 TVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKS--SYRNDEFNDSALVGLSKQEHX 184
           TVQCLLEHL ES +FT HDLRPIKERLDEI +IVEKS  S   DE  +   +   + ++ 
Sbjct: 128 TVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVAEFKEIDTERNKNR 187

Query: 185 XXXXXXXXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLS 244
                          DLL++AKLQ CI+++N++ES+LE+I P+LS I+++L+ +RRGLLS
Sbjct: 188 IEQ------------DLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLS 235

Query: 245 LASPTNDTLSKSDNNHIASTNHNVSDKSHKELVLL-----------------KMKKQLVE 287
           LA               AS+  N+ D+++KE   L                 K KK++ +
Sbjct: 236 LA---------------ASSKKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAK 280

Query: 288 IESQRDENGYYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYK 347
           +E+ RDENG + S  T K E  GQ I+N L+DDCNDLINDLSH  NG +  DPYLQ IY+
Sbjct: 281 MEAMRDENGQFVSKSTGKAEQRGQNILNGLLDDCNDLINDLSHQTNGGLTLDPYLQPIYE 340

Query: 348 NLIDIKTNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYL 407
            LIDIKT L NLM+TRRWTLRETDLF+YQK+L EID++RV+GKF + + D+KGQSIILYL
Sbjct: 341 KLIDIKTTLENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYL 400

Query: 408 LRRCYAIIYKXXXXXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLAS 467
           LRRCYAIIYK              +H QLSTVRRCL+ LKR+GGV + +ELYPYQMKLAS
Sbjct: 401 LRRCYAIIYKLLESSEPVSESLQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLAS 460

Query: 468 LDELRIDGKFYDANGDIPEGQGILNAMLAECFDMVHELK 506
           LD LR DGKFYD++G+IPEGQGILNA+LA CFD++HELK
Sbjct: 461 LDNLRKDGKFYDSDGNIPEGQGILNALLAGCFDILHELK 499

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/513 (58%), Positives = 380/513 (74%), Gaps = 24/513 (4%)

Query: 10  SRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEI 69
           S N+HP  VP+EEE+IL + L+VR+ L+K+KQNR+QFLN+K V  TYQ VLTKVRELDE+
Sbjct: 2   SVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDEL 61

Query: 70  RKNSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQ 129
           RKNS  TP+ +ATTLIH S+LHNRVDSV+DDVFQLLSL FLTVG+KNSAPATY+SLSTVQ
Sbjct: 62  RKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQ 121

Query: 130 CLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYR--------NDEFNDSALVGLSKQ 181
            LLEHLNES ++T HDLRPIKERL+E+  IVE++ Y         N + +D     L K 
Sbjct: 122 SLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKD 181

Query: 182 EHXXXXXXXXXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRG 241
           E                 DLL+RAKL+ CI+++N +ES+LE+I+P+L S ++ L+ IRRG
Sbjct: 182 EELNKNKIEE--------DLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRG 233

Query: 242 LLSLASPTNDTLSKS--DNNHIASTNHNVSDKSH---KELV---LLKMKKQLVEIESQRD 293
           LLSLAS T     K    +  + S     S+K +    +++   L ++++QL ++ES RD
Sbjct: 234 LLSLASSTKRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDEKLKQLQEQLEKLESHRD 293

Query: 294 ENGYYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIK 353
            NG +KSLET+KVE +GQ ++N L+DDC+DL+NDLSH ++G I  D  LQ IY  L+DIK
Sbjct: 294 INGKFKSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIK 353

Query: 354 TNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYA 413
           T L NL+VTRRWTLRETDLF+YQKKL EID+LRVNGKF +   D+KGQSI+LYLLRRCYA
Sbjct: 354 TTLENLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYA 413

Query: 414 IIYKXXXXXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRI 473
           IIYK              +H QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD +R+
Sbjct: 414 IIYKLLESSEPVSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRV 473

Query: 474 DGKFYDANGDIPEGQGILNAMLAECFDMVHELK 506
           DGKFYD +G+IPEGQG LNA+LAECFD++HELK
Sbjct: 474 DGKFYDTDGNIPEGQGTLNALLAECFDIIHELK 506

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/517 (56%), Positives = 376/517 (72%), Gaps = 4/517 (0%)

Query: 14  HPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNS 73
           HPQ VP EEE +LN+ LE+R  L++LKQNRT++L++K+VQ TY+ VLT+VRELD++RK++
Sbjct: 15  HPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKSN 74

Query: 74  LTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLE 133
             TP+ +ATTLIH+++LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPA YSSLSTVQ LLE
Sbjct: 75  HETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRLLE 134

Query: 134 HLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSKQ---EHXXXXXXX 190
           HLNES +FTMHDLRPIKERL EI++IVEKS  +N E        L      +        
Sbjct: 135 HLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLKNAPDLDEADRNLSE 194

Query: 191 XXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTN 250
                    DLL+RAKLQ C++++   E+++E ++P+LS+I+DKL+ IRR LLSLA+   
Sbjct: 195 ETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRELLSLAASAK 254

Query: 251 DTLSKSDNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYYKSLETNKVEMEG 310
            T S +         H ++ +S    V L ++K+L EIES RDE G +KS E+ +   +G
Sbjct: 255 KTTSSASAEKELENKHVLAPESVNTRVEL-LQKELNEIESYRDETGKFKSPESEQSAEKG 313

Query: 311 QGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLMVTRRWTLRET 370
           Q ++N L+ DC DL+ DLSH +NG I  DP LQ IY  LIDIKT L NL++TRRWTLRET
Sbjct: 314 QNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENLLITRRWTLRET 373

Query: 371 DLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKXXXXXXXXXXXXX 430
           DLF+YQK+L EIDSLRVN KF + + D KGQ+I+LYLLRRCYAIIYK             
Sbjct: 374 DLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKLLESSEPVSESLQ 433

Query: 431 XIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPEGQGI 490
            +H QLSTVRRCL++L+R+GG+ + +ELYPYQMKLASLD LR+DGKFYD +G+IPEGQ  
Sbjct: 434 PLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDGNIPEGQAT 493

Query: 491 LNAMLAECFDMVHELKCDAEAYSSSENATPINTDKED 527
           LNA+LAECFD++HE+K +AE  + SE  +    D +D
Sbjct: 494 LNALLAECFDIIHEMKIEAEEKTESETQSEAEGDGDD 530

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/505 (58%), Positives = 368/505 (72%), Gaps = 12/505 (2%)

Query: 14  HPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNS 73
           HPQ VP EEE  L + LEVR  L++LKQNR+Q+LN+K V  TYQ VLTKVRELD IRK+S
Sbjct: 4   HPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSS 63

Query: 74  LTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLE 133
              PA +ATTLIH+ +LHNRVDSVLDDVFQLLSL FLTVG+KNSAPATY+SLSTVQ LLE
Sbjct: 64  HHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 123

Query: 134 HLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSKQEHXXXXXXXXXX 193
           HL+ES +FT HDLRPIKERLDEI EIV +SSY +        +  +K             
Sbjct: 124 HLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRIDFAK-------IQDEKD 176

Query: 194 XXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTN-DT 252
                 DLL+RAKLQ C++++  +ES+LE+I+P L S ++KL+ +RRGLLSLA+ T  + 
Sbjct: 177 RNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNA 236

Query: 253 LSKSDNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYYKSLETNKVEMEGQG 312
           +SK        T  ++  +   +  L +++ +L EIES RD +G + SLET ++  +GQ 
Sbjct: 237 MSKQG----VKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQN 292

Query: 313 IVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLMVTRRWTLRETDL 372
           ++N L+DDC+DLINDLSH  N  +  D  LQ IY NLIDIKT L NL+VTRRWTLRETDL
Sbjct: 293 VLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDL 352

Query: 373 FSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKXXXXXXXXXXXXXXI 432
           FSYQK+L+EID LRV GKF +  +DAKGQ+I+LYLLRRCYAIIYK              I
Sbjct: 353 FSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKI 412

Query: 433 HTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPEGQGILN 492
           H QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD +R+DGKFYD +G+IPEGQG LN
Sbjct: 413 HNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLN 472

Query: 493 AMLAECFDMVHELKCDAEAYSSSEN 517
           A+LAECFD++HELK +AE   + E+
Sbjct: 473 ALLAECFDILHELKIEAEERETPED 497

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/515 (56%), Positives = 371/515 (72%), Gaps = 14/515 (2%)

Query: 12  NNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRK 71
           + HPQ VP EEE  L + LEVR  L++LKQNR+Q+LN+K+V   YQ VLTKVRELDEIRK
Sbjct: 2   HKHPQEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIRK 61

Query: 72  NSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCL 131
            S + P  +ATTLIH+ +LHNRVDSVLDDVFQLLSL FLTVG+KNSAPATY+SLSTVQ L
Sbjct: 62  RSHSAPRNSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRL 121

Query: 132 LEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSY--RNDEFNDSALVGLSKQEHXXXXXX 189
           LEHL+ES +FT HDLRPIKERLDEI EIV +SS+     E N+ + +  +K         
Sbjct: 122 LEHLDESNVFTHHDLRPIKERLDEISEIVTQSSFFKEGGEINNGS-IDFTK-------IS 173

Query: 190 XXXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPT 249
                     DLL+RAKL+ C++++  +ES+LE+I+P L   ++KL+ +RRGLLSLA+ T
Sbjct: 174 DEKDRNKIEEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLAAST 233

Query: 250 NDTLSKSDNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYYKSLETNKVEME 309
                  D +    +   +S +S KE  L  ++ +L +IESQR+ +GY+ S +T ++   
Sbjct: 234 KRNAMLKDGHKAPESP--LSQESVKE-KLHSLEAKLTQIESQRNASGYFVSADTGEIVER 290

Query: 310 GQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLMVTRRWTLRE 369
           GQ ++N L+DDC+DLINDLSH  N  +  D  LQ IY NLI+IKT L NL+VTRRWTLRE
Sbjct: 291 GQSVLNGLLDDCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKTTLENLLVTRRWTLRE 350

Query: 370 TDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKXXXXXXXXXXXX 429
           TDLF+YQK+L+EID LRV GKF + + DAKGQ+I+LYLLRRCYAIIYK            
Sbjct: 351 TDLFAYQKRLSEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAIIYKLLECSEPVSEAL 410

Query: 430 XXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPEGQG 489
             IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD +R+DGKFYD +G+IPEGQG
Sbjct: 411 QKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQG 470

Query: 490 ILNAMLAECFDMVHELKCDAEAYSSSENATPINTD 524
            LNA+LAECFD++HELK +AE Y     A    +D
Sbjct: 471 TLNALLAECFDILHELKIEAE-YRDGSGAEDAESD 504

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/523 (56%), Positives = 377/523 (72%), Gaps = 32/523 (6%)

Query: 18  VPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNSLT-- 75
           VP  E DIL +L++VR  L +LK NR+++LN+K+V++ +Q VLTKVRELD+IRK+ L   
Sbjct: 17  VPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKVRELDDIRKSKLKDD 76

Query: 76  ----TPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCL 131
               +  +  TTL+ +  LHN+VDS++DDVFQLLSLCFLTVG+KNSAPATY+SLSTVQ L
Sbjct: 77  GQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNSAPATYTSLSTVQKL 136

Query: 132 LEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSKQEHXXXXXXXX 191
           LEHL+ES +FT HDLRPIKERLDEI +IV+ +SY+N EFN+  +       +        
Sbjct: 137 LEHLDESNIFTNHDLRPIKERLDEISKIVQNNSYKNYEFNEDEI-------NPNQVDDDE 189

Query: 192 XXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTND 251
                   DLL+RAKL+FC ++F ++ S+LE+I+P L+SI++KLYHIRR LLSLASPT  
Sbjct: 190 IKQNLIEEDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRRNLLSLASPT-- 247

Query: 252 TLSKSDNNHIASTNHNVS-----DKSHKELVLLKMKKQLVEIESQRDENGYYKSLETNKV 306
                   H   T  N+S     ++S K  +L  +  +L E+E+ RDE+G +KSLETN+V
Sbjct: 248 --------HKIDTTENISIFNNNEESRK--MLKHLSDELTELETHRDEDGNFKSLETNEV 297

Query: 307 EMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLMVTRRWT 366
           +++GQ  +  LVD+C+DLIND +++   N I D  LQ IY NLI+IKTNLANLM+TRRWT
Sbjct: 298 KLKGQNALAGLVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMITRRWT 357

Query: 367 LRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKXXXXXXXXX 426
           LRETDLF YQK+L EID  RVNGKF S + + KGQSI+LYLLRRCYAIIYK         
Sbjct: 358 LRETDLFQYQKRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESSEPVS 417

Query: 427 XXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPE 486
                IH QLST RRCL+ LKR+GGV   +ELYPYQ+KLASLDELRIDGKFYD++G+IPE
Sbjct: 418 ESLQPIHNQLSTTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSGEIPE 477

Query: 487 GQGILNAMLAECFDMVHELKCDAEAYSSSEN--ATPINTDKED 527
           GQG LNA+LAECFDM+HEL+ ++E    +EN  A  I  D ED
Sbjct: 478 GQGTLNALLAECFDMLHELEIESEESVDNENDTADSIQDDNED 520

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/489 (59%), Positives = 372/489 (76%), Gaps = 16/489 (3%)

Query: 18  VPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNSLTTP 77
           VP EEE IL +LL+VRA+LAKLK NR+QFLN+K+VQ  +Q VLTKVRELD+IRK      
Sbjct: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79

Query: 78  AKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLEHLNE 137
           A  + T+IH+  LHN+VDS+LDDVFQLLSLCFLTVG+KNSAPATYSSLSTVQ LLEHL+E
Sbjct: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139

Query: 138 SRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSKQEHXXXXXXXXXXXXXX 197
           S +FT HDLRPIK+RLDEI  IVE +SYRN +F+ +     ++++               
Sbjct: 140 SNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPADETEEKRNKNKIEE------- 192

Query: 198 XXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTNDTLSKSD 257
             DLL+RAKL+ C++++N++ S+LE+I+P LSSI++KLYHIRR LLSLASP+    ++ D
Sbjct: 193 --DLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLLSLASPSRKIDTRED 250

Query: 258 NNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYYKSLETNKVEMEGQGIVNKL 317
            +   S+      K  +E  L  ++++L E+ES RDENG +KSLET +V ++GQ ++  L
Sbjct: 251 FSQFNSS------KESQE-ALSSLEQELEELESHRDENGNFKSLETGEVVLKGQNVLAGL 303

Query: 318 VDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLMVTRRWTLRETDLFSYQK 377
           VD+C+DLIND +++ NG+ + DP L+ IY  LI+IKTNLANLM+TRRWTLR+TDLF YQK
Sbjct: 304 VDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQYQK 363

Query: 378 KLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKXXXXXXXXXXXXXXIHTQLS 437
           KL  ID+ RVNGKF + + D KGQ+I+LYLLRRCYAIIYK              IH QLS
Sbjct: 364 KLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVPVSESLQSIHNQLS 423

Query: 438 TVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPEGQGILNAMLAE 497
           T RRCL++LKR+GGV   +ELYPYQ+KLASLDELRIDGKF+DANG+IPEGQG LNA+LAE
Sbjct: 424 TARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNALLAE 483

Query: 498 CFDMVHELK 506
           CFD++HEL+
Sbjct: 484 CFDIMHELE 492

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/517 (54%), Positives = 372/517 (71%), Gaps = 30/517 (5%)

Query: 16  QIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNSLT 75
           Q VP EEE ILN+ L+VR  L++LK+NRTQ+LN+ +VQ TYQ VLTKVRELD IRK +  
Sbjct: 13  QNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKKNHD 72

Query: 76  TPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLEHL 135
             A    TLIH++ LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPATY+SLSTV+ LL+HL
Sbjct: 73  AVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLQHL 132

Query: 136 NESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSKQEHXXXXXXXXXXXX 195
            E++++T HDL+PIK+RL+EI +IVE+S  + +   D+     + +E             
Sbjct: 133 EEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALE---NDEEQAIKDIDAERTRN 189

Query: 196 XXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTNDTLSK 255
               +LL++AKL+ C++ +N++ES+LE I+P L+S+++KL+ IRRGLLSL + + +  S+
Sbjct: 190 KLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQ 249

Query: 256 S-----DNNHIASTNHNVSDK--------------SHKELVLLK---MKKQLVEIESQRD 293
                 D +   S+  N+++               SHK LV  K   ++  L  +E+ RD
Sbjct: 250 ISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHK-LVREKFEVLRNDLKNLEAHRD 308

Query: 294 ENGYYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSH---TQNG-NIITDPYLQQIYKNL 349
           E+G +KSLET+KV   GQ ++N L+DDCNDL++DLSH   T NG  +  DP LQ +Y+ L
Sbjct: 309 EDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERL 368

Query: 350 IDIKTNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLR 409
           ++IKT L NLM+TRRWTLRETDLFSYQKKL EID+LRVNG+F + T+D++GQSI+LYLLR
Sbjct: 369 LEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLR 428

Query: 410 RCYAIIYKXXXXXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLD 469
           RCYAIIYK              IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD
Sbjct: 429 RCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLD 488

Query: 470 ELRIDGKFYDANGDIPEGQGILNAMLAECFDMVHELK 506
            LR DG FYD++G+IPEGQGILNA+LA CFD++HELK
Sbjct: 489 NLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELK 525

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/545 (52%), Positives = 378/545 (69%), Gaps = 23/545 (4%)

Query: 8   LASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELD 67
           ++S N   Q +P EEEDIL++ LE+R  L++LKQNR QFL +K V +TYQ VLTKVRELD
Sbjct: 1   MSSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELD 60

Query: 68  EIRKNSLTTPAKTA--TTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSL 125
           +IRK +  +       TTLIH   LHNRVDSV+DDVFQLLSLCFLTVG+KNSAPATY+SL
Sbjct: 61  KIRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASL 120

Query: 126 STVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRN---DEFNDSALVGLSKQE 182
           STVQ LL+HLNES ++T +DL+PIKERLDEI EIVEK+SY N   D  + +A        
Sbjct: 121 STVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFAD----- 175

Query: 183 HXXXXXXXXXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGL 242
                            +LL+RAKL++C++ +NQ+E++LE I  +L   +++L+ IRRGL
Sbjct: 176 ----DLEDKRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGL 231

Query: 243 LSLASPTNDTLSKSDNNHIASTNHNVSDKSHKEL--VLLKMKKQLVEIESQRDENGYYKS 300
           LSLA+     + + + +     +  +   SH+++   L  ++ +L ++ S R+E+G + S
Sbjct: 232 LSLAASAKSRVEQEEQDE---NDDELCILSHEKINERLKALETELADVRSHRNESGKFVS 288

Query: 301 L-ETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANL 359
           + + N V  +GQ ++N L+DDC+DLI DLSH  +  +  DP++Q IY +L+ IKT L NL
Sbjct: 289 VNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENL 348

Query: 360 MVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKXX 419
           +VTRRWTLRETDLF+YQKKLAE+DSLRVNGKF S +SD+KGQ+I+LYLLRRCYAIIYK  
Sbjct: 349 LVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKLL 408

Query: 420 XXXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYD 479
                       IH QLSTVR CL+ LKR+GGV + +ELYPYQMKLASLD +R+DGKFYD
Sbjct: 409 ESSEPVSESLERIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYD 468

Query: 480 ANGDIPEGQGILNAMLAECFDMVHELKCDAEAYSSSENATPINTDKEDSSLNLKSLNIND 539
            +G+IPEGQG LNA+LAECFD++HE+K +AE     E A   N   E    N+ +  I  
Sbjct: 469 PDGNIPEGQGTLNALLAECFDILHEMKIEAEV---REEAAQSNEAGEKPPNNINNQTIQM 525

Query: 540 KLDGS 544
             DG+
Sbjct: 526 TKDGT 530

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  511 bits (1315), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 266/492 (54%), Positives = 349/492 (70%), Gaps = 21/492 (4%)

Query: 16  QIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNSLT 75
           Q VP EEE  L++LL+VR  L+ LKQNR+QFLN+K +Q TYQ VLTKVRELDEIR+    
Sbjct: 10  QAVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDEIRRQKHG 69

Query: 76  TPAKTAT-TLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLEH 134
              +T   T +H  +LHNRVD+VLDDVFQLLSLCF+T G+KNSAPATY+SLSTVQ LLEH
Sbjct: 70  NSQETEIKTFVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLSTVQSLLEH 129

Query: 135 LNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSKQEHXXXXXXXXXXX 194
           L ES+++T HDL+PIKERLDEI +IV+++   N  + D++   L   ++           
Sbjct: 130 LIESKIYTHHDLKPIKERLDEIAKIVDQNCESN-TYQDAS--TLDDDDNEVSRIDNERNK 186

Query: 195 XXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTNDTLS 254
                +LL++AKL  C+ ++N +ES+LE+++P+ +S+V+KL+ IRR L+SL         
Sbjct: 187 NKIEQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLVE------- 239

Query: 255 KSDNNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYYKSLETNKVEMEGQGIV 314
                 I+ +N  V D+  K+L  L++  QL EIE+ RD +G + S+E+    ++G  ++
Sbjct: 240 ------ISKSNTGVQDQIDKKLKHLQL--QLNEIENNRDPDGNFVSIESGNPIIKGSNVL 291

Query: 315 NKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLMVTRRWTLRETDLFS 374
           N L DDC+DLI+DL+H  +     DP LQ +Y NLID+K +L NLMVTRRWTLRETDLFS
Sbjct: 292 NGLSDDCHDLISDLTH--HTKTFLDPDLQNVYDNLIDVKGSLENLMVTRRWTLRETDLFS 349

Query: 375 YQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKXXXXXXXXXXXXXXIHT 434
           Y KKL EID+LRV+GKF + +   KGQ+I+LYLLRRCY +IYK              IH 
Sbjct: 350 YLKKLNEIDNLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYKLLESSEPVSEALQPIHN 409

Query: 435 QLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPEGQGILNAM 494
           QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD LR DGKFYD+ G+IPEGQGILNA+
Sbjct: 410 QLSTVRRCLLDLKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSKGNIPEGQGILNAL 469

Query: 495 LAECFDMVHELK 506
           LA CFD++HELK
Sbjct: 470 LAGCFDILHELK 481

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  469 bits (1208), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 247/460 (53%), Positives = 322/460 (70%), Gaps = 18/460 (3%)

Query: 55  TYQSVLTKVRELDEIRKNSLTTPAKTAT-TLIHDSQLHNRVDSVLDDVFQLLSLCFLTVG 113
           TYQ+VLTKVR LD++RK        T   TLIH + LHNRVDSVLDDVFQLLSL FLTVG
Sbjct: 3   TYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTVG 62

Query: 114 MKNSAPATYSSLSTVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDS 173
           +KN+APATY+SLSTVQ LLEH+ E+ ++T  DLRPIKERLDEI EIVEK+SY +   +++
Sbjct: 63  LKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVEDEA 122

Query: 174 ALVGLSKQEHXXXXXXXXXXXXXXXXDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVD 233
            L  L++++                 DLLVRAKLQ C++ + +++S+   I P L  + D
Sbjct: 123 PLDELAEEKRLNKLEE----------DLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSD 172

Query: 234 KLYHIRRGLLSLASPTNDTLSKSDNNHIASTNHNVSDKSHKELV--LLKMKKQLVEIESQ 291
           KL+HIRR LLSLA+      +  +     ST  + +  S   L   L  ++  ++E+ES 
Sbjct: 173 KLFHIRRELLSLAASAKTDRAAGE----GSTERSTTPASPNTLASRLKDLESMILEVESH 228

Query: 292 RDENGYYKSLE-TNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLI 350
           RD++G + S +  + V  +GQ  +N L+DDC +L  DLSH  +G +  DP LQ IY+ L+
Sbjct: 229 RDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELL 288

Query: 351 DIKTNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRR 410
           +IKT L NL+VTRRWTLRETDLF+YQK+LAE+D+LRVN K  S++S +KGQ++ILYLLRR
Sbjct: 289 EIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQALILYLLRR 348

Query: 411 CYAIIYKXXXXXXXXXXXXXXIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDE 470
           CYA IYK              IH QLSTVRRCL  LKR+GGV   ++LYPYQMKLASLD 
Sbjct: 349 CYATIYKLLESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDN 408

Query: 471 LRIDGKFYDANGDIPEGQGILNAMLAECFDMVHELKCDAE 510
           +R+DGKFYDA+G+IPEGQG LNA+LAECFD++HE+K +AE
Sbjct: 409 MRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAE 448

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  128 bits (321), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 97/309 (31%), Positives = 166/309 (53%), Gaps = 19/309 (6%)

Query: 210 CIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLA-----SPTNDTLSKSDNNHIA-S 263
           C +  N +E + + I+ NLSS++DK+  +R+ LL +      S         D NH++ S
Sbjct: 187 CYKVHNVIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFSRVKSVFPQCFVLKDPNHMSNS 246

Query: 264 TNHNVSDKSHKELVLLKMKK-QLVEIESQRDENGYYKSLETNKVEMEGQGIVNKLVDDCN 322
           T     ++  + L ++K K  +  E +SQR++N      E N   + GQ I+N LVD C 
Sbjct: 247 TFDKKLNEIQRNLDVIKEKNTEYDEGQSQRNKN------EGN---INGQRILNGLVDYCQ 297

Query: 323 DLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLMVTRRWTLRETDLFSYQKKLAEI 382
           ++I+D+       I  +       K+L+ +K  L  ++VT R +L+  DLF+  K+L+++
Sbjct: 298 EVIHDVKLLAIDKIDDEKKANLFEKSLL-LKIKLETILVTNRHSLKSLDLFNLHKELSKL 356

Query: 383 DSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKXXXXXXXXXXXXXXIHTQLSTVRRC 442
           +   +  +  +     + +SII++ LRRC+ IIYK              ++ QLST+ R 
Sbjct: 357 EKRTI--RHYNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARY 414

Query: 443 LMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPEGQGILNAMLAECFDMV 502
           L+ LK  GGV  + +L P ++KL ++ + RI+  F D +G+IP GQ  LNA+L EC +++
Sbjct: 415 LLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELL 474

Query: 503 HELKCDAEA 511
             L+ D E 
Sbjct: 475 KILEIDFEG 483

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (73%)

Query: 120 ATYSSLSTVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVE 161
           + YSS+  ++ LL  LN+S +FT +DL P+K RLDEI +I+E
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILE 114

>Suva_4.134 Chr4 (247333..251643) [4311 bp, 1436 aa] {ON} YDL112W
            (REAL)
          Length = 1436

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 510  EAYSSSENATPINTDKEDSSLNLKSLNINDKLDGSLNSD 548
            E Y   ++  PI TD++   LN + +NI+    GS+NSD
Sbjct: 1217 EKYLQVKDTVPIGTDEKSLWLNKRDINIDADASGSMNSD 1255

>SAKL0A04620g Chr1 (426819..427997) [1179 bp, 392 aa] {ON} similar
           to uniprot|P53159 Saccharomyces cerevisiae YGL075C MPS2
           Essential membrane protein localized at the nuclear
           envelope and spindle pole body (SPB) required for
           insertion of the newly duplicated SPB into the nuclear
           envelope potentially phosphorylated by Cdc28p
          Length = 392

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 205 AKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTNDTLSKSDNNHIAST 264
            K QF I +  +      KI+    +I +  + +++ +   +SPTND  S+S+N H+ ST
Sbjct: 256 TKHQFIISELTR------KIDEQSKTINELRFKVKQPMTKSSSPTNDFKSRSNNKHMLST 309

Query: 265 NHNVSDKSHKELVLLKM 281
               S      L +LKM
Sbjct: 310 FLKFSLGVVSFLFILKM 326

>NDAI0C01150 Chr3 complement(229501..232275) [2775 bp, 924 aa] {ON}
           Anc_5.509 YDR409W
          Length = 924

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 8   LASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELD 67
           + +R   P ++ ++++ I       R  L  +  + TQ      + IT QSV T     D
Sbjct: 602 ITTRIQPPNVLISQQQQIPPNNNNTRTSLPSITASTTQPQFVSNIPITTQSVPTTPAIRD 661

Query: 68  EIRKNSLTTPAKTATTLIHDSQLHNR 93
           E+   S++ P    +T+I +SQ+HN+
Sbjct: 662 ELPLRSISYP---YSTVIPNSQIHNQ 684

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,568,472
Number of extensions: 2582457
Number of successful extensions: 13811
Number of sequences better than 10.0: 143
Number of HSP's gapped: 14322
Number of HSP's successfully gapped: 145
Length of query: 586
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 471
Effective length of database: 40,294,809
Effective search space: 18978855039
Effective search space used: 18978855039
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)