Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A002703.188ON95795744620.0
KAFR0C008703.188ON6125108213e-97
Kwal_56.231173.188ON6075097783e-91
NCAS0E015903.188ON6085037713e-90
SAKL0C10472g3.188ON6085067643e-89
KLTH0G16038g3.188ON6095047634e-89
NDAI0G017903.188ON6075097363e-85
KNAG0K012903.188ON6115167354e-85
Smik_2.1343.188ON5975047265e-84
Skud_2.1273.188ON5965047213e-83
NCAS0A03650singletonON6075017153e-82
Suva_2.1423.188ON6035067126e-82
KLLA0E17755g3.188ON6385107112e-81
Ecym_53143.188ON6155047066e-81
TDEL0D043303.188ON5985017021e-80
ZYRO0A04950g3.188ON6185057032e-80
AER018C3.188ON6065056846e-78
YBR015C (MNN2)3.188ON5975046811e-77
TPHA0A043803.188ON6425066771e-76
TPHA0C04560singletonON5735076685e-76
TBLA0F007403.188ON6535106632e-74
Kpol_1045.703.188ON6175116583e-74
KNAG0K01300singletonON5975156451e-72
CAGL0I04532g3.188ON6124986162e-68
KAFR0E01030singletonON6405066147e-68
Kpol_1036.503.188ON6765086141e-67
NDAI0A065003.188ON6374866068e-67
TBLA0D030301.150ON6055035835e-64
SAKL0C04598g1.150ON6114975546e-60
KAFR0G002801.150ON5795225384e-58
NDAI0A007801.150ON5875035361e-57
TPHA0E034801.150ON7095255412e-57
KLTH0F03938g1.150ON5625085261e-56
Kwal_33.136931.150ON5584985208e-56
Skud_10.311.150ON5865305165e-55
YJL186W (MNN5)1.150ON5865295149e-55
Smik_10.461.150ON5865055032e-53
KNAG0C009001.150ON6235065001e-52
NCAS0B084501.150ON5865194944e-52
AEL148W1.150ON5734944863e-51
Kpol_2002.571.150ON6055244874e-51
KLLA0C16467g1.150ON6075034841e-50
TBLA0J011901.150ON6164014804e-50
Suva_6.2661.150ON5865194741e-49
ZYRO0D17160g1.150ON5794944652e-48
Ecym_81281.150ON5925164475e-46
CAGL0M02871g1.150ON6005224335e-44
TDEL0C03020na 1ON6605514355e-44
ZYRO0F13244gna 1ON6645714161e-41
CAGL0L08096g1.150ON5643403783e-37
SAKL0C08888gna 2ON6793793565e-34
KLLA0F24574gna 2ON7113833522e-33
Ecym_3545na 2ON6703563361e-31
AEL082Wna 2ON6815863112e-28
SAKL0H22616gsingletonON7413893093e-28
KLTH0C08976gna 2ON7025602915e-26
Kwal_56.22779na 2ON6954042729e-24
Smik_6.3886.177ON1013163810.61
Suva_16.3508.131ON401109734.9
TDEL0G011705.94ON103592728.1
CAGL0C04004gsingletonON632129718.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A00270
         (957 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}...  1723   0.0  
KAFR0C00870 Chr3 complement(175651..177489) [1839 bp, 612 aa] {O...   320   3e-97
Kwal_56.23117 s56 complement(407699..409522) [1824 bp, 607 aa] {...   304   3e-91
NCAS0E01590 Chr5 (302992..304818) [1827 bp, 608 aa] {ON} Anc_3.188    301   3e-90
SAKL0C10472g Chr3 (953238..955064) [1827 bp, 608 aa] {ON} simila...   298   3e-89
KLTH0G16038g Chr7 (1404292..1406121) [1830 bp, 609 aa] {ON} simi...   298   4e-89
NDAI0G01790 Chr7 (392941..394764) [1824 bp, 607 aa] {ON} Anc_3.188    288   3e-85
KNAG0K01290 Chr11 (254881..256716) [1836 bp, 611 aa] {ON}             287   4e-85
Smik_2.134 Chr2 complement(247923..249716) [1794 bp, 597 aa] {ON...   284   5e-84
Skud_2.127 Chr2 complement(241232..243022) [1791 bp, 596 aa] {ON...   282   3e-83
NCAS0A03650 Chr1 complement(729502..731325) [1824 bp, 607 aa] {O...   280   3e-82
Suva_2.142 Chr2 complement(246653..248464) [1812 bp, 603 aa] {ON...   278   6e-82
KLLA0E17755g Chr5 complement(1572985..1574901) [1917 bp, 638 aa]...   278   2e-81
Ecym_5314 Chr5 complement(634571..636418) [1848 bp, 615 aa] {ON}...   276   6e-81
TDEL0D04330 Chr4 complement(790232..792028) [1797 bp, 598 aa] {O...   275   1e-80
ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {...   275   2e-80
AER018C Chr5 complement(661035..662855) [1821 bp, 606 aa] {ON} S...   268   6e-78
YBR015C Chr2 complement(267710..269503) [1794 bp, 597 aa] {ON}  ...   266   1e-77
TPHA0A04380 Chr1 (982546..984474) [1929 bp, 642 aa] {ON} Anc_3.1...   265   1e-76
TPHA0C04560 Chr3 (983249..984970) [1722 bp, 573 aa] {ON}              261   5e-76
TBLA0F00740 Chr6 (187874..189835) [1962 bp, 653 aa] {ON} Anc_3.1...   259   2e-74
Kpol_1045.70 s1045 complement(162608..164461) [1854 bp, 617 aa] ...   258   3e-74
KNAG0K01300 Chr11 (257271..259064) [1794 bp, 597 aa] {ON}             253   1e-72
CAGL0I04532g Chr9 (404659..406497) [1839 bp, 612 aa] {ON} simila...   241   2e-68
KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON}              241   7e-68
Kpol_1036.50 s1036 complement(135897..137927) [2031 bp, 676 aa] ...   241   1e-67
NDAI0A06500 Chr1 complement(1475305..1477218) [1914 bp, 637 aa] ...   238   8e-67
TBLA0D03030 Chr4 complement(734007..735824) [1818 bp, 605 aa] {O...   229   5e-64
SAKL0C04598g Chr3 (447448..449283) [1836 bp, 611 aa] {ON} simila...   218   6e-60
KAFR0G00280 Chr7 (92838..94577) [1740 bp, 579 aa] {ON} Anc_1.150...   211   4e-58
NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150    211   1e-57
TPHA0E03480 Chr5 complement(735664..737793) [2130 bp, 709 aa] {O...   213   2e-57
KLTH0F03938g Chr6 (351536..353224) [1689 bp, 562 aa] {ON} simila...   207   1e-56
Kwal_33.13693 s33 (354321..355997) [1677 bp, 558 aa] {ON} YJL186...   204   8e-56
Skud_10.31 Chr10 (54975..56735) [1761 bp, 586 aa] {ON} YJL186W (...   203   5e-55
YJL186W Chr10 (80155..81915) [1761 bp, 586 aa] {ON}  MNN5Alpha-1...   202   9e-55
Smik_10.46 Chr10 (78173..79933) [1761 bp, 586 aa] {ON} YJL186W (...   198   2e-53
KNAG0C00900 Chr3 (167471..169342) [1872 bp, 623 aa] {ON} Anc_1.1...   197   1e-52
NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa] ...   194   4e-52
AEL148W Chr5 (351089..352810) [1722 bp, 573 aa] {ON} Syntenic ho...   191   3e-51
Kpol_2002.57 s2002 (129140..130957) [1818 bp, 605 aa] {ON} (1291...   192   4e-51
KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} simi...   191   1e-50
TBLA0J01190 Chr10 complement(267291..269141) [1851 bp, 616 aa] {...   189   4e-50
Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON...   187   1e-49
ZYRO0D17160g Chr4 complement(1417469..1419208) [1740 bp, 579 aa]...   183   2e-48
Ecym_8128 Chr8 complement(266920..268698) [1779 bp, 592 aa] {ON}...   176   5e-46
CAGL0M02871g Chr13 (324009..325811) [1803 bp, 600 aa] {ON} simil...   171   5e-44
TDEL0C03020 Chr3 (537820..539802) [1983 bp, 660 aa] {ON}              172   5e-44
ZYRO0F13244g Chr6 (1084412..1086406) [1995 bp, 664 aa] {ON} simi...   164   1e-41
CAGL0L08096g Chr12 complement(886827..888521) [1695 bp, 564 aa] ...   150   3e-37
SAKL0C08888g Chr3 (814687..816726) [2040 bp, 679 aa] {ON} weakly...   141   5e-34
KLLA0F24574g Chr6 complement(2285387..2287522) [2136 bp, 711 aa]...   140   2e-33
Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {O...   134   1e-31
AEL082W Chr5 (474072..476117) [2046 bp, 681 aa] {ON} Non-synteni...   124   2e-28
SAKL0H22616g Chr8 complement(1966196..1968421) [2226 bp, 741 aa]...   123   3e-28
KLTH0C08976g Chr3 (751731..753839) [2109 bp, 702 aa] {ON} weakly...   116   5e-26
Kwal_56.22779 s56 complement(277096..279183) [2088 bp, 695 aa] {...   109   9e-24
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    36   0.61 
Suva_16.350 Chr16 complement(614396..615601) [1206 bp, 401 aa] {...    33   4.9  
TDEL0G01170 Chr7 complement(238219..241326) [3108 bp, 1035 aa] {...    32   8.1  
CAGL0C04004g Chr3 complement(394614..396512) [1899 bp, 632 aa] {...    32   8.3  

>TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}
           Anc_3.188 YBR015C
          Length = 957

 Score = 1723 bits (4462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 858/957 (89%), Positives = 858/957 (89%)

Query: 1   MKSFKRHIGNHYRITTLICIITFYFISHCLKEGKDPRIYEELSDTNQDSYLQDYIISPAX 60
           MKSFKRHIGNHYRITTLICIITFYFISHCLKEGKDPRIYEELSDTNQDSYLQDYIISPA 
Sbjct: 1   MKSFKRHIGNHYRITTLICIITFYFISHCLKEGKDPRIYEELSDTNQDSYLQDYIISPAS 60

Query: 61  XXXXXXXXXXXXXXDVQIPDKTISKENTKLDWNARRKLLKKSGKPXXXXXXXXXXXXXXX 120
                         DVQIPDKTISKENTKLDWNARRKLLKKSGKP               
Sbjct: 61  NWKSNLYLNNKLSNDVQIPDKTISKENTKLDWNARRKLLKKSGKPILKSIFQKLIISSSS 120

Query: 121 XXXXXXXXXPNCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLES 180
                    PNCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLES
Sbjct: 121 SGQNNIQLSPNCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLES 180

Query: 181 LNILQDLPINMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSN 240
           LNILQDLPINMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSN
Sbjct: 181 LNILQDLPINMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSN 240

Query: 241 FDFKQSESDFCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVL 300
           FDFKQSESDFCNKISKELNTNC            H                       VL
Sbjct: 241 FDFKQSESDFCNKISKELNTNCIFISDIIDEEDFHLPELTESTTLLLALLTSSFDDTLVL 300

Query: 301 SPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDI 360
           SPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDI
Sbjct: 301 SPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDI 360

Query: 361 TPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNG 420
           TPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNG
Sbjct: 361 TPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNG 420

Query: 421 PSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHD 480
           PSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHD
Sbjct: 421 PSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHD 480

Query: 481 FQQDFAFYTFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAH 540
           FQQDFAFYTFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAH
Sbjct: 481 FQQDFAFYTFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAH 540

Query: 541 SNLFDGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFD 600
           SNLFDGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFD
Sbjct: 541 SNLFDGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFD 600

Query: 601 YLEDEYVDETNALPGMCLFIKQRLDFLQSSADDAKKTIDARIKFEEKMMEYDKLKNQLSL 660
           YLEDEYVDETNALPGMCLFIKQRLDFLQSSADDAKKTIDARIKFEEKMMEYDKLKNQLSL
Sbjct: 601 YLEDEYVDETNALPGMCLFIKQRLDFLQSSADDAKKTIDARIKFEEKMMEYDKLKNQLSL 660

Query: 661 EDKLIKARIEKILSTKRLREKEVYFKKKPRINLKENGTPDWDXXXXXXXXXXXXVTDLDA 720
           EDKLIKARIEKILSTKRLREKEVYFKKKPRINLKENGTPDWD            VTDLDA
Sbjct: 661 EDKLIKARIEKILSTKRLREKEVYFKKKPRINLKENGTPDWDSELFFEEIEESSVTDLDA 720

Query: 721 EKDVDETATVDELITEEEIEFQKLQDLEEDKNGGKFAKMRKKKSNILEGSFKHKKEQPPI 780
           EKDVDETATVDELITEEEIEFQKLQDLEEDKNGGKFAKMRKKKSNILEGSFKHKKEQPPI
Sbjct: 721 EKDVDETATVDELITEEEIEFQKLQDLEEDKNGGKFAKMRKKKSNILEGSFKHKKEQPPI 780

Query: 781 FGIERNGRLELVKLDEMLEIILLDSKVKFDAQNRGAIREKDDLSLFNDIDKQEENSDQKI 840
           FGIERNGRLELVKLDEMLEIILLDSKVKFDAQNRGAIREKDDLSLFNDIDKQEENSDQKI
Sbjct: 781 FGIERNGRLELVKLDEMLEIILLDSKVKFDAQNRGAIREKDDLSLFNDIDKQEENSDQKI 840

Query: 841 EGTGVKGAPKKDGKLNLRDDPVMQELVRKKKQELMEENKRKNGVNVIKYAPIPEGQDVPK 900
           EGTGVKGAPKKDGKLNLRDDPVMQELVRKKKQELMEENKRKNGVNVIKYAPIPEGQDVPK
Sbjct: 841 EGTGVKGAPKKDGKLNLRDDPVMQELVRKKKQELMEENKRKNGVNVIKYAPIPEGQDVPK 900

Query: 901 GFNPMEKAAVXXXXXXXXXXXXXFVGRPKGKAELNAPTSPEETKGKISTKYNNFEKS 957
           GFNPMEKAAV             FVGRPKGKAELNAPTSPEETKGKISTKYNNFEKS
Sbjct: 901 GFNPMEKAAVKKKLEKDLKLKNKFVGRPKGKAELNAPTSPEETKGKISTKYNNFEKS 957

>KAFR0C00870 Chr3 complement(175651..177489) [1839 bp, 612 aa] {ON}
           Anc_3.188 YBR015C
          Length = 612

 Score =  320 bits (821), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 189/510 (37%), Positives = 271/510 (53%), Gaps = 26/510 (5%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +   + ++      W  L++  LN+CL I  + + NLKT H+ F+E+L  L  LP N 
Sbjct: 119 CQLSEKMGNRPHEYASWYKLSYTELNKCLSISKSDVLNLKTSHKEFVENLGKLV-LPKNS 177

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y G GIV +GGGK +L + +V + +R+ G  +PVE+FIPP  +K           E +FC
Sbjct: 178 YKGNGIVTVGGGKFSLMSLLVIRTLRNLGTTLPVEVFIPPQEEK----------GEMEFC 227

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
           NKI  + +  C                                    +L   NFP+KPLD
Sbjct: 228 NKILPQYHAKCIYISDILPQQMIDNFEFAGYQFKSLAIIASSFENLLLLDADNFPIKPLD 287

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            IF+ +PY  TG + WP FWRR   P  Y+I    ++F  R+R  +DDITPP VYT    
Sbjct: 288 HIFEEEPYVSTGLVLWPDFWRRTTQPLYYEIADVSVDFKTRVRNSIDDITPPPVYT---- 343

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
           K+    ++IPLHDL+GT+PD  T   Q +I KSK++ T+LLALYY+VNGPSWYY ++ QK
Sbjct: 344 KDMNDLSNIPLHDLKGTIPDVSTESGQLMISKSKHLPTVLLALYYNVNGPSWYYPIFSQK 403

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDFAFYTF 490
            S    K+    AA+  D P+YQ++    +DG  + + +     + L HDF QD+  Y  
Sbjct: 404 ASGEGDKETFLAAANFYDLPYYQIRTEVGVDGYHQPENKGFRGVAMLQHDFAQDYKRYVK 463

Query: 491 AKMNIKSTYDLKD--SNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNH---LMFAHSNLFD 545
           AK  ++  Y  KD  S+ I++DP+Y  + F   Y D G E  + G     +MF HSNL  
Sbjct: 464 AKEEVRLKYG-KDRYSSKIKYDPNYDVDSFYRTYFDSGSEPGQGGAQEVDVMFIHSNLPK 522

Query: 546 GDP-KLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLED 604
            +P    K   L+ID    + +    N+   +  +IELE+FK  HE LCE+  +F YL+D
Sbjct: 523 FEPLTSWKTSDLIIDG---KHIRSFTNLKRLKNYDIELENFKIYHEVLCEQGLHFKYLDD 579

Query: 605 EYVDETNALPGMCLFIKQRLDFLQSSADDA 634
              +  N    MC +I  RLDFLQS+ + A
Sbjct: 580 ALGNNKNDKSSMCKYISDRLDFLQSTHEAA 609

>Kwal_56.23117 s56 complement(407699..409522) [1824 bp, 607 aa] {ON}
           YBR015C (MNN2) - putative Golgi
           alpha-1,2-mannosyltransferase [contig 183] FULL
          Length = 607

 Score =  304 bits (778), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 178/509 (34%), Positives = 271/509 (53%), Gaps = 32/509 (6%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +   + +++   D W  LT  NL QCLI+ D   + LK  H+ ++ESL  L  LP   
Sbjct: 121 CKLSGDIGARADDYDNWSKLTSKNLGQCLIVSDKEKRMLKEKHRGYVESLESLV-LPKGA 179

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y G GIV +GGGK ++ A ++ K +R+    +PVE+FIPP             + E+ FC
Sbjct: 180 YKGDGIVTVGGGKFSMLAFLIIKTLRNLHTSLPVEVFIPPA-----------DEGETFFC 228

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
           N++  + N  C                                    +L   NFP+K LD
Sbjct: 229 NELLPQYNAKCIYISDVLPQEIIDNFEFKGYQFKSIAIIASSFDNLLLLDADNFPIKDLD 288

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            +F  +PY   G + WP FWRR  +P  YDI   ++N+ KR+R  +DD+TPP VYT    
Sbjct: 289 NVFNEEPYKSKGMVLWPDFWRRTTNPIYYDIADIEVNYKKRVRNCMDDVTPPAVYT---- 344

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
           K+ +  +++PLHDLEGT+PD  T   Q +I+KS ++ TILL+LYY+VNGPSWYY ++ QK
Sbjct: 345 KDMSDLSNVPLHDLEGTIPDVSTESGQLMIRKSDHLGTILLSLYYNVNGPSWYYPIFSQK 404

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDFAFYTF 490
            S    K+    AA+  D PFYQVK+   +DG  +  ++     + L HDF QD+    +
Sbjct: 405 ASGEGDKETFIAAANFYDLPFYQVKSVTAVDGYHQPHDKGFRGVAMLQHDFVQDYGRQMW 464

Query: 491 AKMNIKSTYDLKDSNDIQFDPSYT----YEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDG 546
           A++ I+S +  KD+   ++DPSY+    Y+KF ++  ++G   I      MF HSNL   
Sbjct: 465 AQVEIRSHFAGKDTQYAKYDPSYSPDAVYKKFFSD-DNIGETDI------MFVHSNLPKF 517

Query: 547 DP-KLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDE 605
           DP +L  ++ L++D    + +    N+      ++ELE+FK  +EYLC     F YL+D+
Sbjct: 518 DPYQLWHDQDLIVD---GKHIRSYRNLKRLNGYDLELENFKIFNEYLCTTQARFKYLDDK 574

Query: 606 YVDETNALPGMCLFIKQRLDFLQSSADDA 634
              +      MC +I +RL +L+ +  DA
Sbjct: 575 LNGDQRNWKDMCSYIGERLKYLEQTHLDA 603

>NCAS0E01590 Chr5 (302992..304818) [1827 bp, 608 aa] {ON} Anc_3.188
          Length = 608

 Score =  301 bits (771), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 182/503 (36%), Positives = 255/503 (50%), Gaps = 26/503 (5%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +   V S+     +W  L++ NL  CL + DT   NLKT H +F E+LN L  LP   
Sbjct: 127 CLLDGDVGSRPENYKDWYKLSYKNLGNCLEVSDTEFTNLKTSHASFTENLNKLV-LPKGT 185

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y G GIVL+GGGK +L + +V K IR+ G  +P+E+FIPP             + ES+FC
Sbjct: 186 YKGDGIVLVGGGKFSLLSYLVIKTIRNLGTTLPIEVFIPPNEV----------EGESEFC 235

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
           ++   +L+  C                                    +L   N P+K L+
Sbjct: 236 SQTISDLDAKCIYISDILPKDMVSKFEFKGYQFKSLAIIASSFENLLLLDADNTPIKNLN 295

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
           TIF+ +PY   G + WP FWRR   P  Y I G  +N  KR+R  +DD+TP  VYT  + 
Sbjct: 296 TIFKQEPYASRGLVLWPDFWRRTTQPIYYKIAGIPVNLQKRVRNDIDDLTPVGVYTKPDM 355

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
            +      IP HD EGT+PD  T   Q ++ KSK++ T+LLALYY+VNGP+WYY ++ QK
Sbjct: 356 VD------IPFHDFEGTMPDVSTESGQLMVNKSKHLATVLLALYYNVNGPNWYYPIFSQK 409

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTFA 491
            +    K+     A+  D P+YQVK+   +DG  + KE     + L HDF QD+  Y  A
Sbjct: 410 AAGEGDKETFIAGANFYDLPYYQVKSKVGVDGYHR-KEGFRGVAMLQHDFVQDYNRYKLA 468

Query: 492 KMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKLL 551
             +I   Y   + + + FD SYT +KF + Y D   E I     +MF HSNL   DP  L
Sbjct: 469 SADIAREY--SNPSSVVFDKSYTVQKFYDKYFDNTDEDI----DVMFIHSNLPKFDPLPL 522

Query: 552 KNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVDETN 611
                LI+D   +P+    N+      +IE E+FKT+ E LCEK   F YL DE+     
Sbjct: 523 WKDNDLIED--GKPVRSYTNLRKLGYHDIEYENFKTLKELLCEKNVDFKYLADEFKSNPQ 580

Query: 612 ALPGMCLFIKQRLDFLQSSADDA 634
           A    C +I  R  +L+ +  +A
Sbjct: 581 ARMSFCKYITDRYKYLEETHQEA 603

>SAKL0C10472g Chr3 (953238..955064) [1827 bp, 608 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 608

 Score =  298 bits (764), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 180/506 (35%), Positives = 265/506 (52%), Gaps = 23/506 (4%)

Query: 130 PNCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPI 189
           P C +   + ++    D W  LT   L QCL++       LK +H  F+E+L+ L  LP 
Sbjct: 121 PRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLV-LPK 179

Query: 190 NMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESD 249
           + Y G GIV +GGGK +L A ++ K +R+    +PVE+ IPP   KD        + E+D
Sbjct: 180 DSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPP---KD--------EGETD 228

Query: 250 FCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKP 309
           FC+ +  + N  C                                    +L   NFP+KP
Sbjct: 229 FCDVLLPKYNAKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKP 288

Query: 310 LDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSE 369
           LD IF  +PY  TG + WP FWRR  +P+ YDI    I+++KR+R  +D+ITPP++YT +
Sbjct: 289 LDDIFDEEPYKSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTED 348

Query: 370 EQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWY 429
            +      +++PLHDL+GT+PD  T   Q +I KS ++ T+LL+LYY+VNGPSWYY ++ 
Sbjct: 349 MED----LSNVPLHDLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFS 404

Query: 430 QKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDFAFY 488
           QK +    K+     A+    PFYQVK+   +DG  +   +     + L HDF QD+  Y
Sbjct: 405 QKAAGEGDKETFIAGANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRY 464

Query: 489 TFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDP 548
            +A  +I++ Y  K SN I  D  YT E F   Y +   + I+  + +MF HSNL   DP
Sbjct: 465 QWAFKDIRTQYSGKTSNSIHLDKDYTPESFYRKYFE--GDDIKEVD-IMFVHSNLPKFDP 521

Query: 549 KLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVD 608
             L   K LI  ++ + +    N+      ++ELESFK   +YLC +  +F YL DE++ 
Sbjct: 522 LTLWREKDLI--VNGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYL-DEHLQ 578

Query: 609 ETNALPGMCLFIKQRLDFLQSSADDA 634
           E      MC +I  RL FL S+  DA
Sbjct: 579 EEAQWQSMCDYIHNRLKFLDSTHKDA 604

>KLTH0G16038g Chr7 (1404292..1406121) [1830 bp, 609 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 609

 Score =  298 bits (763), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 178/504 (35%), Positives = 263/504 (52%), Gaps = 22/504 (4%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +   + +++   + W  LT  NL  CL + +     LK  H +F+ESL  L  LP   
Sbjct: 123 CQLNGDIGARANDYNSWSKLTSKNLGNCLKLSNKEKTMLKETHYDFVESLKSLV-LPKGT 181

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y G GIV +GGGK ++ + ++ K +R+ G  +PVE+FIPP             + E +FC
Sbjct: 182 YKGDGIVTVGGGKFSMLSFLIIKTLRNLGTHLPVEVFIPPN-----------DEGEEEFC 230

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
           N +  + N  C                                    +L   NFP+K LD
Sbjct: 231 NTLLPKYNAKCIYISDVLPEDIIENFDFKGYQFKSISIIASSFENLLLLDADNFPIKALD 290

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            IF+ +PY  TG + WP FWRR  +P+ Y+I    +N+ KR+R  +DDITPP+ YT ++ 
Sbjct: 291 NIFEEEPYKSTGMVLWPDFWRRTTNPAYYEIADIAVNYKKRVRNCMDDITPPQAYT-KDM 349

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
           KN     ++PLHDLEGT+PD  T   Q +I+KS+++ TILL+LYY+VNGP+WYY ++ QK
Sbjct: 350 KNL---ENVPLHDLEGTIPDVSTESGQLMIRKSRHLPTILLSLYYNVNGPTWYYPIFSQK 406

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDFAFYTF 490
            S    K+    AA+    PFYQVK+   +DG  +   +     + L HDF QD++ Y +
Sbjct: 407 ASGEGDKETFIAAANFYGLPFYQVKSVTAVDGYHQPDNKGFRGVAMLQHDFVQDYSRYKW 466

Query: 491 AKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKL 550
           AK +I++ Y  K    I+ D SY+ +     Y +   E ++  + +MF HSNL   DP  
Sbjct: 467 AKSDIENKYAGKVPQFIKQDTSYSPDAMYKTYFEP--EDLKEVD-IMFVHSNLPKFDPYT 523

Query: 551 LKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVDET 610
           L N K LI D   + +    N+      ++ELE+FK   EYLC     F YL+D    + 
Sbjct: 524 LWNDKDLIVD--GKHIRSYTNLRRLNNYDLELENFKVFKEYLCVSRTKFKYLDDSLQGDE 581

Query: 611 NALPGMCLFIKQRLDFLQSSADDA 634
                MC +IK+RL+FL  +  DA
Sbjct: 582 RQWKSMCGYIKERLNFLDQTHSDA 605

>NDAI0G01790 Chr7 (392941..394764) [1824 bp, 607 aa] {ON} Anc_3.188
          Length = 607

 Score =  288 bits (736), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 181/509 (35%), Positives = 257/509 (50%), Gaps = 23/509 (4%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C + + +AS+     +WE L+  NL  CL +      NL T H NF+E +N L  LP   
Sbjct: 117 CKLDQGIASRPDSYKDWEKLSMQNLLNCLEVSPEEFTNLSTSHHNFVEHVNKLV-LPKGT 175

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y   GIV++GGGK T  A +V K +R+QG  +PVEIFIPP    D++        E  FC
Sbjct: 176 YNNDGIVMVGGGKFTFMAYLVLKTLRNQGTTLPVEIFIPPI---DTVK-------EETFC 225

Query: 252 -NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPL 310
            +++  EL+  C                                    +L   NFP+K L
Sbjct: 226 KSEMLSELSAKCIYMSNILPQEMIEKFDFKGYQFKSLAIIASSFENLLLLDADNFPIKSL 285

Query: 311 DTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEE 370
           D IF+ +PY  TG + WP FWRR   P  Y +    +N  KR+R  +DDITP KVY+ + 
Sbjct: 286 DKIFKHEPYNSTGLVMWPDFWRRTTQPIYYKLADIYVNVLKRVRNDIDDITPTKVYSDD- 344

Query: 371 QKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQ 430
             N  F   IP HD EGT+PD  T   Q +I KSK++ T+LLALYY+VNGP+WYY ++ Q
Sbjct: 345 --NFDF-TKIPFHDFEGTMPDDSTESGQLMINKSKHLPTVLLALYYNVNGPNWYYPIFSQ 401

Query: 431 KISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTF 490
                  K+    AA     PFYQV+     DG   TK+R    +   HDF QD+  Y  
Sbjct: 402 NAHGEGDKETFIAAATFYRLPFYQVRTKVGADG-YHTKDRFQGVAMAQHDFIQDYEHYQI 460

Query: 491 AKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGN-HLMFAHSNLFDGDPK 549
           A+  IK  Y   +  DI++D  Y  +KF + + +   +  + G   +MF HSNL   DP 
Sbjct: 461 AQREIKKRY--SNVKDIKYDAEYAVQKFYDEFFNK--DTTKYGEIDIMFLHSNLPKFDPL 516

Query: 550 LLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVDE 609
            L     LID+  K     + +  I +K +IE E+FK + + +C+K  +F YL++E  ++
Sbjct: 517 KLWEDSALIDETGKHFRSFS-DPKIVKKYDIEYENFKIIKDVICDKGIHFSYLDEELQEK 575

Query: 610 TNALPGMCLFIKQRLDFLQSSADDAKKTI 638
                 MC +IK R  FL+ +  DA   +
Sbjct: 576 PQDWVSMCQYIKDRYIFLKDTHQDATSPV 604

>KNAG0K01290 Chr11 (254881..256716) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  287 bits (735), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 176/516 (34%), Positives = 257/516 (49%), Gaps = 38/516 (7%)

Query: 130 PNCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPI 189
           P C ++  + S+      ++ L ++NL  CL +    + NL+  H++F++SL++   LP 
Sbjct: 118 PECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSLDV--TLPS 175

Query: 190 NMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESD 249
           N Y G GIV +GGGK +L A ++ + IR  G  +PVE+FIPP            +  E++
Sbjct: 176 NSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPN-----------EGPETE 224

Query: 250 FCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKP 309
           FC ++  + N  C                                    +L   NFP+KP
Sbjct: 225 FCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKP 284

Query: 310 LDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSE 369
           L++IF  +P+   G + WP FWRR   P  YDI G  +N   R+R   DD+TPP+VYT  
Sbjct: 285 LNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYT-- 342

Query: 370 EQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWY 429
             +N    + +P HDLEGT+PD  T   Q ++ K+K++ TILLALYY+VNGP+WYY ++ 
Sbjct: 343 --ENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFS 400

Query: 430 QKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYT 489
           QK +    K+    AA+    PFYQVK++  +DG  +  E     + L +D  QD+  Y 
Sbjct: 401 QKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFENGEFHGV-AMLQYDCVQDYKLYQ 459

Query: 490 FAKMNIKSTYDLKDSND------IQFDPSYTYEKFSNNYMDVGWEAIRNGNH--LMFAHS 541
            AK +I   Y L    +      I FD SY+ E F N Y        R  +H  +MF HS
Sbjct: 460 IAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYF-------REDSHNDVMFIHS 512

Query: 542 NLFDGDP-KLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC--EKAYY 598
           N    DP  L KNR+L+  D          N+  F   +IELE+FK    + C  +K  Y
Sbjct: 513 NFPKFDPLSLWKNRQLV--DKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSY 570

Query: 599 FDYLEDEYVDETNALPGMCLFIKQRLDFLQSSADDA 634
           F YL D           MC +I +RL FL+ +  +A
Sbjct: 571 FSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEA 606

>Smik_2.134 Chr2 complement(247923..249716) [1794 bp, 597 aa] {ON}
           YBR015C (REAL)
          Length = 597

 Score =  284 bits (726), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 169/504 (33%), Positives = 257/504 (50%), Gaps = 24/504 (4%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +   +  +  + +E   L+ N L++CL +    +  L   H+++++ +  L  LP   
Sbjct: 109 CQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLA-LPKGT 167

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y G GI  +GGGK +L + ++ K +R+ G  +PVE+ IPP             + ES+FC
Sbjct: 168 YKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPG-----------DEGESEFC 216

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
           NKI    N  C                                    +L   NFP+KPLD
Sbjct: 217 NKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLD 276

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            IF  +PY  TG + WP FWRR  HP  Y+I    +N   R+R   DD+TPP +YT    
Sbjct: 277 NIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYT---- 332

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
           KN+     +PL DL+GT+PD  T   Q +I K+K++ T LL+L+Y+VNGP+WYY ++ QK
Sbjct: 333 KNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQK 392

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTFA 491
            +    K+    AA+     FYQVK    ++G    KE     + L HDF QD++ Y  A
Sbjct: 393 AAGEGDKETFIAAANFYGLSFYQVKTRTGVEG-YHDKEGFHGVAMLQHDFVQDYSRYLTA 451

Query: 492 KMNIKSTY-DLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNH--LMFAHSNLFDGDP 548
             +I + Y D+K S  I++D +Y+ EK++  + D   E ++  +H  +MF HSNL   DP
Sbjct: 452 SKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFFDN--EDLKAKDHVDVMFIHSNLPKFDP 509

Query: 549 KLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVD 608
             L     L  D   +P      +   +  +IELE+FK + EY+C+K   F YL+D+  +
Sbjct: 510 YTLSETNFLTTD--DKPARSFTALHKVQNYDIELENFKVLKEYVCDKKNPFKYLDDKLGE 567

Query: 609 ETNALPGMCLFIKQRLDFLQSSAD 632
           +      MC +I +RL FL+S+ D
Sbjct: 568 DKKEWRRMCDYIAKRLQFLESTHD 591

>Skud_2.127 Chr2 complement(241232..243022) [1791 bp, 596 aa] {ON}
           YBR015C (REAL)
          Length = 596

 Score =  282 bits (721), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 171/504 (33%), Positives = 258/504 (51%), Gaps = 20/504 (3%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +   +  +  + +E   L+   L++CL +    +  L   H++++E +  L  LP   
Sbjct: 108 CLLNGDIGDRPDQYEELHKLSAKQLSKCLELSPDEISRLTKSHRDYVEHIATLL-LPKGT 166

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y G GI  +GGGK +L A ++ K +R++G  +PVE+ IPP             + ES+FC
Sbjct: 167 YKGSGIATVGGGKFSLMAFLIIKTLRNRGTNLPVEVLIPPG-----------DEGESEFC 215

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
           NKI  + N+ C                                    +L   NFP+K LD
Sbjct: 216 NKILPKYNSKCIYVSDILPVETIKKFHFEGYQFKSLALIASSFENLLLLDADNFPIKSLD 275

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            IF  +PY  TG + WP FWRR  HP  Y+I G  +N +KR+R   DDITPP VYT ++ 
Sbjct: 276 NIFNEEPYVSTGLVMWPDFWRRTTHPLYYEIAGIPVNMNKRVRNSQDDITPPAVYT-KDL 334

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
           KN    + +PL DL+GT+PD  T   Q +I KSK + T LL+L+Y+VNGP+WYY ++ QK
Sbjct: 335 KNL---DDVPLSDLDGTIPDVSTESGQLMINKSKQLATALLSLFYNVNGPNWYYPIFSQK 391

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTFA 491
            +    K+    AA+   +PFYQV+    ++G  + K+     + L HDF QD++ Y  A
Sbjct: 392 AAGEGDKETFIAAANFYGEPFYQVRTRTGVEGYHENKDFHGV-AMLQHDFVQDYSRYLIA 450

Query: 492 KMNIKSTYD-LKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKL 550
                  Y+ +K S  I+FD SY++E +   + +      +N   +MF HSNL   DP  
Sbjct: 451 SKKTNDKYNTMKSSASIKFDKSYSFENYFEEFFENEDTNAKNHVDVMFIHSNLPKFDPYD 510

Query: 551 LKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVDET 610
           L     L   I K+P      +   +  +IELE+FK + EY+C     F YL+D   ++ 
Sbjct: 511 LSETNFLT--IDKKPARSYTALHKIQNYDIELENFKALKEYVCTNKNPFKYLDDALGEDK 568

Query: 611 NALPGMCLFIKQRLDFLQSSADDA 634
                MC +I +RL+FL+S+ D A
Sbjct: 569 VKWKKMCDYITERLEFLESTHDKA 592

>NCAS0A03650 Chr1 complement(729502..731325) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  280 bits (715), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 168/501 (33%), Positives = 251/501 (50%), Gaps = 25/501 (4%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +   V        +W  L++ NL  CL I D    NL+++H +F+E ++ L  LP ++
Sbjct: 127 CLLNSVVGYSPDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKLT-LPNDI 185

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y G GIVL+ GGK +L + +V K IR  G  +PVE+FIPP          D  + E++FC
Sbjct: 186 YQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTLPVEVFIPP----------DEVEEEAEFC 235

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
             +  E +  C                                    +L   NFP+K LD
Sbjct: 236 KTMLNEFDAKCVYISDILPESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLD 295

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            IFQ +PY  TG I WP FWRR   P  Y+I G  +N  KR+R  +D++TP +VY   +Q
Sbjct: 296 NIFQQEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQ 355

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
                +  +P HD EG +PD  T   + ++ K +++ T+LLALYY+VNGP+WYY ++ Q 
Sbjct: 356 -----EMDVPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQG 410

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTFA 491
           ++    K+     A   + PFYQVK    +DG  K ++     + L HDF QD+  Y  A
Sbjct: 411 LAGEGDKETFIAGATFYNLPFYQVKTKVGVDGYHK-EDGFRGVAMLQHDFVQDYDRYKLA 469

Query: 492 KMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKLL 551
           ++ I   Y    SN++ +D  YT +KF + Y ++      N   ++F HS+L   DP  L
Sbjct: 470 QLKIDKKY--LPSNEVLYDKDYTVQKFYDEYFNIE----GNETDVLFVHSHLPKFDPVSL 523

Query: 552 KNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVDETN 611
                LI D   + L    N+  F   +IE E+FKTM E LCE   +F Y+++ + D+  
Sbjct: 524 WKDNDLIKD--GKHLRSYTNLNKFGYYDIEYENFKTMKELLCESDTHFYYIDEAFKDKPE 581

Query: 612 ALPGMCLFIKQRLDFLQSSAD 632
                C +I  R +FL  + D
Sbjct: 582 EKADFCKYIVDRYEFLNETHD 602

>Suva_2.142 Chr2 complement(246653..248464) [1812 bp, 603 aa] {ON}
           YBR015C (REAL)
          Length = 603

 Score =  278 bits (712), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 169/506 (33%), Positives = 251/506 (49%), Gaps = 22/506 (4%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           CP+K  +  +  +  +   L+   L +CL +    +  LK  H++++E +  L  LP   
Sbjct: 113 CPLKGDIGDRPDQYKDLYKLSAKELAKCLELSPDEVSKLKKSHKDYVEHIASLI-LPKGT 171

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y G GI  +GGGK +L A ++ K +R+ G  +PVE+ IPP             + E++FC
Sbjct: 172 YKGSGIATVGGGKFSLMAFLIIKTLRNMGTTLPVEVLIPPG-----------DEGETEFC 220

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
           +KI  + N  C                                    +L   NFP+K LD
Sbjct: 221 SKILPKYNAKCIYISDILPAETIEKFVFKGYQFKSLALITSSFENLLLLDADNFPIKSLD 280

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            IF  +PY  TG + WP FWRR  HP  YDI G  +N ++R+R   DDITPP VYT    
Sbjct: 281 NIFLEEPYVSTGLVMWPDFWRRTTHPLYYDIAGIPVNKERRVRNSQDDITPPAVYT---- 336

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
           K+    +++PL D+EG +PD  T   Q +I KSK++ T LL+L+Y+VNG +WYY ++ QK
Sbjct: 337 KDLKDLDAVPLSDMEGAIPDVSTESGQLMINKSKHLATALLSLFYNVNGINWYYPIFSQK 396

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTFA 491
            +    K+    AA+    PFYQVK    ++G     +     + L HDF QD++ Y  A
Sbjct: 397 AAGEGDKETFIAAANFYGLPFYQVKTKTGVEG-YHDSDGFHGVAMLQHDFVQDYSRYLTA 455

Query: 492 KMNIKSTYD---LKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDP 548
              I + Y    +K S  I+FD  Y+ EK+   + D      ++   +MF HSNL   DP
Sbjct: 456 SKTINNKYKDLIIKSSAPIKFDKDYSLEKYIKEFFDNEDSHAKDHVDVMFIHSNLPKFDP 515

Query: 549 KLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVD 608
             L     L  D   +P     ++    K +IELE+FK +HEY+C     F YL+D    
Sbjct: 516 YDLSKSNFLTTD--NKPARSFTSLGKIHKYDIELENFKALHEYVCVNKNPFKYLDDALGQ 573

Query: 609 ETNALPGMCLFIKQRLDFLQSSADDA 634
           +      MC +I +RL FL+S+ + A
Sbjct: 574 DEKGWKKMCDYIAKRLQFLESTHEKA 599

>KLLA0E17755g Chr5 complement(1572985..1574901) [1917 bp, 638 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 638

 Score =  278 bits (711), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 177/510 (34%), Positives = 255/510 (50%), Gaps = 41/510 (8%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +   +  +    D+W  LT   LN CL +       LK  H N++ +L+ L  LP + 
Sbjct: 158 CSLNGDIGYRQENTDQWWKLTTEELNNCLQLSQEQRLMLKEAHSNYVHALSKLV-LPKDT 216

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y G GIV +GGGK ++ A ++ K +R+ G  +PVE+FIPP+ + D            +FC
Sbjct: 217 YSGDGIVTVGGGKFSMMAFLIIKTVRNFGTTLPVEVFIPPSDEGDD-----------EFC 265

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
           N +  + N  C                                    +L   NFP+KPLD
Sbjct: 266 NVLLPQYNAKCIYLSDAFPPDLIEKSDFKGYQFKSLAIIASSFKNLLLLDADNFPIKPLD 325

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            IF+ K Y +TG I WP FWRR  HPS Y I    I+  +RIR  +DD+TPP VYT    
Sbjct: 326 GIFEEKSYKDTGLILWPDFWRRTTHPSYYSIANTPIS-SERIRNTMDDVTPPSVYT---- 380

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
           K+    + +PLHDL+GT+PD  T   Q +I K K+  T+LL+LYY+V GPSWYY ++ Q+
Sbjct: 381 KDLKDLSDVPLHDLDGTIPDASTESGQLMINKLKHFPTVLLSLYYNVYGPSWYYSIFSQR 440

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVK-TKERPMFSSTLYHDFQQDFAFYTF 490
            S    K+    AAH  D PFYQV++ P +DG  +   E       L HDF QD+  Y  
Sbjct: 441 SSGEGDKETFIAAAHFYDLPFYQVRSEPRVDGYHRHNNEGFRGVCMLQHDFAQDYKRYRQ 500

Query: 491 AKMNIKSTYDLKDSNDIQFDPSYTYEK------FSNNYMDVGWEAIRNGNHLMFAHSNLF 544
           A+  I + Y   + +D  +DP Y Y++      F+N+ +DV           MF HS+L 
Sbjct: 501 AQNEIGTKY-TNEPDD--YDPKYNYQENYLGKYFTNDPVDV-----------MFVHSHLP 546

Query: 545 DGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLED 604
             DP  L   + LI D   + +    N+      ++ELE FKT  EY+C+K  +F Y E 
Sbjct: 547 KFDPVELALSQDLIQD--GKHIRSYRNLKRMNGYDLELEVFKTFKEYVCDKRVHFKYFEK 604

Query: 605 EYVDETNALPGMCLFIKQRLDFLQSSADDA 634
               E+N    +C ++ +RL +L  S  +A
Sbjct: 605 AVKLESN-WGIICNYVNERLVYLIESHSEA 633

>Ecym_5314 Chr5 complement(634571..636418) [1848 bp, 615 aa] {ON}
           similar to Ashbya gossypii AER018C
          Length = 615

 Score =  276 bits (706), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 167/504 (33%), Positives = 253/504 (50%), Gaps = 27/504 (5%)

Query: 131 NCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPIN 190
           NC + + +  +   +  W  L++ +L++CL +     + LK  H +++  L  L  LP++
Sbjct: 135 NCQLTKDIGGRLEDQKWWYKLSYEHLSKCLQVSRKDRKMLKKKHSDYVADLASLV-LPLD 193

Query: 191 MYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDF 250
            Y G GIV +GGGK ++ A ++   +R+ G  +PVE+ IPP            ++SE +F
Sbjct: 194 SYTGNGIVTVGGGKFSVLAFLMITTLRNVGTTLPVEVLIPPN-----------EESEHEF 242

Query: 251 CNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPL 310
           CN +  E N  C                                    +L   N P+K L
Sbjct: 243 CNNVLPEFNAKCIYLSDVLPKSVLTSFEVKGYQLKSFAIIASSFQNLLLLDADNLPIKNL 302

Query: 311 DTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEE 370
           D IF+ KPY  TG + WP FWRR   P  Y++ G  IN++KR+R  +DD+TP  VYTS  
Sbjct: 303 DDIFESKPYKSTGLVLWPDFWRRTTSPIYYEVAGIPINYNKRVRNSIDDVTPASVYTS-- 360

Query: 371 QKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQ 430
             N    +++P+HDLEG +PD  T   Q +I K  ++ T LL+LYY+VNGP+WYY L+ Q
Sbjct: 361 --NPYSLSTVPMHDLEGAIPDMSTESGQLMISKRTHLGTALLSLYYNVNGPTWYYPLFSQ 418

Query: 431 KISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTF 490
             S    K+    AA     PFYQV+    +DG  ++       + L HDF+QD+  YT 
Sbjct: 419 GASGEGDKETFIAAASFYQLPFYQVRTVTGVDGYHRSSGYRGV-AMLQHDFRQDYERYTH 477

Query: 491 AKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKL 550
           +K + ++ Y    +    ++ SY    F N Y   G    +    +MF HSNL   +P  
Sbjct: 478 SKEDTEAKY---AAGSAAYESSYNVNDFYNTYF--GTYNSQEPLDVMFVHSNLPKLEPLS 532

Query: 551 LKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVDET 610
           L     L++D   + +    N+      +IEL SF+T +EYLC+K   F Y E   +DE 
Sbjct: 533 LSTD--LMED--GQHIRSYSNLKRLHGYDIELRSFQTFNEYLCDKRVKFKYYEKTLIDE- 587

Query: 611 NALPGMCLFIKQRLDFLQSSADDA 634
            +   MC +IK RL FL+ + D+A
Sbjct: 588 ESWTSMCDYIKGRLSFLERTHDEA 611

>TDEL0D04330 Chr4 complement(790232..792028) [1797 bp, 598 aa] {ON}
           Anc_3.188 YBR015C
          Length = 598

 Score =  275 bits (702), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 165/501 (32%), Positives = 254/501 (50%), Gaps = 24/501 (4%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +   +  +    +EW  LT   L+QCL++ +  +  L+  H +++++L  L  LP N 
Sbjct: 111 CSLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLV-LPKNS 169

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y G+GIV +GGGK +L A +V K +R+    +PVE+FIPP+            + E+D C
Sbjct: 170 YKGQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPS-----------DEGETDLC 218

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
             +  + N  C                                     L   NFP+K LD
Sbjct: 219 ETVFSKYNAKCIFLSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLD 278

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            IF+  PY  TG + WP FWRR   P  YDI G Q++  KR+R   DD+TPP+VYT    
Sbjct: 279 HIFEQDPYHSTGLVLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYT---- 334

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
           KN    +++P HDLEG++P+  T   Q +I KSK++ TILLALYY+VNGPSWYY ++ Q+
Sbjct: 335 KNLGDLSNVPFHDLEGSIPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQR 394

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDFAFYTF 490
            S    K+    AA     P+YQ+K+   ++G  +   +     + L HD  QD+  Y  
Sbjct: 395 ASGEGDKETFLTAASFYGLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKT 454

Query: 491 AKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDP-K 549
           A+  I + Y  +    I +D SY+  +F   Y         N   +MFAHS+    +P  
Sbjct: 455 AQKAISNKYGAQ--AKISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYT 512

Query: 550 LLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVDE 609
           L KN+ L+ +    + +     ++   + ++ELE+FK ++EY+C K     YL +E +  
Sbjct: 513 LWKNQDLIWEG---KHIRSYTALSKINRYDLELENFKAINEYVCVKRTNVKYL-NENLAT 568

Query: 610 TNALPGMCLFIKQRLDFLQSS 630
           +     MC +I+ RL +LQS+
Sbjct: 569 SAEWASMCDYIRDRLAYLQST 589

>ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {ON}
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 618

 Score =  275 bits (703), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 166/505 (32%), Positives = 247/505 (48%), Gaps = 21/505 (4%)

Query: 131 NCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPIN 190
           +CP+   +  +    DEW  L  ++L  CL I    +  LK +H  +++ L  L+ LP N
Sbjct: 131 DCPLHGDIGFRPENYDEWPTLAHDSLENCLEISPEEVTMLKKNHAAYVDVLGSLR-LPKN 189

Query: 191 MYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDF 250
           +Y GKGIV +GGGK +L A +V + +R+ G  +PVE+FIPP+              E+ F
Sbjct: 190 VYKGKGIVTVGGGKFSLLALLVIRSMRELGTTLPVEVFIPPS-----------DLGENQF 238

Query: 251 CNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPL 310
           C++I  + N  C                                     L   NFP+K L
Sbjct: 239 CDEILPQYNAKCVYLSDVLPPNVIANSQFTGYQFKSLSLIASSFEDVLFLDADNFPVKRL 298

Query: 311 DTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEE 370
           + +F L PY  TGF+ WP FWRR   P  YDI    +N  KRIR   DD+TPP+VYT   
Sbjct: 299 NDVFDLAPYKTTGFVLWPDFWRRTTQPIYYDIADITVNRRKRIRNCFDDLTPPEVYT--- 355

Query: 371 QKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQ 430
            KN    + IP HD EGT+PD  T   Q +I KS ++ TILLALYY+VNGPSWYY ++ Q
Sbjct: 356 -KNTKSMDDIPFHDFEGTIPDVSTESGQLMISKSTHLPTILLALYYNVNGPSWYYPMFSQ 414

Query: 431 KISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDFAFYT 489
           + +    K+    AA+    PFYQVK    ++G  +         + L HD  QD+  Y 
Sbjct: 415 RAAGEGDKETFLAAANFYGLPFYQVKTATGVEGYHRANNEGFRGVAMLQHDLNQDYLRYQ 474

Query: 490 FAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPK 549
            A   I++ Y  K +  I++D  Y+ + F   +      A++  + +MFAHS+    DP 
Sbjct: 475 AAADAIEAKYGGKTAKSIKYDKLYSLDNFYKTFFGSENSALKECD-VMFAHSHAPKFDPY 533

Query: 550 LLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVDE 609
            L  +  L+ D   +      ++      ++EL +  ++H+++C     F YL  E +  
Sbjct: 534 GLWTQNELVQD--GKHFRSYTSLEKINNYDLELSAIDSIHKFVCLDKVNFKYLS-EKIQS 590

Query: 610 TNALPGMCLFIKQRLDFLQSSADDA 634
                 MC +I +R +FL S+   A
Sbjct: 591 KQEHQEMCDYISKRREFLLSTHQQA 615

>AER018C Chr5 complement(661035..662855) [1821 bp, 606 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR015C
           (MNN2)
          Length = 606

 Score =  268 bits (684), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 157/505 (31%), Positives = 261/505 (51%), Gaps = 28/505 (5%)

Query: 131 NCPIKRPVASKSIRE-DEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPI 189
            C + + V    + +   W  LT  +L++CL +     Q +   H +++++L+ L+ L  
Sbjct: 125 QCQVSQVVLQGHLDDTSHWPLLTREHLSKCLKMTQKDKQMVSDKHMHYVDALSNLK-LSK 183

Query: 190 NMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESD 249
             Y G GIV +GGGK ++ A ++ K +R  G  +PVE+ IPP            ++ E D
Sbjct: 184 RAYSGAGIVTVGGGKFSMLALLLIKSLRKVGTSLPVEVLIPPG-----------EEEEYD 232

Query: 250 FCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKP 309
           +C+K+  E+   C            +                       +L   N P+  
Sbjct: 233 YCSKLLPEVGAKCIYLKDVLPPAVINNHYFEGYQLKSAAIIASSFKDLLLLDADNIPILN 292

Query: 310 LDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSE 369
           LD IFQ KPY E G + WP FWRR+  P  Y+I   Q+++++R+R  +D++TP  VYT  
Sbjct: 293 LDDIFQSKPYVEHGLVLWPDFWRRSTSPDYYEIARVQVDYNRRVRNHIDNLTPASVYT-- 350

Query: 370 EQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWY 429
             +N    +SIP+HD+EGTLPDP T   Q LI K +++ T+LL+LYY+VNG +WYY L+ 
Sbjct: 351 --QNMKDLSSIPMHDMEGTLPDPSTESGQLLIDKERHLSTVLLSLYYNVNGETWYYPLFS 408

Query: 430 QKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYT 489
           Q       K+    AA+   KP+YQV+ +   +G   TK+     + L HDF++D+  Y 
Sbjct: 409 QGAPGEGDKETFIAAANFYRKPYYQVRTSTGAEG-YHTKKGFSGVAMLQHDFREDYRRYE 467

Query: 490 FAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPK 549
            A+ ++K+ Y    +   Q+DP YT E F   Y +   +  +    +MF H+NL   +P 
Sbjct: 468 AAREDVKTKY----AKSQQYDPEYTVEGFYKKYFE---DPNQPPVDVMFVHANLPKFEPL 520

Query: 550 LLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVDE 609
            +  ++LL+++ S        ++      +IELESF+ ++EYLC +     + +D+ +  
Sbjct: 521 KMSEKQLLMENGSH--FRSYSHLDKLHNYDIELESFRVLNEYLCVRKVQLKFYKDK-LSR 577

Query: 610 TNALPGMCLFIKQRLDFLQSSADDA 634
                 MC +++ RL FL+S+ ++A
Sbjct: 578 PAKWNSMCKYVEDRLKFLESTHEEA 602

>YBR015C Chr2 complement(267710..269503) [1794 bp, 597 aa] {ON}
           MNN2Alpha-1,2-mannosyltransferase, responsible for
           addition of the first alpha-1,2-linked mannose to form
           the branches on the mannan backbone of oligosaccharides,
           localizes to an early Golgi compartment
          Length = 597

 Score =  266 bits (681), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 163/504 (32%), Positives = 250/504 (49%), Gaps = 20/504 (3%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +K  +  +     +   L+   L++CL +    + +L   H++++E +  L   P   
Sbjct: 109 CLLKGDIGDRPDHYKDLYKLSAKELSKCLELSPDEVASLTKSHKDYVEHIATLVS-PKGT 167

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y G GI  +GGGK +L A ++ K +R+ G  +PVE+ IPP             + E++FC
Sbjct: 168 YKGSGIATVGGGKFSLMAFLIIKTLRNMGTTLPVEVLIPPG-----------DEGETEFC 216

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
           NKI  + N+ C                                    +L   NFP+KPLD
Sbjct: 217 NKILPKYNSKCIYVSDILPRETIEKFVFKGYQFKSLALIASSFENLLLLDADNFPIKPLD 276

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            IF  +PY  TG + WP FWRR  HP  YDI G  ++  KR+R   DDITPP VYT    
Sbjct: 277 NIFNEEPYVSTGLVMWPDFWRRTTHPLYYDIAGIAVDKKKRVRNSRDDITPPAVYT---- 332

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
           K+    + +PL DL+GT+PD  T   Q +I K+K++ T LL+L+Y+VNGP+WYY ++ QK
Sbjct: 333 KDLKDLSDVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPTWYYPIFSQK 392

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTFA 491
            +    K+    AA+     FYQV+    ++G    ++     + L HDF QD+  Y  A
Sbjct: 393 AAGEGDKETFIAAANFYGLSFYQVRTRTGVEG-YHDEDGFHGVAMLQHDFVQDYGRYLNA 451

Query: 492 KMNIKSTY-DLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKL 550
             +I + Y   K ++ I+FD +Y+ EK++  + D      +N   +MF HSN    DP  
Sbjct: 452 MESIGNKYGGTKSADAIKFDKNYSLEKYTEEFFDNEDLNAKNHVDVMFIHSNFPKFDPYD 511

Query: 551 LKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVDET 610
           L     L    + +P      +   +  +IELE+FK ++EY+C     F YL+D    + 
Sbjct: 512 LSKSNFLT--TNGKPARSYTALKKVKNYDIELENFKVLNEYVCVNKNPFKYLDDLLGQDK 569

Query: 611 NALPGMCLFIKQRLDFLQSSADDA 634
                +C +I  RL FL+S+ D A
Sbjct: 570 TEWKRVCGYITDRLAFLESTHDKA 593

>TPHA0A04380 Chr1 (982546..984474) [1929 bp, 642 aa] {ON} Anc_3.188
           YBR015C
          Length = 642

 Score =  265 bits (677), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 166/506 (32%), Positives = 251/506 (49%), Gaps = 27/506 (5%)

Query: 131 NCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPIN 190
           +C +   +  +    + W  LT   L  CL       + LK+ H NF+ S++ L  LP  
Sbjct: 154 SCILTDNIPDRPENSEHWFKLTKKALENCLEFTPDEFKMLKSTHDNFVNSISKLT-LPKQ 212

Query: 191 MYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDF 250
            Y  +GIV++GGGK ++ A ++ K +R+ G  +PVE+FIPP  + +          + DF
Sbjct: 213 GYSKQGIVMVGGGKFSMLAFLIIKTLRNLGTTLPVEVFIPPVDEAE----------KDDF 262

Query: 251 CNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPL 310
           C  +    N  C                                    +L   NFP+K L
Sbjct: 263 CKDVLPNFNAKCIFISDVLPEEQIKTFDFKGYQFKSLALISSSFEDLLLLDADNFPVKNL 322

Query: 311 DTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEE 370
           D IF  +PY   G I WP FWRR   P  Y I    +++ KR+R  +DD+TPP++YT   
Sbjct: 323 DNIFDQEPYKSKGLILWPDFWRRTTTPVYYQIADVPVDYTKRVRNSIDDLTPPEIYTEN- 381

Query: 371 QKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQ 430
                  +++PLHDL+GT+PDP T   Q LI K +++ T+LL+LYY++NGP+WYY ++ Q
Sbjct: 382 ------LDTVPLHDLQGTIPDPSTESGQLLINKKQHVPTLLLSLYYNINGPNWYYPMFTQ 435

Query: 431 KISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDFAFYT 489
           K +    K+    AA   D PFYQVK    +DG  +   +     + L HDF QD+  + 
Sbjct: 436 KAAGEGDKETFIAAAVYYDLPFYQVKTKTGVDGYHQADNKGFRGVAMLQHDFVQDYKRFL 495

Query: 490 FAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNH---LMFAHSNLFDG 546
            AK  I+S Y   +S    FD +Y+ E +  NY+       +N      +MF HSNL   
Sbjct: 496 KAKDKIQSIYKTVESR--IFDKNYSLEDYYKNYILKTNSFDKNDEGEVDIMFVHSNLPKF 553

Query: 547 DPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEY 606
           DP  L  +  LI  ++ E +     I      +IELE+FKT ++YLC +   F ++E   
Sbjct: 554 DPISLWKQNELI--VNGEHIRGYRAIEKLNNYDIELENFKTFNQYLCVEKTKFVHVEKHL 611

Query: 607 VDETNALPGMCLFIKQRLDFLQSSAD 632
            +E +    MC +IK RL++L+ + D
Sbjct: 612 ENEQDR-KSMCDYIKSRLEYLEKTHD 636

>TPHA0C04560 Chr3 (983249..984970) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score =  261 bits (668), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 171/507 (33%), Positives = 255/507 (50%), Gaps = 31/507 (6%)

Query: 131 NCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPIN 190
           NC +   V + +     W  L+  ++  CL + D+ +  LK+ H  +++SL  +    I+
Sbjct: 83  NCLLDGTVGTGNNDVKNWHRLSQKSMEGCLELSDSEINTLKSKHDAYIQSLEEIAVEKIH 142

Query: 191 MYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDF 250
            Y GKGI ++GGGK +L A +V K IR     +P+EIFIPP   +D L          +F
Sbjct: 143 -YKGKGIAIVGGGKFSLLAFLVVKTIRKFETTLPIEIFIPPQDVEDEL----------EF 191

Query: 251 CNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPL 310
           C ++  E N  C                                    ++   NFP+K L
Sbjct: 192 CQQLLPEDNAKCIYLSDILPSQDIKKYEFKRYQYKSLAILASSFDDLLLIDADNFPIKNL 251

Query: 311 DTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEE 370
           D IF  +PY  TG I WP FWRR+ +P  Y+I G +++  KR+R  +DD+TPP+VYT + 
Sbjct: 252 DGIFDNEPYTSTGLILWPDFWRRSANPKFYEITGIELDTKKRVRNAIDDLTPPEVYTEDF 311

Query: 371 QKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQ 430
            K A     +P HD  GTLPDP T   Q +I K K++ T+LLALYY+VNGPSWYY +  Q
Sbjct: 312 SKLA----DVPFHDFSGTLPDPSTESGQMMINKGKHMKTLLLALYYNVNGPSWYYPILSQ 367

Query: 431 KISPHSSKDELTIAAHILDKP-FYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDFAFY 488
             +    K E  IAA + +K  FYQVK    ++G  ++  R     + L HDF QDFA Y
Sbjct: 368 GAAGEGDK-ETVIAAALHNKAKFYQVKFKTGVEGYHQSNGRGFRGVAMLQHDFVQDFARY 426

Query: 489 TFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYM-----DVGWEAIRNGNHLMFAHSNL 543
             A   IK  Y  +     QFD  Y+ + F   Y+     D+  E  +    ++F HS+L
Sbjct: 427 EDATARIKELYSTESFK--QFDSGYSIDAFYEKYISQVNTDIPEE--KRKIDVLFVHSHL 482

Query: 544 FDGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLE 603
              DP  L   + LI+D   +      ++      +IEL++F+   +Y+C+    F Y++
Sbjct: 483 PKFDPVPLWQSQDLIED--GKHFRSYTSLKKINYFDIELQNFEIFDKYICQDTIAFPYIK 540

Query: 604 DEYVDETNALPGMCLFIKQRLDFLQSS 630
           +E  D    +P +C +IK RL +LQ +
Sbjct: 541 NEVKDAD--MPDLCNYIKNRLSYLQET 565

>TBLA0F00740 Chr6 (187874..189835) [1962 bp, 653 aa] {ON} Anc_3.188
           YBR015C
          Length = 653

 Score =  259 bits (663), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 163/510 (31%), Positives = 250/510 (49%), Gaps = 24/510 (4%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +K  V ++     EW  LT   L+ CL +   T + L+  H ++++ +  L  LP   
Sbjct: 158 CQLKGDVGTRPDNYKEWYKLTSKELSNCLEVPYETAKMLQESHADYVDKIGSLV-LPKVA 216

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y GKGIV +GGGK ++ A ++ + +R+ G  +PVE+FIPP+            + E+DFC
Sbjct: 217 YGGKGIVTVGGGKFSVLAFLIIRTLRNLGTSLPVEVFIPPS-----------DEGETDFC 265

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
           N +  + N  C                                    +L   NFP+K LD
Sbjct: 266 NNVLPQYNAKCIYMTDILPKEFVDEFEFKGYQFKSLAMIASSFDDLLMLDADNFPIKDLD 325

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            IF+ +PY  TG + WP FWRR  +P  Y I    +N  KR+R   DD+TP ++YT    
Sbjct: 326 NIFEQEPYTSTGLVMWPDFWRRTTNPVYYSIADVPVNEKKRVRNTFDDLTPVEIYT---- 381

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
           ++ +  + +P HDLEGTLPD  T   Q +I K K+I T+LLALYY+ NGP+WYY ++ QK
Sbjct: 382 EDISDLSDVPFHDLEGTLPDVSTESGQLMINKEKHIATVLLALYYNFNGPTWYYPIFSQK 441

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDFAFYTF 490
            +    K+    AA+     +YQV+ +  +DG  ++ ++     + L HDF QD+  Y  
Sbjct: 442 AAGEGDKETFIAAANFYGLSYYQVRTSVGVDGYHQSDDKGFRGVAMLQHDFVQDYERYER 501

Query: 491 AKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNG----NHLMFAHSNLFDG 546
           A+  I   Y       +++D +Y+ + F   Y D G ++  N       +MF HSNL   
Sbjct: 502 ARNEIDIKYG-GAKKVMKYDYNYSPDDFYKTYFDSGDDSNVNQPIKEVDIMFVHSNLPKF 560

Query: 547 DPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEY 606
           DP  L +   L  D S         +      ++E E+FK  H+ LC     F YLED++
Sbjct: 561 DPFTLWDENDLTLDGSH--FRSYLKLPHLTHYDLEYENFKIFHQSLCVLKNQFKYLEDKF 618

Query: 607 VDETNALPGMCLFIKQRLDFLQSSADDAKK 636
             + +    MC +I  RL +L  + + A K
Sbjct: 619 QGKESNRESMCNYIMDRLKYLTDTHEMALK 648

>Kpol_1045.70 s1045 complement(162608..164461) [1854 bp, 617 aa]
           {ON} complement(162610..164463) [1854 nt, 618 aa]
          Length = 617

 Score =  258 bits (658), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 166/511 (32%), Positives = 258/511 (50%), Gaps = 37/511 (7%)

Query: 131 NCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPIN 190
           +CP+   +  +     +W  LT +NL++CL ID+ +L  LK  H+ +++ L  L   P +
Sbjct: 133 DCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKYIDGLKELGSSP-D 191

Query: 191 MYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDF 250
           MY G GIVL+ GGK +L +++V K IR+    +P+E+FIPP  + D            + 
Sbjct: 192 MYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDD-----------EL 240

Query: 251 CNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXX-XXXXVLSPKNFPLKP 309
           CN +  + N  C            +                        +L   N+P+K 
Sbjct: 241 CNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIKN 300

Query: 310 LDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSE 369
           +D IF  +PY   G I WP +WRR+  PS YDI+ + I+ ++R+R  LDDITPP VYT E
Sbjct: 301 IDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYT-E 359

Query: 370 EQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWY 429
           + KN      IP+HD EGTLPD  T   Q +I K K++ ++LLA+YY++ GP+WYY +  
Sbjct: 360 DLKN---HKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILT 416

Query: 430 QKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVK---TKERPMFSSTLYHDFQQDFA 486
           QK S    K+     A+  + PFYQVK     DG  +    +   MF     HDF QD+ 
Sbjct: 417 QKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQ----HDFIQDYT 472

Query: 487 FYTFAKMNIKSTY--DLKDSNDIQFDP-SYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNL 543
            Y  AK  I+  Y    +D  D ++ P  +T + F + + D   +       +MF H++L
Sbjct: 473 AYENAKTFIEKKYPNTKQDKIDKEYSPFDFTDKFFEDEHADPVID-------VMFVHAHL 525

Query: 544 FDGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC-EKAYYFDYL 602
              +P  L     L+ D S       ++       ++E+E+FK + E LC EK + F YL
Sbjct: 526 PKFEPVALWEENDLMQDGSHVRSYTKYD--KLNHYDLEMENFKALEELLCLEKPFEFKYL 583

Query: 603 EDEYVDETNALPGMCLFIKQRLDFLQSSADD 633
           +D+  D+     G+C +IK R  F++ + ++
Sbjct: 584 KDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614

>KNAG0K01300 Chr11 (257271..259064) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  253 bits (645), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 161/515 (31%), Positives = 245/515 (47%), Gaps = 37/515 (7%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +   + + S    ++E L++ NL  CL + +  L  LK  H  F++SL++    P  M
Sbjct: 101 CILNEAIGTTSDNIPKFERLSYENLLDCLKLSNEELSALKLSHNFFVQSLDV--KYPKGM 158

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           Y G GIV++GGGK +L A +V K +R  G  +PVE+FIPP            ++ E++FC
Sbjct: 159 YQGDGIVMVGGGKYSLMAYLVIKHLRSSGTSLPVEVFIPPN-----------EEDETEFC 207

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
                ELN  C                                    +L   N+P++ LD
Sbjct: 208 ETALPELNAQCIFIDRILPSAMIKTFHFKGYQFKSLALVSSSFENVLLLDADNYPVRRLD 267

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            IF+ +P+  TG I WP FWRR   P  Y+I G  I+    +R   DD+TPP+VY     
Sbjct: 268 DIFKQEPFKSTGLILWPDFWRRTTTPLFYNISGVAIDLTSPVRYSFDDLTPPEVYF---- 323

Query: 372 KNATFKNS-IPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQ 430
            N+T   S IP++D  G +PD  T   Q LI K  ++ TILL+LYY+VNGP+WYY +  Q
Sbjct: 324 -NSTMDRSKIPVNDFAGAMPDVSTESGQLLINKRTHLKTILLSLYYNVNGPAWYYPIIAQ 382

Query: 431 KISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTF 490
           +      KD    AA+    P+YQVK    +DG  +  +       L +DF QD+  Y  
Sbjct: 383 RAPGEGDKDTFIAAANFYGLPWYQVKTRVGIDGYSEDGQYHGV-GMLQYDFVQDYELYQS 441

Query: 491 AKMNIKSTYDLKD-------SNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNL 543
           A+ +I + Y +          ++I +D +Y+ + F   Y +      ++G+ +MF H+N 
Sbjct: 442 ARRDITAKYGVAGPSKTGQLRSEIAYDENYSLDTFEEKYFN----KEKSGHKVMFIHANF 497

Query: 544 FDGDPKLLKNRKLLIDDISKEPLLMTW-NIAIFEKQNIELESFKTMHEYLCEKA---YYF 599
              DP  L   K  I+   +     T+ N+  F   +IEL +F +     C  A    +F
Sbjct: 498 PKFDPLSLWQDKKFIN--KQGSTYRTYNNLGKFNYWDIELYNFNSFETLFCSGADSVTWF 555

Query: 600 DYLEDEYVDETNALPGMCLFIKQRLDFLQSSADDA 634
            Y+       TN    MC +I+ RLD L+ +  +A
Sbjct: 556 PYMNRALQGNTNDRESMCSYIRMRLDHLEQTHHEA 590

>CAGL0I04532g Chr9 (404659..406497) [1839 bp, 612 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015c TTP1
           type II membrane protein
          Length = 612

 Score =  241 bits (616), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/498 (31%), Positives = 243/498 (48%), Gaps = 35/498 (7%)

Query: 148 WEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINMYYGKGIVLIGGGKNTL 207
           W+ L+++ L+ C+ I  + + +L+ +H+++++ +N L  LP   Y G+GIV +GGGK TL
Sbjct: 130 WKKLSYHQLSHCMKISPSEINHLRGNHKSYVDKINELV-LPKGSYKGEGIVTVGGGKFTL 188

Query: 208 FASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNTNCXXXXX 267
            A  + K +R  G  +PVE+FIPP             + ES FC  +  + N  C     
Sbjct: 189 MALTMIKALRTLGTTLPVEVFIPP------------DEGESTFCESVLPQYNAKCIYISD 236

Query: 268 XXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKPYPETGFISW 327
                                          +L   N P+K +D IF+ + +   G I W
Sbjct: 237 ILPDDMIQKFTFKGYQFKSLAMITSSFENLLLLDADNIPVKKIDHIFESQIFRSAGLILW 296

Query: 328 PGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSIPLHDLEG 387
           P FWRR   P+ Y+I     N +KR+R   DDITPP+VYT  +       + +P HD+EG
Sbjct: 297 PDFWRRTTMPAYYEIANLPYNQNKRVRNAFDDITPPEVYTKPDGD----LSEVPFHDMEG 352

Query: 388 TLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDELTIAAHI 447
           TLPDP T   Q LI K+K++ T+LL+LYY+VNGP+WYY ++ Q+ +    K+    AA  
Sbjct: 353 TLPDPSTESGQLLISKAKHLPTLLLSLYYNVNGPNWYYPIFSQRTAGEGDKETFISAASF 412

Query: 448 LDKPFYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDFAFY--TFAKMNIKSTYDLKDS 504
               +YQVK +  +DG  +           L HDF QD   Y   F   N K      + 
Sbjct: 413 YSLSYYQVKTSVGVDGYFRHDGSGYRGVGMLQHDFIQDSKQYMEAFEYSNTKYNNLRSEK 472

Query: 505 NDIQFDPSYTYEKFSNNYM-----DVGWEAIRNGNHLMFAHSNLFDGDPKLLKNRKLLID 559
             I +DPSY   +F + +      D G E+  +   +MF H NL   DP +  +   L+ 
Sbjct: 473 GSISYDPSYDPNEFFDKFFSRKKPDGGDESKAD---VMFVHCNLPKFDPYVSWDTNDLV- 528

Query: 560 DISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC---EKAYYFDYLEDEYVDETNALPGM 616
               +      N  +  + +IELE+FK  +E LC        F YL+++  +E    P M
Sbjct: 529 -YQTKHFRSFNNKKVIAQFDIELENFKFFNETLCPYENGKGKFKYLDNKLSEER--WPQM 585

Query: 617 CLFIKQRLDFLQSSADDA 634
           C +I +RL +L+ S ++A
Sbjct: 586 CDYISKRLQYLKESHNEA 603

>KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON} 
          Length = 640

 Score =  241 bits (614), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 151/506 (29%), Positives = 238/506 (47%), Gaps = 25/506 (4%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +   +  +     +W  LT++NL++CL + D  +  L T H++++ ++N + +    +
Sbjct: 135 CIVDTSIGGRPGDHKDWHKLTYDNLSKCLQLSDEEVDMLHTKHKSYVSAINQIVEDSKEL 194

Query: 192 YYGK-----GIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQS 246
             G+     GIV++GGGK +L + +    IR  G  +PVE+FIP   + D L   DF+  
Sbjct: 195 LNGQRTKKNGIVMVGGGKYSLLSLLSVMTIRKFGTTLPVEVFIP---RDDELKG-DFQS- 249

Query: 247 ESDFCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFP 306
              FCN++  + N  C                                    +L   N P
Sbjct: 250 ---FCNELLPQYNAKCIFTSNVLSEKLIENFHFNGYQHKSLALLASSFDNILLLDSDNHP 306

Query: 307 LKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVY 366
           +K LD+IF+ +P+ + G + WP FWRR   P  Y I G  IN + R+R  +DD+TP +VY
Sbjct: 307 IKNLDSIFKAEPFVKNGMVLWPDFWRRTTSPKFYQIAGIPINKNTRVRNCIDDLTPLEVY 366

Query: 367 TSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYI 426
            +EE         +P HD EGT PD  +   Q LI +++++ +ILLALYY+ NGP+WYY 
Sbjct: 367 NNEEIN----IYDVPFHDTEGTFPDMSSESGQLLINRNRHLKSILLALYYNYNGPAWYYS 422

Query: 427 LWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDF 485
           ++ Q  +    K+     AH    P+YQVK  P + G  +         + L HD  QD+
Sbjct: 423 IFSQGAAGEGDKETFIAGAHFYGLPYYQVKTFPSVSGYHQPGNSEFRGVAILQHDLVQDY 482

Query: 486 AFYTFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVG-WEAIRNGNHLMFAHSNLF 544
             Y  A + +  TY+  +  ++ +D +Y+   F N Y D G  E         F H+N  
Sbjct: 483 QRYQEASIGLGKTYEFPE--NVTYDENYSLGTFYNKYFDGGNNEPDVKEVDFAFVHANFP 540

Query: 545 DGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLED 604
             DP  L      I     +      ++      +IE E+F T+H+++C    YF Y+E 
Sbjct: 541 KFDPVSLAEGSSFI--FEGQHFRSFTDLTKLNGYDIEYENFVTLHDFVCVNRKYFPYIEK 598

Query: 605 EYVDETNALPGMCLFIKQRLDFLQSS 630
               E      MC +I  RL FL+ S
Sbjct: 599 SISKE--EYEKMCRYISDRLQFLRLS 622

>Kpol_1036.50 s1036 complement(135897..137927) [2031 bp, 676 aa]
           {ON} complement(135897..137927) [2031 nt, 677 aa]
          Length = 676

 Score =  241 bits (614), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 175/508 (34%), Positives = 248/508 (48%), Gaps = 28/508 (5%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C +   +  +    + W  L+   L  CL I    +  LK  H  ++  ++ L  LP N 
Sbjct: 186 CLLNGDIGDRPEFYEVWYKLSMKELGNCLEISKAEMSKLKAKHAKYIADISSLS-LPRNS 244

Query: 192 YYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFC 251
           + GKGIV++GGGK +L + ++   IR+QG  +PVE+F+P    +D+           +FC
Sbjct: 245 FRGKGIVIVGGGKFSLLSFLIINAIRNQGTTLPVEVFMPNDKGEDA-----------EFC 293

Query: 252 NKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLD 311
            K+  ELN  C                                    +L   N+P+K LD
Sbjct: 294 -KLLPELNAKCIYLSDVLPEETIDQFKFGGYQFKSIALLLSSFDDLLLLDADNYPIKNLD 352

Query: 312 TIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQ 371
            IF  +PY  TG + WP FWRR   P  Y I G  +N  KR+R  +DDITPP+VYT E  
Sbjct: 353 EIFTKEPYKSTGLVLWPDFWRRTTTPFYYKIAGITVNSKKRVRNSIDDITPPEVYT-ENM 411

Query: 372 KNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQK 431
            N     ++PLHDLEG++PD  T   Q +I KSK++ TILL+LYY+VNGP+WYY ++ QK
Sbjct: 412 GNLV---NVPLHDLEGSIPDGSTESGQLMINKSKHLATILLSLYYNVNGPNWYYPMFSQK 468

Query: 432 ISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDFAFYTF 490
            +    K+    AA     PFYQVK    +DG  +   +     + L  DF QD+  Y  
Sbjct: 469 AAGEGDKETFVAAAVFNKLPFYQVKTNTGVDGYHQADNKGFRGVAMLQFDFHQDYLRYKR 528

Query: 491 AKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGN----HLMFAHSNLFDG 546
           AK  I+  Y  +D N   +D  Y+   F   Y+ +  +  RNG      +MF HSNL   
Sbjct: 529 AKEAIE--YQYQDKNLRTYDKRYSLNDFYRKYIMINDD--RNGGTSEADVMFVHSNLPKF 584

Query: 547 DPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEY 606
           DP  L   + LI+    + +    N+      +IELE+F   +++LC K   F YLEDE 
Sbjct: 585 DPVGLWRGQDLIE--HGKHIRSFRNLQRLNNYDIELENFTIFYKHLCLKRRSFKYLEDEL 642

Query: 607 VDETNALPGMCLFIKQRLDFLQSSADDA 634
            D       MC +IK R+ FL  S   A
Sbjct: 643 GDNEEDWKDMCKYIKDRVTFLNMSHQRA 670

>NDAI0A06500 Chr1 complement(1475305..1477218) [1914 bp, 637 aa]
           {ON} Anc_3.188
          Length = 637

 Score =  238 bits (606), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 154/486 (31%), Positives = 238/486 (48%), Gaps = 28/486 (5%)

Query: 151 LTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINMYYGKGIVLIGGGKNTLFAS 210
           L+ N+L  CL I D  +  LK  HQ F  S+  L+ LP N Y   GIV++GGGK +L + 
Sbjct: 173 LSRNSLYDCLQISDQEIDMLKNYHQGFTNSIAPLE-LPKNTYQNDGIVIVGGGKYSLLSL 231

Query: 211 IVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNTNCXXXXXXXX 270
           +  K +R     +PVE++I    + D            +FC++I  + N  C        
Sbjct: 232 LAIKTLRKFNTTLPVEVYISQDEEGDL-----------EFCDEILPQYNAKCISIKNILS 280

Query: 271 XXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKPYPETGFISWPGF 330
               +                       +L   NFP+KPLD IF+ +PY     + WP F
Sbjct: 281 NDLINTFKFAGYQYKSLAVLSSSFENLLLLDADNFPIKPLDDIFKQEPYLSKRMVMWPDF 340

Query: 331 WRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSIPLHDLEGTLP 390
           WRR  HPS YDI    +N   RIR   DD+TP  VYT   +      + IP HD EGTLP
Sbjct: 341 WRRTTHPSYYDIAHIFVNKSSRIRNSYDDVTPSNVYTDYSKS----LDEIPFHDFEGTLP 396

Query: 391 DPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDELTIAAHILDK 450
           D  T   Q L+ K +++  ILLALYY+VNGP+WYY ++ Q ++    K+     A+  + 
Sbjct: 397 DLSTESGQLLLNKKEHLKAILLALYYNVNGPNWYYPIFSQGVAGEGDKETFLAGANFYNL 456

Query: 451 PFYQVKATPFLDGIVKTKERPMFS-STLYHDFQQDFAFYTFAKMNIKSTYDLKDSNDIQF 509
            +YQVK  P + G    ++      + L  DF  D+  Y+ A  +I S Y     N+I+ 
Sbjct: 457 TYYQVKTYPRVSGHFNKEDGSYRGVAILQSDFVDDYKRYSHAMDDINSKYKDLSPNEIKL 516

Query: 510 DPSYTYEKFSNNYMDV-GWEAIRNGNHLMFAHSNLFDGDPKLLKNRKLLIDDISKEPLLM 568
           D  Y  + F + Y ++ G +A      +MF H+N    DP  L++    I +   +    
Sbjct: 517 DEDYDLQNFLDKYFELEGKQA-----DVMFIHANFPKFDPVDLESGSSFIHE--GKHFRS 569

Query: 569 TWNIAIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVDETNALPGMCLFIKQRLDFLQ 628
             N+   +  ++ELE+FK ++  +C +  +F Y++D+ V+E      +C +I+ RL FL+
Sbjct: 570 FDNLKDIKYYDLELETFKILNNIICVERKHFKYIDDKGVEERGK---VCKYIEDRLKFLE 626

Query: 629 SSADDA 634
            + ++A
Sbjct: 627 ETHEEA 632

>TBLA0D03030 Chr4 complement(734007..735824) [1818 bp, 605 aa] {ON}
           Anc_1.150 YJL186W
          Length = 605

 Score =  229 bits (583), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 156/503 (31%), Positives = 232/503 (46%), Gaps = 53/503 (10%)

Query: 151 LTFNNLNQCLIIDDTTLQNLKTDHQNFLESLN----------ILQDLPINMYYGKGIVLI 200
           ++FN+L  CL I    L NLK  H NF++ L            L  +  N   G+GIV I
Sbjct: 124 VSFNSLLNCLSISRPQLDNLKYVHSNFIQLLEAKMSELTKPEFLDQIFPN---GRGIVTI 180

Query: 201 GGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNT 260
           GGGK ++ A  V K +R  G+ +PVE+ IPP  +K+          E DFCN      N 
Sbjct: 181 GGGKFSVLAMNVIKVLRKTGSTLPVEVVIPPQDEKN----------EVDFCNNFLPNYNA 230

Query: 261 NCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKPYP 320
            C                                     L   N+PLK LD +F    Y 
Sbjct: 231 KCVFFKDVLPKHYAENLRLKGYQIKVMALLISSFKEIIFLDSDNYPLKSLDHVFDADIYK 290

Query: 321 ETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYT-----SEEQKNAT 375
           E G I WP  WRR  +P  YDI    ++ ++R+R   DDI+PP  YT        +K   
Sbjct: 291 EAGLILWPDIWRRVTNPMYYDIANVSVDINQRVRYGTDDISPPNRYTIPRVHKNNEKEIE 350

Query: 376 FKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPH 435
            KN+IP HDL GT+PD  T   Q ++ K+K++DT+LLA YY+  GP+WYY L+ Q  +  
Sbjct: 351 NKNTIPFHDLLGTVPDASTESGQMIVNKAKHLDTLLLAAYYNFYGPAWYYRLFSQGTAGE 410

Query: 436 SSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTFAKMNI 495
             K+    AAH L+KP+YQVK+    DG   +K        L HDF QD+  Y+ AK  +
Sbjct: 411 GDKETFISAAHTLNKPYYQVKSKVGFDGFWDSKLGFQGIMLLQHDFIQDYEHYSKAKNQV 470

Query: 496 KSTYDLKDSNDIQFDPSYTYEK-FSNNYM---DVGWEAIRNGNHLMFAHSNLFDGDPKLL 551
              YD    +   F   Y  ++ F +N +   D+          +MF H++ F  +P +L
Sbjct: 471 IDHYD----DYYHFKSDYNLDRDFYDNLIHEKDIS---------IMFGHTSFFKYEPWVL 517

Query: 552 KNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC------EKAYYFDYLEDE 605
            + +  ID  +++ +    +I      ++EL  F  + + LC      + +  F + +D 
Sbjct: 518 YHERRYIDHETQQHVRGLRSIGRALDFDLELFCFDNLLQTLCKGNANDKSSIRFAFYKD- 576

Query: 606 YVDETNALPGMCLFIKQRLDFLQ 628
            +  T     MC ++  R+ +LQ
Sbjct: 577 -IQGTPLWDSMCEYLDNRVSYLQ 598

>SAKL0C04598g Chr3 (447448..449283) [1836 bp, 611 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 611

 Score =  218 bits (554), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 146/497 (29%), Positives = 229/497 (46%), Gaps = 35/497 (7%)

Query: 151 LTFNNLNQCLIIDDTTLQNLKTDHQNFLESLN----------ILQDLPINMYYGKGIVLI 200
           L +NNL++C  +      +L ++H  ++  L           +L  L  N    KGIV +
Sbjct: 133 LAYNNLDRCYNLSPEQFDSLHSNHAKYVSKLKKEFELGPDSPLLDKLFPNE---KGIVTV 189

Query: 201 GGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNT 260
           GGG+ +L +  + + +R++G  +PVE+ IPP             + E DFCN +   LN 
Sbjct: 190 GGGRFSLLSLTMIRVLRERGTTLPVEVVIPPA-----------DEGEDDFCNNVLPALNG 238

Query: 261 NCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKPYP 320
            C            +                        L   NF +KPLD IF+ + Y 
Sbjct: 239 TCVYFSDVLSKSTLNQVTFERYQIKGVALLLSSFKNTIFLDADNFAIKPLDNIFESEAYL 298

Query: 321 ETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSI 380
           E G + WP  WRR   P  Y++   +++  KR R   DD+TP   Y   +   A  K  +
Sbjct: 299 EHGLVLWPDLWRRVTAPVFYNVSDVELDLTKRARFIGDDVTPASKYHKPDADLAYNKAEV 358

Query: 381 PLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDE 440
           PLHDL+G +PDP +   Q ++ K ++  T+LLALYY+  GP WYY ++ Q  S    K+ 
Sbjct: 359 PLHDLDGAIPDPSSESGQMIVDKREHFQTLLLALYYNYYGPDWYYRMFSQGTSGEGDKET 418

Query: 441 LTIAAHILDKPFYQVKATPFLDGIVKTKERPMF--SSTLYHDFQQDFAFYTFAKMNIKST 498
              AAH+L KP+YQVK+     G         F  ++ L HDF QD+  +  A   ++S 
Sbjct: 419 FVAAAHVLSKPYYQVKSKLGFAGYWDEYTDGGFKGAALLQHDFVQDYGQHKKALEVVRSN 478

Query: 499 YDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKLLKNRKLLI 558
           YD       +FDP+Y  EK  + Y  +     +    +MF H++    DP  L  RK  +
Sbjct: 479 YD----EYTRFDPNYNSEK--DFYKKLMVPDGKEETDVMFVHASFHKFDPWDLYRRKTYL 532

Query: 559 DDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCE-KAYYFDYLEDEYVDETNALPGMC 617
               K       ++      ++EL +F+ + + LC  K   F YL+D+    +   PGMC
Sbjct: 533 KPDGKSQFRSYRDLKRLGGFDLELFNFEVLEDALCAGKQIGFKYLQDKVT--SQEWPGMC 590

Query: 618 LFIKQRLDFLQSSADDA 634
            ++  R+ FL+ +  +A
Sbjct: 591 EYVHDRVQFLKETHAEA 607

>KAFR0G00280 Chr7 (92838..94577) [1740 bp, 579 aa] {ON} Anc_1.150
           YJL186W
          Length = 579

 Score =  211 bits (538), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 149/522 (28%), Positives = 251/522 (48%), Gaps = 42/522 (8%)

Query: 131 NCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPIN 190
           +C + + V    +  D +E L+F+NL +C  + +   Q+L+  H ++++S+  L D   N
Sbjct: 75  SCDLPKDVGINDL--DRFEKLSFDNLQRCYHLSNEQAQDLQKAHSSYVKSIKDLIDNHSN 132

Query: 191 MYYG-----KGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQ 245
           +        KGI+ +GGG+ ++    + + +R+ G  +PVE+ IPP  + D         
Sbjct: 133 IISKDDEKKKGILTVGGGRYSVLLFTMIQKLRETGTTLPVEVLIPPQDEGDD-------- 184

Query: 246 SESDFCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNF 305
              +FCN I  + N  C                                     L   N+
Sbjct: 185 ---EFCNVILPQFNAKCIYFKDYLPPNLLDKLVLKSYQIKALGLLMTSFNQILFLDADNY 241

Query: 306 PLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKV 365
           P+K L+ IF+ + + + G I+WP  WRR   P+ Y+I     N +KR+R   DDI+P   
Sbjct: 242 PMKNLNYIFETESFQKYGLITWPDIWRRYTPPAYYNIADIDFNLEKRVRFETDDISPVSR 301

Query: 366 Y-------TSEEQKNATFKNS-IPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYS 417
           Y        ++E+K   + +S +P HDLEGT+ D  T   Q LI K K++DT+LLA YY+
Sbjct: 302 YDDIFPTLLNDERKLTEYTSSKVPFHDLEGTISDLTTESGQMLIDKKKHLDTLLLAFYYN 361

Query: 418 VNGPSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTL 477
             GPSWYY ++    S    K+    AAH L KP+YQVK+    DG    K+       +
Sbjct: 362 FYGPSWYYNMFSLGSSGEGDKETFISAAHALGKPYYQVKSKVEFDGFFHDKDGFQGLGLM 421

Query: 478 YHDFQQDFAFYTFAKMNIKSTYD--LKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNH 535
            HDF+QD+  +  A + +    D   K  +D + + S+T ++F   Y +      ++   
Sbjct: 422 QHDFEQDYQVHKNAMLEVAGNPDKYSKYESDYKLETSFT-DQFLRKYNNK-----KDLVD 475

Query: 536 LMFAHSNLFDGDPKLL--KNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC 593
           +MF H++ F  +P  L  KNR  + D+    PL     +      ++EL +F+ + + LC
Sbjct: 476 IMFVHASFFKFEPLELHSKNRYYMSDN---SPLRGFKRMDRMNNFDLELFNFQILRDNLC 532

Query: 594 E-KAYYFDYLEDEYVDETNALPGMCLFIKQRLDFLQSSADDA 634
             K   F   ED+Y  +T+    +C ++ +R+ FL+ + ++A
Sbjct: 533 STKPVAFKVYEDKY--DTDEWKSVCEYLDKRVTFLKKTHEEA 572

>NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150
          Length = 587

 Score =  211 bits (536), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 144/503 (28%), Positives = 232/503 (46%), Gaps = 40/503 (7%)

Query: 149 EYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPIN---MYYG-----KGIVLI 200
           EYL++NNLN+C  + +  L NLK  H  F+ES  IL +       +  G     +GIV +
Sbjct: 110 EYLSYNNLNECYKLSNIQLNNLKRSHSGFVES--ILSEFSTKDDKLTSGLFPNNEGIVTV 167

Query: 201 GGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNT 260
           GGGK T+    + + +R  G  +P+E+ IPP  + D            +FCN +    N 
Sbjct: 168 GGGKYTVLLMTMIEKLRQSGTTLPLEVIIPPQDEGDD-----------EFCNNVLPNYNG 216

Query: 261 NCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKPYP 320
            C                                     L   N  +K LD IF  + + 
Sbjct: 217 KCIYFKDVLPDQLSDKLVIKGFQLKPLAILLSSFKKALFLDADNLAMKDLDNIFNTQAFK 276

Query: 321 ETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSI 380
           +   I WP  WRR   P+ Y I   +++  KRIR   DD++PP  Y    + +A +  ++
Sbjct: 277 QKRLIVWPDVWRRFTAPAYYKIANIKLDLGKRIRNLNDDVSPPSRYDDNSENSAQYLENV 336

Query: 381 PLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDE 440
           P HDL+GT+PDP +   Q +I K ++  T++L+LYY++ GP WYY ++ Q  S    K+ 
Sbjct: 337 PFHDLKGTIPDPTSESGQMVIDKIEHFHTLILSLYYNLYGPPWYYRMFSQGTSGQGDKET 396

Query: 441 LTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTFAKMNIKSTYD 500
              AAH L KP+YQV       G    K        L HDF+QDF     A   I     
Sbjct: 397 FIAAAHALGKPYYQVHTKMGFKGYNDEKLGFQGVGLLQHDFEQDFKQLQLASKTINEN-- 454

Query: 501 LKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDP-KLLKNRKLLID 559
             +S   +F   Y   K + ++ D   + I     +MF H++ F  +P  L++  + + +
Sbjct: 455 --ESEYSKFKQDY---KATVDFDDSLMKPIDGPIDIMFLHASFFKYEPLDLIREHRYVKE 509

Query: 560 DISKEPLLMTWNIAIFEKQN---IELESFKTMHEYLC-EKAYYFDYLEDEYVDETNALPG 615
           D S   +      +  E+ N   +EL +FK ++++LC E+  +F Y ++  V+       
Sbjct: 510 DGSHFRVF-----SGLERLNYFDLELFNFKILNKFLCTEEMIHFKYYKN--VESKPEWSD 562

Query: 616 MCLFIKQRLDFLQSSADDAKKTI 638
           MC F+K+  ++L+S+  +A   +
Sbjct: 563 MCKFLKEHTEYLESTHKEATAQV 585

>TPHA0E03480 Chr5 complement(735664..737793) [2130 bp, 709 aa] {ON}
           Anc_1.150 YJL186W
          Length = 709

 Score =  213 bits (541), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 152/525 (28%), Positives = 241/525 (45%), Gaps = 61/525 (11%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLN--------- 182
           C IK  VAS   +E+ +  L+++NL++C  + D+  ++L+ +H+ F+  ++         
Sbjct: 128 CKIK-DVASYDKKEN-FSLLSYSNLDECFKLSDSQTKDLQVNHERFVNFIDTDIAEMDPA 185

Query: 183 ILQDLPINMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFD 242
           I + L  N    KGIV++GGGK ++ +    K IR++G+ +P+E+ IP +          
Sbjct: 186 IKEQLWPNE---KGIVIVGGGKFSIISINTIKAIRERGSTLPIEVIIPRS---------- 232

Query: 243 FKQSESDFCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSP 302
               E ++CN+     N  C                                     +  
Sbjct: 233 -SVPEEEYCNRFLPSFNAKCVYLDDTLPNEFKERLTLKKYQYKSFALLVSSFKNVLYIDA 291

Query: 303 KNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITP 362
            N PL  LD IF  K Y + G I+WP  WRR   P+ Y I     N D R+R   DD+TP
Sbjct: 292 DNIPLVNLDNIFDSKAYKDNGLITWPDIWRRVTAPAYYKIANINYNLDNRVRYMADDVTP 351

Query: 363 PKVYTSEEQKNATFK-NSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGP 421
              Y +       +K    P HD EGTLPD  +   Q ++ K  +  T+LLA YY+  GP
Sbjct: 352 TSYYDNIVNPGNNYKLRRTPFHDFEGTLPDLTSESGQLMVNKETHFRTLLLAFYYNYYGP 411

Query: 422 SWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDF 481
            WYY ++ Q  S    K+    AAH L +P+YQVK+T   DG    K+          DF
Sbjct: 412 RWYYTIFSQGTSGEGDKETFLAAAHALGEPYYQVKSTIEFDGYFDHKDGFQGIGLYQKDF 471

Query: 482 QQDFAFYTFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWE-AIRN--GNHL-- 536
            +D+  Y  AK  ++     KD    +++P+Y +        D  +E A+ N  GN +  
Sbjct: 472 NKDYENYLAAKAKVE-----KDKKYGEYNPNYDF--------DADFEKALMNPPGNEVEA 518

Query: 537 MFAHSNLFDGDP-KLLKNRKLLIDD-----ISKEPLLMTWNIAIFEKQNIELESFKTMHE 590
           MF H +    DP  L KN++ ++        SK   L  W        ++ELE+ + MH 
Sbjct: 519 MFIHVSFHKFDPHNLAKNKRYILQGKQYRVFSKFKNLRNW--------DLELEANRNMHF 570

Query: 591 YLC-EKAYYFDYLEDEYVDETNALPGMCLFIKQRLDFLQSSADDA 634
           YLC + A  F + +D  +   ++   MC ++ +R+++L S+ D A
Sbjct: 571 YLCTDNAVEFIFYKD--LQGKDSWKDMCNYLSERVEYLASTHDAA 613

>KLTH0F03938g Chr6 (351536..353224) [1689 bp, 562 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 562

 Score =  207 bits (526), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 139/508 (27%), Positives = 224/508 (44%), Gaps = 36/508 (7%)

Query: 144 REDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNIL----QDLPI--NMY-YGKG 196
           R D  + + + NL++C        + L+  H  FL  L        D P+   ++   +G
Sbjct: 78  RGDAVDAMLYENLDRCYRPTKAQFEGLQAPHSAFLTQLRTTFAYEADSPVFERLFPRERG 137

Query: 197 IVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISK 256
            V +GGG+ +L A  + + +R +G+++P E+ IPP   +D+         E  FCN++  
Sbjct: 138 FVTVGGGRFSLLAYSMLRALRARGSKLPAEVVIPP---QDA-------AGEEHFCNEVLP 187

Query: 257 ELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQL 316
           ELN  C                                     +   +FP++ LD++F  
Sbjct: 188 ELNARCVFFEDALPRALVETWDFERYQIKAVALLLSSFKKIVFIDADDFPIQNLDSLFDS 247

Query: 317 KPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATF 376
           +   E G + WP  WRRA  P  Y +    ++  +R+R   D+++P   YT  +Q     
Sbjct: 248 EVLREHGLVLWPDLWRRATAPVFYRLANIDVDLRRRVRNMGDNLSPASRYTDPDQDPEQL 307

Query: 377 KNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHS 436
           +   P HD  GT+PDP T   Q +I K ++  T+LLALYY+V GP WYY L+ Q  +   
Sbjct: 308 QKIAPFHDFAGTVPDPTTESGQMVIDKVRHFQTLLLALYYNVYGPEWYYSLFSQGTAGEG 367

Query: 437 SKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLY-HDFQQDFAFYTFAKMNI 495
            K+    AAH+L  PFYQVK     DG             LY HD  +D+  Y  A+  I
Sbjct: 368 DKETFATAAHVLGLPFYQVKNKLAFDGYFHPNGDGFRGVALYQHDCVEDYLLYCRARDII 427

Query: 496 KSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNH----LMFAHSNLFDGDPKLL 551
           K   D   +    +DP   + K            +    H    +MFAH++    DP  L
Sbjct: 428 KENQDSFSAYKPDYDPEPDFYK----------SLMAPEGHPEIPVMFAHASFHKFDPWQL 477

Query: 552 KNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC-EKAYYFDYLEDEYVDET 610
            + K+ +D+          NI      +IEL  F+ + + +C +    F YLED+++   
Sbjct: 478 YHEKVYLDNDGAH-FRSFHNIKRIGNFDIELFVFEGLQKAICSDNPIRFKYLEDKFIHAD 536

Query: 611 NALPGMCLFIKQRLDFLQSSADDAKKTI 638
              P +C +++ R+ +LQ + D A   +
Sbjct: 537 --WPKVCQYVEDRVKYLQDTHDPAVGLV 562

>Kwal_33.13693 s33 (354321..355997) [1677 bp, 558 aa] {ON} YJL186W
           (MNN5) - putative Golgi alpha-1,2-mannosyltransferase
           [contig 114] FULL
          Length = 558

 Score =  204 bits (520), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 141/498 (28%), Positives = 226/498 (45%), Gaps = 39/498 (7%)

Query: 152 TFNNLNQCLIIDDTTLQNLKTDHQNFLESL----------NILQDLPINMYYGKGIVLIG 201
            + NL+ C        + L+  H  +L +L           +  +L  N    KG V +G
Sbjct: 85  VYENLDACFRPSKAQFEGLQAPHTAYLAALRSTFNYQNEPGVFNELFPN---DKGFVTVG 141

Query: 202 GGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNTN 261
           GG+ +L +  + + +R++G+ +P+E+ IPP  +K           E  FC +I  +LN  
Sbjct: 142 GGRFSLLSYTMIRTMRERGSTLPIEVVIPPQDEK----------GEEHFCQEILPKLNGR 191

Query: 262 CXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKPYPE 321
           C                                     +   + PLK LD +F+ K + +
Sbjct: 192 CVFFGDTLPPSIVEDWKFKSYQIKVMALLLSSFKKIVFIDADDLPLKNLDDVFESKVFKK 251

Query: 322 TGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSIP 381
            G + WP  WRR   P  Y +     +  KR+R   DDI+P   Y +    NA  +  IP
Sbjct: 252 NGLVLWPDLWRRMTAPVFYRLANIDTDLTKRVRNLGDDISPVSRYLN---PNAKEQKPIP 308

Query: 382 LHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDEL 441
            HD  GT+PDP T   Q +I K ++  T+LLALYY+V GP WYY L+ Q  +    K+  
Sbjct: 309 FHDFAGTIPDPTTESGQMVIDKVRHFQTLLLALYYNVYGPDWYYALFSQGTAGEGDKETF 368

Query: 442 TIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLY-HDFQQDFAFYTFAKMNIKSTYD 500
             AAH+L+ P+YQV+     DG    K+       LY HD  QD+  Y  A+  +KS  D
Sbjct: 369 ASAAHVLELPYYQVRTKLSFDGYSDPKDGGFRGVALYQHDCTQDYETYEQARELVKSQPD 428

Query: 501 LKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDP-KLLKNRKLLID 559
              +    F   Y  E   + Y  +     +    +MFAH++    DP +L K +  L +
Sbjct: 429 KYSA----FKEDYDSE--PDFYQSLMKPEGKPEVEVMFAHASFHKFDPWQLFKEKVYLNE 482

Query: 560 DISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC-EKAYYFDYLEDEYVDETNALPGMCL 618
           D ++        +   +  +IEL +F+ + E +C E+   F Y ED++  E    P +C 
Sbjct: 483 DGTQ--FRSFRRLHRIKHFDIELFNFEVLEEAMCSEQPIRFRYFEDKFKREE--WPKVCQ 538

Query: 619 FIKQRLDFLQSSADDAKK 636
           ++K R+++L+ + D+A K
Sbjct: 539 YVKDRVEYLKKTHDEAVK 556

>Skud_10.31 Chr10 (54975..56735) [1761 bp, 586 aa] {ON} YJL186W
           (REAL)
          Length = 586

 Score =  203 bits (516), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 152/530 (28%), Positives = 230/530 (43%), Gaps = 57/530 (10%)

Query: 131 NCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPIN 190
            C     VA+ +   D    L++ +LN+C  ++ T  + L   H  F + L+      +N
Sbjct: 83  GCTFAGNVAAHTSERDS--ELSYESLNKCYRLNTTVQEGLTAMHNKFTDILSG----KLN 136

Query: 191 MYYGK---------GIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNF 241
             + +         GIV IGGGK ++ A  + K +R+ G  +P+E+ IPP  + D     
Sbjct: 137 FSFAQREALFPESEGIVTIGGGKYSVLAYTMIKKLRETGTTLPIEVIIPPQDEGDD---- 192

Query: 242 DFKQSESDFCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLS 301
                  DFC     + N  C                                     + 
Sbjct: 193 -------DFCKNWLPKHNGKCIYFSDIVPAKSLRDLELTHFQLKVFGLIISNFKRIIFID 245

Query: 302 PKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDIT 361
             N+ +K LD  F    + +TG I WP FWRR   P  Y+I+G  IN  KR+R   DD++
Sbjct: 246 ADNYAVKNLDLAFNTTSFEDTGLILWPDFWRRVTPPVFYNIIGSTINTGKRVRFVSDDVS 305

Query: 362 P----------PKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTIL 411
           P           K Y  EE +N  F   +PLHD++GT+PD  T   Q +I K ++  T+L
Sbjct: 306 PVSRYDPFVSDSKDYNPEEIQNH-FLRHVPLHDMDGTMPDLTTESGQMVIDKIRHFHTLL 364

Query: 412 LALYYSVNGPSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERP 471
           LALYY+V GP+WYY +  Q  +    K+    AAH L+ P+YQVK     DG    K+  
Sbjct: 365 LALYYNVYGPTWYYKMLSQGTAGEGDKETFIAAAHALNVPYYQVKTKFEFDGFYYKKDDF 424

Query: 472 MFSSTLYHDFQQDFAFYTFAKMNIKSTYDLKDSNDIQFDPSYTYEK-FSNNYM--DVGWE 528
              + L HDF+QD+  Y  A+  +K+          + +P YT +K F  N M  D G +
Sbjct: 425 KGLALLQHDFEQDYRHYQTAQQKVKANI----GEFSKLNPEYTLDKGFLKNLMLNDDGSD 480

Query: 529 AIRNGNHLMFAHSNLFDGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTM 588
                  +MF H++ +  DP  L + K  I    K+  L  +        + EL  F  M
Sbjct: 481 L-----DIMFIHASFYKADPWNLYHEKRFIGPDGKQ--LRGFKKLGRYGMDFELFLFDDM 533

Query: 589 HEYLC----EKAYYFDYLEDEYVDETNALPGMCLFIKQRLDFLQSSADDA 634
            +  C     +   F Y ED+    T     MC ++   +D+L+ +  DA
Sbjct: 534 KKSFCTTPKNQVLRFKYFEDKIT--TPEWDAMCKYLADHVDYLERTHKDA 581

>YJL186W Chr10 (80155..81915) [1761 bp, 586 aa] {ON}
           MNN5Alpha-1,2-mannosyltransferase, responsible for
           addition of the second alpha-1,2-linked mannose of the
           branches on the mannan backbone of oligosaccharides,
           localizes to an early Golgi compartment
          Length = 586

 Score =  202 bits (514), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 146/529 (27%), Positives = 234/529 (44%), Gaps = 55/529 (10%)

Query: 131 NCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPI- 189
            C     VA+     D    L++ +L++C  ++ T  ++L+  H  F ++L+   +  I 
Sbjct: 83  GCSFANNVAAHDSGHDS--DLSYESLSKCYNLNKTVQESLREVHSKFTDTLSGKLNFSIP 140

Query: 190 ---NMYYG-KGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQ 245
               ++ G +GIV IGGGK ++ A  + K +RD G  +P+E+ IPP             +
Sbjct: 141 QREALFSGSEGIVTIGGGKYSVLAYTMIKKLRDTGTTLPIEVIIPPQ-----------DE 189

Query: 246 SESDFCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNF 305
            E DFC     + N  C                                     L   N+
Sbjct: 190 GEDDFCKNWLPKFNGKCIYFSDIVPSKPLSDLKLTHFQLKVFGLIISSFKRIIFLDADNY 249

Query: 306 PLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKV 365
            +K LD  F    + +TG I WP FWRR   P+ Y+I+G  IN  KR+R   DDI+P   
Sbjct: 250 AVKNLDLAFNTTSFNDTGLILWPDFWRRVTPPAFYNIIGSSINIGKRVRFVSDDISPVSR 309

Query: 366 Y---------TSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYY 416
           Y          + +++   F   +PLHDL+GT+PD  +   Q +I K ++ +T+LLALYY
Sbjct: 310 YDPFVSNSNDYTPKERQEHFLKHVPLHDLDGTMPDLSSESGQMVIDKIRHFNTLLLALYY 369

Query: 417 SVNGPSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSST 476
           +V GP+WYY +  Q  +    KD    AAH L+ P+YQV+     DG    K+     + 
Sbjct: 370 NVYGPTWYYKMISQGTAGEGDKDTFVAAAHALNMPYYQVRTNFEFDGFFYQKDDYKGLAL 429

Query: 477 LYHDFQQDFAFYTFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHL 536
           L HDF+QD+  Y  A+  +K+  +       + DP YT +   N ++        +G+ L
Sbjct: 430 LQHDFEQDYKQYQKAQQKVKANIEEFS----KLDPDYTLD---NGFLKT-LMVNDDGSDL 481

Query: 537 --MFAHSNLFDGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEK-----QNIELESFKTMH 589
             MF H++ +  DP  L +    I    ++       +  F K      + EL  F  M 
Sbjct: 482 DIMFIHASFYKADPWTLYHENRFIGPNGEQ-------VRGFRKPHRYGMDFELFLFNDMR 534

Query: 590 EYLC----EKAYYFDYLEDEYVDETNALPGMCLFIKQRLDFLQSSADDA 634
              C     +   F Y  D+    T     MC ++   +++L+S+  +A
Sbjct: 535 GSFCTTPKSQVIKFKYFTDKV--NTPEWDAMCEYLTNHVNYLESTHKEA 581

>Smik_10.46 Chr10 (78173..79933) [1761 bp, 586 aa] {ON} YJL186W
           (REAL)
          Length = 586

 Score =  198 bits (503), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 146/505 (28%), Positives = 225/505 (44%), Gaps = 47/505 (9%)

Query: 151 LTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINMYYG-----KGIVLIGGGKN 205
           L++ +L++C  +D T  +NL   H  F + L+   +  I          +GIV IGGGK 
Sbjct: 101 LSYESLSKCYRLDSTVQENLVEMHNQFTDVLSGRLNFSIPQREALFPESEGIVTIGGGKY 160

Query: 206 TLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNTNCXXX 265
           ++ A  + K +R  G  +P+E+ IPP  + D            +FCN      N  C   
Sbjct: 161 SVLAYTMIKNLRKTGTTLPIEVIIPPQDEGDD-----------EFCNNWLPNFNGRCLYF 209

Query: 266 XXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKPYPETGFI 325
                                             +   N+ +K LD  F    + +TG I
Sbjct: 210 SDIVPPKPLGDLKLTHFQLKVFGLLISNFKRIIFMDADNYAVKNLDLAFNATSFQDTGLI 269

Query: 326 SWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITP----------PKVYTSEEQKNAT 375
            WP +WRR   P+ Y+I+G  IN  KR+R   DDI+P           + YTSEE ++  
Sbjct: 270 LWPDYWRRVTPPAFYNIIGSSINTGKRVRFISDDISPVSRYDSFISNSEDYTSEEMQDH- 328

Query: 376 FKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPH 435
           F   +PLHDL+GT+ D  +   Q +I K ++  T+LLALYY+V GP+WYY +  Q  +  
Sbjct: 329 FLRHVPLHDLDGTMSDLTSESGQMVIDKIRHFHTLLLALYYNVYGPTWYYNIISQGTAGE 388

Query: 436 SSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTFAKMNI 495
             KD    AAH L+  +YQVK     DG    K      + L HDF+QD+  Y  A+  +
Sbjct: 389 GDKDTFIAAAHALNASYYQVKTKFEFDGFFYKKNDYKGIALLQHDFEQDYKQYQKAQQKV 448

Query: 496 KSTYDLKDSNDIQFDPSYTYEK-FSNNYMDVGWEAIRNGNHL--MFAHSNLFDGDPKLLK 552
           K+  D++  +  + DP YT +K F  + M        +G  L  MF H++ +  DP  L 
Sbjct: 449 KA--DVEKFS--KLDPDYTLDKGFLKSLM-----LNEDGTDLDIMFIHASFYKADPWTLY 499

Query: 553 NRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC----EKAYYFDYLEDEYVD 608
                 D   K+  L  +        + E+  F+ M E  C     +   F Y  D+   
Sbjct: 500 RENRFTDPDGKQ--LRGFRKPYRYAMDFEMFLFRDMKESFCTPPKNQVIKFKYFNDKL-- 555

Query: 609 ETNALPGMCLFIKQRLDFLQSSADD 633
            T     MC ++   LD+L+++ ++
Sbjct: 556 NTPEWDKMCQYLTNHLDYLEATHNE 580

>KNAG0C00900 Chr3 (167471..169342) [1872 bp, 623 aa] {ON} Anc_1.150
           YJL186W
          Length = 623

 Score =  197 bits (500), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 142/506 (28%), Positives = 231/506 (45%), Gaps = 38/506 (7%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINM 191
           C ++ P+ +     ++ E +++++L+ C+ + D  L++L   H  F+ ++  +    +  
Sbjct: 144 CKLRDPMFASDGEREKLEAVSYDSLDGCMHVPDQYLESLTKMHTKFVGTIKSISSSTVRQ 203

Query: 192 YYGK--GIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESD 249
            Y +  GIV +GGG+ ++  + +   +R     +PVEIFIP    +D+         ++ 
Sbjct: 204 LYPEDSGIVAVGGGRYSVLLATMLPKLRKNCTSLPVEIFIP---DEDA-------AGDAS 253

Query: 250 FCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKP 309
           FC   +   N  C                                     L   N+ +K 
Sbjct: 254 FCQVFAPRYNAKCIYAKAIVGKIDI---KLERFQYKPVAILLSSFKNVLFLDADNYVMKN 310

Query: 310 LDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSE 369
           +D IF  + Y +TG I WP  W+R   PS Y I G   +  KR+R   D+I+P   YTS 
Sbjct: 311 IDKIFSAESYHDTGLIIWPDIWKRCTSPSFYKIAGINFDLTKRVRWGGDEISPVSRYTSA 370

Query: 370 EQKNATF-KNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILW 428
           EQ +  + K  +P HDL+G +PD  +   Q LI K K++DT+LLALYY+V G  WY+ L 
Sbjct: 371 EQNSPEYLKTKVPFHDLDGPMPDSSSESGQLLINKVKHMDTLLLALYYNVYGKQWYFPLA 430

Query: 429 YQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFY 488
            Q+      K+    AA+ L KP YQVK      G    +   +    L HDF+QD+  Y
Sbjct: 431 SQRGPGEGDKESYISAAYALKKPVYQVKTPLEFSGYFTDEFNGV--GLLQHDFEQDYQLY 488

Query: 489 TFAKMNIKSTYDLKDSNDIQ---FDPSYTY-EKFSNNYMDVGWEAIRNGNHLMFAHSNLF 544
                  K   +L  +N I+   +DP YTY   F   +  VG  A    + +MF H++ F
Sbjct: 489 -------KKAEELVAANQIRYGFYDPEYTYSSSFLKEFFHVGESA---HSDVMFIHASFF 538

Query: 545 DGDP-KLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC-EKAYYFDYL 602
             DP +L +N +            +   I     ++ ELE F+ M E  C +K   + YL
Sbjct: 539 KFDPWELSQNERFTYRGKQVRGFSLRDRI---NGEDFELEVFELMKEAFCIDKTVKYGYL 595

Query: 603 EDEYVDETNALPGMCLFIKQRLDFLQ 628
           E ++  + +     C +I + + FL+
Sbjct: 596 EKKFKSKED-WEKACSYIDKHIVFLK 620

>NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa]
           {ON} Anc_1.150
          Length = 586

 Score =  194 bits (494), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 154/519 (29%), Positives = 239/519 (46%), Gaps = 45/519 (8%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQD----- 186
           C     ++      D  E L+  NL++C  +    L NLK  H  +++++    D     
Sbjct: 89  CKWSGDISVNDDGRDANERLSMENLDECFKLSSIQLNNLKRAHSGYVKNIRDKFDDKNER 148

Query: 187 -----LPINMYYGKGIVLIGGGKNT-LFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSN 240
                 P N+    GIV IGGG+ T L  +++AK +RD G  +P+E+ IPP  + D    
Sbjct: 149 LTNSLFPNNV----GIVTIGGGRYTVLLMTMIAK-LRDTGTSLPIEVIIPPEDEGDD--- 200

Query: 241 FDFKQSESDFCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVL 300
                   DFCN I  + N  C                                     L
Sbjct: 201 --------DFCNVILPKWNGKCVFFKDVLPDELNKKLMLQSYQIKPLAVLLSSFKKILFL 252

Query: 301 SPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDI 360
              N+ +K LD IF+ +P+ E G I WP +WRR   P+ Y I    I+  KRIR   DDI
Sbjct: 253 DADNYAMKDLDHIFESEPFIENGLIVWPDYWRRVTPPAYYKIADINISKKKRIRNINDDI 312

Query: 361 TPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNG 420
           TPP  Y ++ +        +P+HDLEGT+PDP +   Q +I K K+  T+LL+LYY++ G
Sbjct: 313 TPPSYYDNKLKDRDHLLKEVPMHDLEGTIPDPTSESGQMVIDKVKHFHTLLLSLYYNLYG 372

Query: 421 PSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKE-RPMFSSTLYH 479
           PSWYY ++ Q  S    K+    AAH L+KP+YQV  +  L G     E R +    L  
Sbjct: 373 PSWYYQIFSQGTSGQGDKETFIAAAHALNKPYYQVTTSLGLKGFFYENEFRGI--GLLQR 430

Query: 480 DFQQDFAFYTFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHL--M 537
           DFQQD+A +   K  I+    L++ ++ + D     ++F+   M        NG  L  M
Sbjct: 431 DFQQDYAQHQLVKQTIQD--HLEEYSEFKEDYKVA-DEFNKKLM-----IPPNGQPLDVM 482

Query: 538 FAHSNLFDGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCE--K 595
           F H++ +  +P  L N +  ++         + ++  F   ++EL +FK + + LC   K
Sbjct: 483 FVHASFYKYEPWDLYNERRYVNSDGTHFRGFS-DLKEFNYFDMELFNFKILRDTLCSPNK 541

Query: 596 AYYFDYLEDEYVDETNALPGMCLFIKQRLDFLQSSADDA 634
              F +  D+    +     MC ++K  ++FLQ +  +A
Sbjct: 542 KVEFKFYNDKVF--SPEWDNMCTYLKDHVNFLQETHSEA 578

>AEL148W Chr5 (351089..352810) [1722 bp, 573 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL186W (MNN5)
          Length = 573

 Score =  191 bits (486), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 131/494 (26%), Positives = 223/494 (45%), Gaps = 39/494 (7%)

Query: 152 TFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLPINMYYG---------KGIVLIGG 202
           +++ L +C  ++   L+ L+  H  FL +++   +L I+              GIV +GG
Sbjct: 101 SYDGLAKCFRLERDHLEGLRQGHSEFLRTIH--GELAISAKSALFKTLYPLPAGIVTVGG 158

Query: 203 GKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNTNC 262
           G+ ++ A ++ + +R +G  +PVE+F+            D    +  FC+ I +  N  C
Sbjct: 159 GRYSILAMVMIRALRKRGTTLPVEVFLT-----------DDDADDEAFCSYI-EHFNAKC 206

Query: 263 XXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKPYPET 322
                                                +   N PLKPLD +F+ KP  E 
Sbjct: 207 VLFSDRLPKSVLASQKLSGFELKAVALLLSSYQQVIFIDADNVPLKPLDDVFKSKPLAEY 266

Query: 323 GFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATF-KNSIP 381
           G + WP  W+R   P+ YDI G  ++F +R+R   DD++PP  YT   + + +F +  +P
Sbjct: 267 GLVLWPDIWKRVTAPAFYDIAGIPVDFKRRVRFSADDVSPPSRYTKPGEVDESFNRAHVP 326

Query: 382 LHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDEL 441
           LHD  GT+P+  +   Q LI K++++DT+LL LYY+V+G   +Y L  Q  S    K+  
Sbjct: 327 LHDFAGTMPELSSESGQLLIDKARHMDTLLLILYYNVHGKHLFYRLSTQGTSGEGDKETF 386

Query: 442 TIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTFAKMNIKSTYDL 501
            +AA  L KP+YQVK      G   T  + + ++ L HDF QD   +  A+  +      
Sbjct: 387 AMAAQALGKPYYQVKTKLRFQG-YHTPSQYVGAALLQHDFVQDHEQWLRAREEVAR---- 441

Query: 502 KDSNDIQFDPSYTY-EKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKLLKNRKLLIDD 560
           + S    ++P+Y   E F N  M            +MF H++     P  L   K+ I +
Sbjct: 442 RPSELAAYNPAYNVDEHFYNTLMRP-----EKPLDVMFVHASYHKLVPIDLFREKVYIGE 496

Query: 561 ISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKA--YYFDYLEDEYVDETNALPGMCL 618
             K+      ++A  +  +IEL + + ++E +C       F Y  D+ +        MC 
Sbjct: 497 DGKQ-FRSFPDLAAMDNFDIELFAIQILNEAICSATTKIEFKYNRDK-IKSPEEFEDMCT 554

Query: 619 FIKQRLDFLQSSAD 632
           +++ R+  L  + D
Sbjct: 555 YVRDRMRMLLDTRD 568

>Kpol_2002.57 s2002 (129140..130957) [1818 bp, 605 aa] {ON}
           (129140..130957) [1818 nt, 606 aa]
          Length = 605

 Score =  192 bits (487), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 147/524 (28%), Positives = 221/524 (42%), Gaps = 53/524 (10%)

Query: 138 VASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLE----SLNILQDLPINMYY 193
           +AS S +ED     ++ +L+ C  +  +   +L   H+ F E    S  +      +M+ 
Sbjct: 113 IASYSSKEDHL-LTSYESLSNCYNLTQSQYDDLHNSHELFTEHVEKSFQLSNSAAKSMWP 171

Query: 194 G-KGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCN 252
             KGIV IGGGK +++   + K +R +G  +PVEI +P    +D            +FC+
Sbjct: 172 NDKGIVAIGGGKFSVYILSMIKTLRAKGTHLPVEILMPLASPEDK-----------EFCD 220

Query: 253 KISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVL--SPKNFPLKPL 310
           K    LN  C                                    V+     N  LK L
Sbjct: 221 KFLPPLNAKCVYFKDVLPKEFTGKYPIKISRFQYKVFSILFSSFRNVMYIDSDNLALKSL 280

Query: 311 DTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEE 370
           D +F    Y E G I WP  WRR   P  Y + G   N +KR+R  +DD++P   Y + E
Sbjct: 281 DKVFDTVAYRENGLILWPDIWRRVTAPIYYSVAGVPYNLEKRVRNMVDDLSPVSRYDNVE 340

Query: 371 QKNATFKNS-IPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWY 429
                ++   +P HD EGTLPD  T   Q ++ K ++  T+LLA YY+  GP WYY ++ 
Sbjct: 341 NPGNDYRTRKVPFHDFEGTLPDLTTESGQLVVDKVRHFKTLLLATYYNFYGPDWYYRIFS 400

Query: 430 QKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYT 489
           Q  +    K+    AAH    P+YQVK     DG    KE         HDF QD+  Y 
Sbjct: 401 QGGAGEGDKETFIAAAHKFGLPYYQVKTNLKFDGYNDAKEGFRGIGLYQHDFDQDYKQYQ 460

Query: 490 FAKMNIKSTYDLKDSNDIQFDPSYTYEK-FSNNYMDVGWEAIRNGNHL--MFAHSNLFDG 546
            AK  +   Y    +   Q+DP Y+ EK F    M        NG  +  MF H + +  
Sbjct: 461 AAKSYVSRNY----AKLSQYDPEYSSEKSFEKELMKPS-----NGKDIDAMFVHVSFYKF 511

Query: 547 DPKLLKNRKLLIDD------ISKEPLLMTWNIAIFEKQNIELESFKTMHEYLCEKAYYFD 600
           DP +L   K  + D        +  LL  W        ++EL++F    +  C      +
Sbjct: 512 DPFVLAKEKRYMRDGKHFRGFGRFELLKGW--------DLELDTFTLFRDTFCSD----N 559

Query: 601 YLEDEYVDETNALP---GMCLFIKQRLDFLQSSADDAKKTIDAR 641
            +E  Y     + P    MC ++  R+ FL+ + ++A K  D +
Sbjct: 560 VIEFSYYKPKMSQPEWKDMCNYLSSRVAFLEETHEEAVKPKDKK 603

>KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 607

 Score =  191 bits (484), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 135/503 (26%), Positives = 232/503 (46%), Gaps = 33/503 (6%)

Query: 149 EYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQDLP--INMYYG--KGIVLIGGGK 204
           E L+++NL +CL + ++   +LK  H+ F++ L+ +      +   Y   +GIV +GG +
Sbjct: 113 ERLSYDNLAKCLQLPESNYNSLKNGHEKFVKYLSTVDTSASQLEQIYATKRGIVTVGGRR 172

Query: 205 NTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNTNCXX 264
            +L + ++   +R  G+++P+E+ IPP             + E++FC  I  + N  C  
Sbjct: 173 YSLLSYLMINMVRRSGSKLPIEVVIPPD-----------DEPETEFCESIL-QFNARCIY 220

Query: 265 XXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKPYPETGF 324
                                             ++   N PLK +D +F    + + G 
Sbjct: 221 FKDRLPTSLLANLSVKSYQVKGIALLLSSFQEFVLIDSDNMPLKNIDEVFDYNVFRDHGM 280

Query: 325 ISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSIPLHD 384
           + WP  WRR   P  Y +    I+F KR+R   D+++P   Y   E   +  K  +P+HD
Sbjct: 281 VIWPDIWRRMTSPQFYQLAEVPIDFTKRVRNAGDELSPVSRYDKLENTVSENKAKVPMHD 340

Query: 385 LEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDELTIA 444
             GTLPDP T   Q ++ K  ++  +LLALYY+  GP +YY L+ Q  S    K+   +A
Sbjct: 341 FLGTLPDPTTESGQMIVNKKTHLKMLLLALYYNQYGPEYYYQLFSQGTSGQGDKETFAMA 400

Query: 445 AHILDKPFYQVKATPFLDGIVKTKE-RPMF--SSTLYHDFQQDFAFYTFAKMNIKSTYDL 501
           AHIL +PFYQVK T      +  +E +  F  +  L HD +QD+ ++   K  I+   + 
Sbjct: 401 AHILKEPFYQVKKTFGFAAYMDPREGKSEFQGAGLLQHDPEQDYRYWNILKTEIEGQQEK 460

Query: 502 KDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKLLKNRKLLIDDI 561
             +    FD  Y  +K   + M +G    +   HL F H++    DP  L N K L+   
Sbjct: 461 YGT----FDEDYHIKKTFYDKM-LGKVGDQPREHL-FLHASYHKYDPWNLYNEKNLMHSD 514

Query: 562 SKEPLLMTWNIAIFEKQNIELESFKTMHEYLCE----KAYYFDYLEDEYVDETNALPGMC 617
            K+      +   F+  ++EL  ++ +++ +C     K  Y D L+    ++T+    +C
Sbjct: 515 GKQFRAYPCSSTAFKGFDVELFLWEIVNKIVCSENPVKMAYIDKLK----EDTDKFKAVC 570

Query: 618 LFIKQRLDFLQSSADDAKKTIDA 640
            F K R++ L  + D+    + A
Sbjct: 571 QFTKDRVNHLNETHDEYVSYMGA 593

>TBLA0J01190 Chr10 complement(267291..269141) [1851 bp, 616 aa] {ON}
           Anc_1.150 YJL186W
          Length = 616

 Score =  189 bits (480), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 188/401 (46%), Gaps = 22/401 (5%)

Query: 194 GKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNK 253
           G+GIV +GGGK +L A ++ K +R++G  +PVE+ IPP+ ++           ++  CN 
Sbjct: 164 GRGIVTVGGGKYSLLAYLMIKLLREKGTTLPVEVVIPPSDKE--------MYDDTWLCND 215

Query: 254 ISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTI 313
           +   LN  C                                     L   NFPLK LD +
Sbjct: 216 VLPTLNAKCIYFTDRLPAEILQDLDIHGFQYKSLAIWISSFKKTLFLDSDNFPLKDLDNV 275

Query: 314 FQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKN 373
           F    + E G I WP  WRR I P  YDI   + +  KR+R   DD++   +Y  ++   
Sbjct: 276 FDTPAFEEVGLIFWPDLWRRTIPPDFYDISNIKYDLKKRVRYVQDDLSSVPLY-DKDNSV 334

Query: 374 ATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKIS 433
             ++ +IP HDL+GT+ DP T   Q L+ K  + +T+LL+++++  G + YY ++ Q  +
Sbjct: 335 KDYEYNIPFHDLDGTISDPSTETGQMLVDKETHFETLLLSIFFNYFGFAIYYDMFSQAGA 394

Query: 434 PHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFYTFAKM 493
               KD    AAH+L +P+YQVK  P  DG           + L HDF QD+  Y  A++
Sbjct: 395 GIGDKDTFIAAAHVLGQPYYQVKTPPEFDGFWHPTMGFQGLALLQHDFNQDYKNYQVARI 454

Query: 494 NIKSTYDLKDSNDIQFDPSYTYEK-FSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKLLK 552
             K   D K  N I     Y  +K F  + MD+      N   +MFAH +L   +P  L 
Sbjct: 455 EAKGD-DAKYENYIT---DYNLKKHFEEDMMDI------NNIDVMFAHYSLHKAEPMSLL 504

Query: 553 NRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC 593
             +L  D   K PL   +    +   N+E   F T+HE+LC
Sbjct: 505 EGQLYFDQNGK-PLKGLYKNDKY-GMNLEYYIFNTLHEFLC 543

>Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON}
           YJL186W (REAL)
          Length = 586

 Score =  187 bits (474), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 147/519 (28%), Positives = 226/519 (43%), Gaps = 43/519 (8%)

Query: 131 NCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESL--NILQDLP 188
            C     VA+     D+   L++ +L++C  ++ T L NL   H  F + L   +   +P
Sbjct: 83  GCEFADNVAAHDTTHDD--NLSYESLSRCYKLNRTLLANLAEMHNEFTDILLGKLNYSIP 140

Query: 189 INMYY---GKGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQ 245
                    +GIV IGGGK ++ A  + K +R+ G  +P+E+ IPP  + D         
Sbjct: 141 QREALFPESEGIVTIGGGKYSVLAHTMIKKLRETGTTLPIEVIIPPQDEGDD-------- 192

Query: 246 SESDFCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNF 305
              DFC       N  C                                     +   N+
Sbjct: 193 ---DFCKNWLPRQNGKCLYFSDIVPSKPLRDLELTHFQLKVFGLIISNFKRIIFIDADNY 249

Query: 306 PLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITP--- 362
           P+  LD +F    + +TG I WP  WRR   P+ Y+I+G  IN  KR+R   DD++P   
Sbjct: 250 PVTNLDLVFNTTSFQDTGLIMWPDLWRRVTPPAFYNIIGSTINTSKRVRFVSDDVSPVSR 309

Query: 363 -------PKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALY 415
                   K YTSEE ++  F   +PLHD++G +PD  +   Q +I K ++  T+LLALY
Sbjct: 310 YDPFVSKSKEYTSEEMQDH-FLRHVPLHDMDGAMPDLTSESGQMVIDKVRHFHTLLLALY 368

Query: 416 YSVNGPSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSS 475
           Y+V GP+WYY +  Q  +    K+    AAH L+ P+YQVK     DG    +      +
Sbjct: 369 YNVYGPTWYYKMLSQGTAGEGDKETFIAAAHALNAPYYQVKTKFEFDGFFYKEGDYKGLA 428

Query: 476 TLYHDFQQDFAFYTFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNH 535
            L H+F+QD+  Y  AK  +K+  D     D+ +     + K S    D G +       
Sbjct: 429 LLQHNFEQDYKQYQKAKKKVKANIDQFSQLDVDYSLDGGFLK-SLMLNDDGSDL-----D 482

Query: 536 LMFAHSNLFDGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC-- 593
           +MF H++ +  DP  L +    I    ++  L  +        + EL  F  M E  C  
Sbjct: 483 IMFIHASYYKADPWNLYHENRFIGPDGEQ--LRGFRKPQRYAMDFELFLFDDMKESFCTP 540

Query: 594 --EKAYYFDYLEDEYVDETNALPGMCLFIKQRLDFLQSS 630
             +K   F Y ED+    T     MC ++   +D+LQS+
Sbjct: 541 AKDKVIKFKYFEDKI--NTPDWDKMCKYLADHVDYLQST 577

>ZYRO0D17160g Chr4 complement(1417469..1419208) [1740 bp, 579 aa]
           {ON} similar to uniprot|P46982 Saccharomyces cerevisiae
           YJL186W MNN5 Alpha-1 2-mannosyltransferase responsible
           for addition of the second alpha-1 2-linked mannose of
           the branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 579

 Score =  183 bits (465), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 130/494 (26%), Positives = 219/494 (44%), Gaps = 31/494 (6%)

Query: 147 EWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNILQ----DLPINMYYGKGIVLIGG 202
           ++E  ++ NL+ C  + D  L  L + H+ F+E++N  +    D+        GIV IGG
Sbjct: 106 DFEKSSYENLDACFHLSDDRLGMLASKHEKFVEAINSWKFSKSDIDKLFPNESGIVTIGG 165

Query: 203 GKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNTNC 262
            K ++ +  + + +RD+G+++PVE+ IPP  + D            D+CN +  +L   C
Sbjct: 166 SKYSVISLTMLETLRDRGSKLPVEVMIPPGDEGDE-----------DYCNVVLPKLGAKC 214

Query: 263 XXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKPYPET 322
                                                +     PLKPLD +F    Y + 
Sbjct: 215 VYMAEKLPPDVVKNVKIERYQNKIVGLLLSSFKNVVYIDADCLPLKPLDDVFNSPAYKKH 274

Query: 323 GFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYT-SEEQKNATFKNSIP 381
           G I WP  W+R   P+ Y +    ++  KR+R   DD++P   Y  S E         +P
Sbjct: 275 GLILWPDIWKRVTAPAFYKLANIPLDLKKRVRFGADDVSPLSRYEPSSEASEVRMLKKVP 334

Query: 382 LHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDEL 441
            HDLEGT+ DP T   Q LI K  ++ ++LL+ YY+++G  WYY +  Q  S    K+ L
Sbjct: 335 FHDLEGTMSDPTTESGQMLINKVDHLRSLLLSAYYNIHG-KWYYKMLSQGTSGEGDKETL 393

Query: 442 TIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLY-HDFQQDFAFYTFAKMNIKSTYD 500
             AAH L  P+YQVK     DG   +        +LY  DFQQD+  Y  A   ++    
Sbjct: 394 IAAAHALKLPYYQVKTDVRFDGF--SDHEGFHGISLYQQDFQQDYEAYKKAIRWVRRHKS 451

Query: 501 LKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKLLKNRKLLIDD 560
              + +  +D     ++F    +  G + + +    +F H +    +P  L  + + ID+
Sbjct: 452 ELSAYEQNYD---VKKQFYEKLLKPGDKEVES----LFGHISYHKFEPIELAEKSIYIDE 504

Query: 561 ISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC-EKAYYFDYLEDEYVDETNALPGMCLF 619
             K          +    ++E+ +F+ + +YLC E    F Y +D    +T     MC +
Sbjct: 505 KGKH-FRGFRRKEVIRHFDLEMFNFEVLEKYLCKENPVKFVYYKDRM--DTPEWERMCNY 561

Query: 620 IKQRLDFLQSSADD 633
           +K  + +LQ + ++
Sbjct: 562 LKSHVSYLQDTHEE 575

>Ecym_8128 Chr8 complement(266920..268698) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii AEL148W
          Length = 592

 Score =  176 bits (447), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 146/516 (28%), Positives = 221/516 (42%), Gaps = 38/516 (7%)

Query: 138 VASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLNI-----LQDLPINMY 192
           V+  S    + EYL++    +C    + +   LK  H  F++ +N       +    N  
Sbjct: 100 VSFGSTDPTDGEYLSYAARRKCFRPSEVSTAELKKSHLGFIKHINRHLTVDTKSALFNEL 159

Query: 193 YGK--GIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDF 250
           + K  GIV +GGGK ++ A  + + +R+ G ++PVE+ IP     D             F
Sbjct: 160 FPKEAGIVTVGGGKYSILALTMLRALREHGTKLPVEVLIPEGDIGDI-----------HF 208

Query: 251 CNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPL 310
           C  I K  N  C                                    ++   N P+KPL
Sbjct: 209 CRAIRK-WNAECILLPKALPNTVSKLHDFKSYETKLAALLLSSFKDVILIDADNIPIKPL 267

Query: 311 DTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEE 370
           D +F+ +PY ETG I WP  WRR   P  Y+I    I+F  RIR   DD++PP  Y + +
Sbjct: 268 DDVFESEPYKETGLILWPDIWRRQTAPVFYEIADIDIDFRNRIRNSYDDLSPPSRYKNPD 327

Query: 371 QKNATFKN--SIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILW 428
             N    N   +PLHDL G +PD  +   Q L+ K K++ T+LLALYY+  G  W+Y + 
Sbjct: 328 VPNDAKYNMAHVPLHDLAGAIPDLSSESGQLLVNKGKHLSTLLLALYYNYYGEQWFYQMS 387

Query: 429 YQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKTKERPMFSSTLYHDFQQDFAFY 488
               S    K+    AAH L KP+YQVK     DG             L HDF QD+A  
Sbjct: 388 SLGTSGQGDKETFIFAAHALKKPYYQVKNPLLFDGYFGDDGSFKGVGLLQHDFTQDYA-- 445

Query: 489 TFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVGWEAIRN----GNHLMFAHSNLF 544
                N K   +    N        TY    N   D   E + +    G  +MF H++  
Sbjct: 446 -----NWKKAKEYMTENIAHLG---TYNSDYNVNQDFKDEMLHHKDFDGVDIMFIHASFH 497

Query: 545 DGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFKTMHEYLC-EKAYYFDYLE 603
              P  L   K+ +D   K+      N+      ++EL +F+ + +Y+C + A  F+Y  
Sbjct: 498 KLIPWDLYREKIYLDKSGKQ-FRSFKNLKNINYFDVELFAFEGLQKYICSDDAIKFEYHT 556

Query: 604 DEYVDETNALPGMCLFIKQRLDFLQSSADDAKKTID 639
            + V  T +   MC +I  R+  L+ + ++A  + D
Sbjct: 557 LQ-VTSTESFNAMCAYIDDRVKMLRETHEEAISSND 591

>CAGL0M02871g Chr13 (324009..325811) [1803 bp, 600 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186w MNN5
           or uniprot|P38069 Saccharomyces cerevisiae YBR015c TTP1
          Length = 600

 Score =  171 bits (433), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 139/522 (26%), Positives = 222/522 (42%), Gaps = 51/522 (9%)

Query: 131 NCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESL-NILQDLPI 189
           +CP K  V+S  I  D++ + +  NL  CL +DD  ++ L   H  ++++L N   +  I
Sbjct: 95  SCPKKGDVSSGGI--DQFHWTSAKNLKACLNLDDYAIKTLSEAHSRYMKTLFNDKGEFAI 152

Query: 190 N------MYYG-KGIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFD 242
           +      +Y   KGIV +GGG+ T+ A ++ + +R  G+ +PVE+  PP           
Sbjct: 153 SKSDFKKLYPNEKGIVTLGGGRYTILAMLMIETVRRHGSTLPVEVMFPPE---------- 202

Query: 243 FKQSESDFCNKISKELNTNCXXXXXXXXXXXXHX---XXXXXXXXXXXXXXXXXXXXXXV 299
             + E DFCN    + N  C                                        
Sbjct: 203 -DEGEFDFCNNWLPKHNGRCVMMSQEVPFEILQKDKEVRFKSYQIKSLALLLTSFKQFVF 261

Query: 300 LSPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDD 359
           +   N  +K +D IF  + +   G I WP  W+R  +P  YDI G + +  KR+R   DD
Sbjct: 262 IDADNNAMKNIDHIFDTEAFKTHGLILWPDLWKRFTNPGFYDIAGVKYDLGKRVRNVNDD 321

Query: 360 ITPPK-------VYTSEEQKN-----ATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNI 407
            +PP+       +YT+ + K            + L DL+GT+ D  T   Q ++   K++
Sbjct: 322 ASPPETYDPNHSIYTTHDLKQREEIAKHLYEDVSLADLDGTIADTTTESGQMMVDNKKHL 381

Query: 408 DTILLALYYSVNGPSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDGIVKT 467
            T+LLALYY++ GP  YY +     +    K+    AAH+L  P+YQVK     DG V  
Sbjct: 382 STLLLALYYNIYGPDLYYYMMSMGTAGEGDKETFISAAHVLHLPYYQVKTNIGFDGYVND 441

Query: 468 KERPMFSSTLYH-DFQQDFAFYTFAKMNIKSTYDLKDSNDIQFDPSYTYEKFSNNYMDVG 526
            +       L   DF+QD   Y   K  +K     K    +++       +  N++ D  
Sbjct: 442 VDNQFKGVGLMQTDFEQD---YQRHKQVLKELATEKPLEPVKY-------QLPNHFQDKM 491

Query: 527 WEAIRNGNHLMFAHSNLFDGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNIELESFK 586
                    +MF H++    DP  L   K      + E +     I  ++  + EL SFK
Sbjct: 492 KNPDGTSLDIMFLHASFHKFDPADLAKSKQYFKQ-NGEQVRGYNRIDAYKNFDFELFSFK 550

Query: 587 TMHEYLCEKAYY-FDYLEDEYVDETNALPGMCLFIKQRLDFL 627
            +++ LC   +  F  L+    + T     MC + KQR+DFL
Sbjct: 551 KLYDNLCTSDHISFKSLKKH--EGTEFWTSMCSYFKQRVDFL 590

>TDEL0C03020 Chr3 (537820..539802) [1983 bp, 660 aa] {ON} 
          Length = 660

 Score =  172 bits (435), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 147/551 (26%), Positives = 236/551 (42%), Gaps = 92/551 (16%)

Query: 149 EYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLN--ILQDLPINMYYGKGIVLIGGGKNT 206
           E ++ + L +C+ I       LK  H++FL  L   I+   PI+MY G GIV +GGG+ T
Sbjct: 127 EKVSKSELLKCIQITPDAEDELKNLHKSFLSVLEKKIMPKYPISMYRGDGIVFVGGGRFT 186

Query: 207 LFASIVAKFIR-DQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELN----TN 261
           +F     + IR + G +IP+EI IPP               ES FC  I   ++    T 
Sbjct: 187 MFVMPAIQAIRANAGRDIPIEIMIPPG-----------NNHESGFCENILPLVDPSGLTR 235

Query: 262 CXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKPYPE 321
           C                                    +L   N+ +  +D+ F  +   +
Sbjct: 236 CVFMETLFDSKTM--KNVKGYQLKALALLASSFRKTLLLDADNYVVNSIDSFFDSEIIED 293

Query: 322 TGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSIP 381
            G   WP +W+R  HP+ YDI+G  ++  +R R  +D ++P ++Y S++       + +P
Sbjct: 294 YGMALWPDYWKRLHHPAVYDIVGSHVDSSRRARFIMDTVSPSQLYQSDD------ISKVP 347

Query: 382 LHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDEL 441
            HDL+GT+PD  T   Q L+ K K++DTI+L+LYY+ NGPS+YY L  Q ++    KD  
Sbjct: 348 FHDLDGTIPDGGTESGQLLVDKYKHLDTIILSLYYNYNGPSYYYPLLGQGLAGEGDKDTF 407

Query: 442 TIA-----AHILDKPFYQVKA--------------TPFLDGIVKTKERPMFS--STLYHD 480
            +A     AH L + FYQ++A               P LD     +++  F   + L HD
Sbjct: 408 ALAARALSAHGLQRYFYQLRAPVGALGYWAHPKDNVPILDDEHVPEDQRSFRGVAMLQHD 467

Query: 481 FQQDFAFYTFAKMNIKS--TYDLKDSNDIQFDPSYTYEKFSNNYMDVG---WEAIRNGNH 535
              DF  Y  A   IKS    DLK      F    T    S +  +V    W+  R   +
Sbjct: 468 LDLDFKAYKKAYTEIKSKLVQDLK-----TFRKKATLSDASADLANVDELFWKERRKDGY 522

Query: 536 -------------LMFAHSNL-------FDGDPKLLKNRKLLIDDISKEPLLMTWNIAIF 575
                        + F HS+        F  D + + + K ++ D   +P     +   F
Sbjct: 523 DVNEFLSYFSDVPVTFIHSHFPKYNPWEFAQDQEFIFDGKKVMSDHKDDPNFKPTHHGHF 582

Query: 576 ----------EKQNIELESFKTMHEYLCEKAYY--FDYLEDEYVDETNALPG---MCLFI 620
                        ++EL ++ +  E++C +  +  F YL +E     + L     MC +I
Sbjct: 583 RMYDHTFQKLSNYDLELANWLSFKEHICREDGHTNFSYLAEEIEKTEHGLQRYEEMCKYI 642

Query: 621 KQRLDFLQSSA 631
            +R+  L+S+ 
Sbjct: 643 DERVKMLKSTT 653

>ZYRO0F13244g Chr6 (1084412..1086406) [1995 bp, 664 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 664

 Score =  164 bits (416), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 166/571 (29%), Positives = 245/571 (42%), Gaps = 116/571 (20%)

Query: 146 DEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESL--NILQDLPINMYYGKGIVLIGGG 203
           D++  +T   L +C+     T + LK  H  FL++L  +IL + P ++Y GKGIV++GGG
Sbjct: 119 DKFSKVTKEQLLKCIDFPQETFEQLKDSHTTFLDTLTNDILDEYPTDLYGGKGIVIVGGG 178

Query: 204 KNTLFASIVAKFIRDQGN-EIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELN--- 259
           K TL+A    K +R  G+  IP+E+ IPP               E  FC  +  EL+   
Sbjct: 179 KYTLYAMPAIKAVRTNGDPTIPIELMIPPE-----------NDGEDAFCENVLPELDPSG 227

Query: 260 -TNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKP 318
            T C                                    +L   N+ +  +  IF+L  
Sbjct: 228 LTRCIYMNQVFDEQTL--KDVKGYQLKALALLASSFEKVLLLDADNYVVNSIRDIFELDV 285

Query: 319 YPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKN 378
           + E G I WP +WRR  HP  YDI+G  +N +KR+R  +DD++P ++Y  ++Q      +
Sbjct: 286 FKEFGLILWPDYWRRLHHPRLYDIVGISVNENKRVRYSMDDVSPTELYEEKDQ------S 339

Query: 379 SIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSK 438
            IP HD EG +PD  T   Q L+ KSK++ TI+L+LYY+ NGPS YY L  Q  +    K
Sbjct: 340 KIPFHDFEGAIPDGGTESGQLLVDKSKHLGTIILSLYYNYNGPSQYYPLLGQGFAGEGDK 399

Query: 439 DELTIAAHILDK-----PFYQVKA--------------TPFLDGIVKTKERPMFSSTLYH 479
           D   +AA  L +      ++QVK               TPF  G+   +      + L H
Sbjct: 400 DTFALAATALTQRGIVSAYHQVKTPVGTSGYWANSKDETPFEKGLPDAQRSYRGVAMLQH 459

Query: 480 DFQQDFAFYTFAKMNIKSTYDLKDSNDIQF---------------DPSYTYEKFSNNYMD 524
           D   DF  Y      + + +DL DS D  F               D S + EK +N    
Sbjct: 460 DLLGDFEAY------MNAIHDLSDSYDEDFKIYYHRRLGQRPLEEDNSESREKVAN---- 509

Query: 525 VGWE-AIRNG---NH-----------------LMFAHSNLFDGDPKLLK--------NRK 555
             WE  IR     +H                 ++F HS+L   +P LL          ++
Sbjct: 510 --WEKKIREDFWKSHKVDYDLKSFLQHFKDVPVLFVHSHLPKYNPWLLSQFGDLKYDGKR 567

Query: 556 LL---IDD----ISKEPLLMTWNIAIFEKQN--IELESFKTMHEYLC--EKAY-YFDYLE 603
           +L    DD     S+      +     EK N  +EL +F TM +++C  E  Y  F YL 
Sbjct: 568 VLEKHADDPNFKPSRHGHYRMYGDEFKEKINYDLELANFITMRDHICAVEDGYKNFSYLS 627

Query: 604 DEYVDETNALP---GMCLFIKQRLDFLQSSA 631
            E   E         MC +I +R+D L  + 
Sbjct: 628 KEVNQEDKGFEKYRAMCDYIAERVDMLSDTT 658

>CAGL0L08096g Chr12 complement(886827..888521) [1695 bp, 564 aa]
           {ON} some similarities with uniprot|P46982 Saccharomyces
           cerevisiae YJL186w or uniprot|P38069 Saccharomyces
           cerevisiae YBR015c
          Length = 564

 Score =  150 bits (378), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 91/340 (26%), Positives = 156/340 (45%), Gaps = 27/340 (7%)

Query: 132 CPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNF---LESL-----NI 183
           C +  P++ +   +D  + L++  L+ C  +  T   NLKT H  +   +E+L       
Sbjct: 85  CTLVAPISVEETSDDTLKQLSYMTLDYCFHLSPTQTNNLKTAHNGYCRRVETLFGSLDEY 144

Query: 184 LQDLPINMYYGKGIVLIGGGKNTLFASIVAKF--IRDQGNEIPVEIFIPPTPQKDSLSNF 241
           L+D  +  Y  KGIV +GG + TL  S++A    +R  G+ +P+E+  PP          
Sbjct: 145 LRDSLMPRY--KGIVTLGGNERTL--SLLASIPRLRKMGSTLPIEVIFPP---------- 190

Query: 242 DFKQSESDFCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLS 301
            +  +E  FC+      N  C                                     + 
Sbjct: 191 -YVSNEDKFCDDFLPRYNGKCIYMSKALPEYVLKAHKFDEKMIRMFTPLVSTFKSILYME 249

Query: 302 PKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDIT 361
             +F    +D  F  K + +TG + WPG  RR+  P+ Y I+ ++I+ + R R   DD++
Sbjct: 250 SNDFANTNVDKAFDSKSFTDTGLVLWPGRSRRSTSPAFYQIVNRKIDLNNRTRNLADDVS 309

Query: 362 PPKVYTSEEQKNATFK--NSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVN 419
            P  YTS+  +N  F      P+HDL+G +PD VT    ++I K K+  T++LA+YY+V+
Sbjct: 310 RPTRYTSQALENIQFNLLAHTPMHDLDGAIPDAVTHVGHYMIDKQKHFKTLMLAMYYAVH 369

Query: 420 GPSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATP 459
           G  W+ +++  +      ++ +  AAH L+  +YQV   P
Sbjct: 370 GEMWFDMMFAPEKGSSGYRENIVAAAHALELSYYQVHLIP 409

>SAKL0C08888g Chr3 (814687..816726) [2040 bp, 679 aa] {ON} weakly
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 679

 Score =  141 bits (356), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 103/379 (27%), Positives = 173/379 (45%), Gaps = 50/379 (13%)

Query: 151 LTFNNLNQCLIIDDTTLQNLKTDHQNFL-----ESLNILQDLPINMYYGKGIVLIGGGKN 205
           LT   L++C+ +   T+ +LK  H  F      E L     L    Y G+GIV++GGG+ 
Sbjct: 134 LTKLELSKCINVPADTVSHLKDLHLKFQKLIKDEILPAASRLSKPAYEGEGIVILGGGQK 193

Query: 206 TLFASIVAKFIRDQG-----NEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELN- 259
           TL A      IR  G     N  PVE+ IPP             ++E+ FC  +  +L+ 
Sbjct: 194 TLLALPAINAIRTSGGVTIRNTTPVELVIPPR-----------YKNETAFCQHLLPQLDP 242

Query: 260 ---TNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQL 316
              T C                                    +L   ++ +  LD  F  
Sbjct: 243 TGLTRCVLLSDLYDGEALEHLEDQQLKPLALLVSSFQKAL--LLDCDSYVVNSLDGYFDG 300

Query: 317 KPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATF 376
           + + + G + WP  WRR  HP+ Y+++  +++ + + R  +D +TP +V+  E       
Sbjct: 301 EIFRDKGLVLWPDAWRRLHHPALYEVLNIKVDENNQPRNSIDIVTPREVFQVEN------ 354

Query: 377 KNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHS 436
           K S+P HDLE T+PD  T   Q LI K K++DT+++++YY+ NGPS+YY+L  Q  + + 
Sbjct: 355 KLSVPYHDLEHTIPDGSTDTGQLLIDKDKHLDTLIMSVYYNFNGPSYYYLLLEQGCNVNG 414

Query: 437 SKDELTIAAHIL---DKPFYQVKATPFLDGIV-------------KTKERPMFSSTLYHD 480
            K+  T AAH +   D  +Y V+    + G               K++ R + +  L HD
Sbjct: 415 DKNTYTAAAHAMHPNDGSYYHVRTPIGMQGHWVDEDGARLADPNQKSQTRRVVAG-LQHD 473

Query: 481 FQQDFAFYTFAKMNIKSTY 499
           + +D+ +Y +++  I + +
Sbjct: 474 YNEDYKYYKWSREVIGNNF 492

>KLLA0F24574g Chr6 complement(2285387..2287522) [2136 bp, 711 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 711

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 113/383 (29%), Positives = 168/383 (43%), Gaps = 55/383 (14%)

Query: 151 LTFNNLNQCLIIDDTTLQNLKTDHQNF-----------LESLNILQDLPINMYYGKGIVL 199
           LT +NL +CL I D  ++ +K  H NF            + LN  +D P+  Y G+GI +
Sbjct: 161 LTKDNLLKCLPISDEDVKEVKEAHNNFKKLLQDKLMPNFKKLNTEKD-PV--YKGEGISI 217

Query: 200 IGGGKNTLFASIVAKFIR-DQG----NEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKI 254
           +GGGK TL A  V K IR + G    + +P+EI IPP+       N D K  E +    I
Sbjct: 218 VGGGKYTLMALPVIKSIRMNSGLTLKSSVPIEIVIPPS------DNADRKVCE-NIIPTI 270

Query: 255 SKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIF 314
                T C                                    +L   N+ +  L   F
Sbjct: 271 DPSGLTKCVYLSEFFDSEIL--KDITGYQLKSLSLLISSFEKVLLLDADNYVINSLGNFF 328

Query: 315 QLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNA 374
               + ETG I WP +WRR   P  YDI+  ++  DK  R   D IT  +++   +    
Sbjct: 329 DGDIFRETGLILWPDYWRRVHSPKLYDIVDIKVQ-DKLARYSTDYITNSRLFPESDPAK- 386

Query: 375 TFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISP 434
                IP HDLEG +PD  T   Q L+ K+ ++D ++L+LYY+ NGPS+YY L  Q IS 
Sbjct: 387 -----IPFHDLEGAIPDGSTESGQLLVNKASHLDALILSLYYNYNGPSYYYRLLGQGISG 441

Query: 435 HSSKDELTIAAHILDKPFYQVKATP-------------------FLDGIVKTKERPMFSS 475
              KD   +AA +L   +YQV+ TP                    +D     +++    +
Sbjct: 442 EGDKDTFILAATVLKHRYYQVR-TPVRPQGYWGKIENEVRIQDDLVDDTPSNEKKYRGIA 500

Query: 476 TLYHDFQQDFAFYTFAKMNIKST 498
            + HD+ +D  F + A+  I+ +
Sbjct: 501 MIQHDYNEDRTFDSIARDAIRGS 523

>Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {ON}
           similar to Ashbya gossypii AEL082W
          Length = 670

 Score =  134 bits (336), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 104/356 (29%), Positives = 150/356 (42%), Gaps = 48/356 (13%)

Query: 131 NCPIKRPVASKSIREDEWEYL---TFNNLNQCLIIDDTTLQNLKTDHQNF--------LE 179
           NC  +R     SI E + E L   T   L++CL + D     +   H  F        ++
Sbjct: 99  NCQHRRV----SIDEGKHEVLLQLTEAELSKCLHVSDDIKSKMMASHLQFKEYVQGTLMK 154

Query: 180 SLNILQDLPINMYYGKGIVLIGGGKNTLFASIVAKFIRDQGN-----EIPVEIFIPPTPQ 234
           SL  L+  P   Y G G++++ GG++TL A    K IR  G       +P++I IP   Q
Sbjct: 155 SLANLESYP---YKGDGVIIMAGGEHTLSAMASIKAIRQNGGIIMRRSVPIQIVIPSKKQ 211

Query: 235 KDSLSNFDFKQSESDFCNKISKELN----TNCXXXXXXXXXXXXHXXXXXXXXXXXXXXX 290
            D +           FC K+   L+    + C            +               
Sbjct: 212 DDEV-----------FCTKVLPMLDPTGLSTCLFFEDIFDSDVLNKIESSQYKSLALIVS 260

Query: 291 XXXXXXXXVLSPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFD 350
                   +L    F +  +D  F      E G I WP +WRR  HP  Y I+G  ++ D
Sbjct: 261 SFRRVL--LLDSDTFVVNSIDGYFHHSQLKENGMILWPDYWRRLHHPDLYKIVGINVHAD 318

Query: 351 KRIRMFLDDITPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTI 410
            R+R  +DD +P  +Y S +  +       P HD E  +PD  T+    LI K  ++DTI
Sbjct: 319 TRLRFSVDDSSPKVLYESPKGDSP-----FPFHDSENAIPDGSTASGPLLIDKQIHLDTI 373

Query: 411 LLALYYSVNGPSWYYILWYQKISPHSSKDELTIAAHIL--DKP-FYQVKATPFLDG 463
           +++LYYS NGPS YY L          KD   +AAH L  D P +YQVK     +G
Sbjct: 374 IMSLYYSFNGPSLYYPLLGCDQGSECEKDTFALAAHALYPDTPKYYQVKTPSAHEG 429

>AEL082W Chr5 (474072..476117) [2046 bp, 681 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR015C (MNN2)
          Length = 681

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 136/586 (23%), Positives = 226/586 (38%), Gaps = 109/586 (18%)

Query: 131 NCPIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNLKTDHQNFLESLN-----ILQ 185
           +C ++R  A+    E ++  LT + L  C+ +      + K  H   ++ +       L 
Sbjct: 113 DCLLERVRATD---ERKFGSLTASKLQGCVDLSGDAFAHAKEQHALMMKVIQKSLPEHLS 169

Query: 186 DLPINMYYGKGIVLIGGGKNTLFASIVAKFIRDQG-----NEIPVEIFIPPTPQKDSLSN 240
           DL    Y   GIV++GGG  T+ A    + IR+       N +P+E+ IP    ++ +  
Sbjct: 170 DLDHYPYISDGIVILGGGHKTIAAIPAIRSIRENSGITVRNSMPIEVVIPGPADEEKV-- 227

Query: 241 FDFKQSESDFCNKISKELNTNCXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVL 300
                    FC+KI   L+ +                                     VL
Sbjct: 228 ---------FCSKILPVLDPSGLTRCVHLGDTISSSLLSKVKPSDHRTLALLASSFSRVL 278

Query: 301 SPKNFP--LKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLD 358
              +    +  +D  F  + + E G + WP +WRR  HP  Y++ G +++  +R R  +D
Sbjct: 279 YLDSSVQVINAIDGYFHHELFNERGLVLWPDYWRRLHHPKLYELAGSKVDTGRRERYSID 338

Query: 359 DITPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSV 418
             +P ++Y  ++          P+HD + ++PD  +S    LI K K+  T+ LALYY+V
Sbjct: 339 KGSPIELYGGKD-------GEWPMHDCKDSIPDASSSSGVLLIDKKKHFKTLALALYYNV 391

Query: 419 NGPSWYYILWYQKISPHSSKDELTIAAHILDK---PFYQVKATP-FLDGIVKTK--ERPM 472
           +G  ++Y L   K    + KD +  AAH+L +   P Y    TP   +G  K K   +P+
Sbjct: 392 HGEPFFYPLLDPKAPREAEKDTIVFAAHVLSRGGGPLYHQVTTPKRSEGHRKDKASSKPI 451

Query: 473 FSSTL----------------YHDFQQDFAFYTFAKMNIKS------------------- 497
              T+                YHDF  D  F   A   I S                   
Sbjct: 452 LEDTVDTSTIITSTYRHGAASYHDFFADHNFELLAGEIINSNFDSRRLAYVKWWRQNHSD 511

Query: 498 --TYDLKDSNDIQFDPSYT---YEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKLL- 551
             TY  K   D+  D S     Y  F  NY    +        + F  +++   +P ++ 
Sbjct: 512 DTTYKDKSDEDLSNDASVKADFYTSFHGNYTLAEYLNFFEFTPVSFVETDVLTCNPWIVA 571

Query: 552 KNRKLLIDD---ISKEPL---------------LMTWNIAIFEKQNIELESFKTMHEYLC 593
           ++R L  D    +  +P                L + +       ++EL ++    E+LC
Sbjct: 572 QSRDLTFDGASAVGAQPANQQTQYKAGPPTHHRLFSDHFQKLTTYDLELATWSAYAEFLC 631

Query: 594 EKAYYFDYLEDEYVDE--------TNALPGMCLFIKQRLDFLQSSA 631
            K  Y DY    Y+ E        T A   MC +I  R+  LQS++
Sbjct: 632 SKFSYKDY---PYLKEHLGLTDSPTTAYKMMCKYISARVSHLQSTS 674

>SAKL0H22616g Chr8 complement(1966196..1968421) [2226 bp, 741 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 741

 Score =  123 bits (309), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 105/389 (26%), Positives = 173/389 (44%), Gaps = 62/389 (15%)

Query: 299 VLSPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLD 358
           +L   N+ +  ++  F    + E G + WP FWRR  HP  Y+I+G  +N ++ IR  +D
Sbjct: 353 MLDADNYVVNSIENFFDSPVFNEKGLVLWPDFWRRLHHPKFYEIIGIDVNRNESIRYSID 412

Query: 359 DITPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSV 418
           ++TPP+VY   +       +SIP HDL  ++PD  T   Q L+ K K++DT+LL+ YY+ 
Sbjct: 413 NVTPPEVYRDNDD------DSIPFHDLANSIPDISTESGQLLVDKQKHLDTLLLSCYYNY 466

Query: 419 NGPSWYYILWYQKISPHSSKDELTIAAHIL----DKPFYQVKATPFLDG----------- 463
           NGPS+YY L  Q  +    KD    AAH+        ++Q++    + G           
Sbjct: 467 NGPSFYYPLLGQGYAGEGDKDTFIAAAHVTHPSESGSYHQIQTPVRVQGHWCDEFEISID 526

Query: 464 ------IVKTKER-----PMFSSTLYHDFQQDFAFYTFAKMNIKSTYD-LKDSNDIQF-- 509
                 I + K +      M  S    D ++     +    +IK   D  +  +  +F  
Sbjct: 527 DNPDDIIAEVKNKKYRGVAMLQSNYIEDHERLKEAQSAIPKDIKKRLDKFRQEHKDEFNN 586

Query: 510 -DPSYT--YEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKLL-----------KNRK 555
            D  Y   YE    +Y    +    +   + F HS+L   DP ++           + +K
Sbjct: 587 EDDLYKKFYESLRGHYSLNDYLEYFDSTEVSFIHSHLPKYDPWVISQDEDFKYDGKRAKK 646

Query: 556 LLIDDISKEPLL----MTWNIAIFEKQN--IELESFKTMHEYLC--EKAYY--FDYLEDE 605
           L  D  S    L      +N A  +  N  +EL ++    E+LC  +K  Y  F YL+ +
Sbjct: 647 LRGDKDSPSSKLSGHYRIYNSAFPKVTNYDLELANWAVFQEFLCSGDKENYKNFKYLKTQ 706

Query: 606 YVDETN---ALPGMCLFIKQRLDFLQSSA 631
                N   A+  MC +I +R++FL+ + 
Sbjct: 707 VSKADNPTVAVENMCKYIDERVEFLRKTT 735

>KLTH0C08976g Chr3 (751731..753839) [2109 bp, 702 aa] {ON} weakly
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 702

 Score =  116 bits (291), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 126/560 (22%), Positives = 229/560 (40%), Gaps = 99/560 (17%)

Query: 151 LTFNNLNQCLIIDDTTLQNLKTDHQNFLESLN-----ILQDLPINMYYGKGIVLIGGGKN 205
           LT  +L +CL I +   + L   H+ F  ++      + + L    + G GI+++GGGK 
Sbjct: 157 LTKESLEKCLQIPEEMTKTLHEAHKKFRAAIGEKLMPMFRKLDTPAFSGDGILIVGGGKY 216

Query: 206 TLFASIVAKFIRDQGNEIPVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELN----TN 261
           ++FA    K IR+         F   +     +      +++  FC+ +  +++    T 
Sbjct: 217 SVFALPAIKAIRENSG------FKLKSSIPIEIIIPPSDKADRGFCDNVLPKVDPLGLTK 270

Query: 262 CXXXXXXXXXXXXHXXXXXXXXXXXXXXXXXXXXXXXVLSPKNFPLKPLDTIFQLKPYPE 321
           C                                    +L   N+ +  ++  F      +
Sbjct: 271 CVFLDEMFDADTL--SHIEGYQIKALALLVSRFERVLMLDADNYVVNSINDYFTSSALND 328

Query: 322 TGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSIP 381
            G I WP +WRR  HP  Y I+   ++ D   R  +DD++P  +Y    +K+ T     P
Sbjct: 329 KGLILWPDYWRRLHHPKLYGIVDLGVSPDHISRYSVDDVSPDYMY----KKSVT---DTP 381

Query: 382 LHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDEL 441
            HD    LPD  T   Q L+ K K++D+I+++LYY+ NG S+YY +  Q  +    KD  
Sbjct: 382 FHDFRDALPDGGTESGQLLVDKKKHLDSIIMSLYYNYNGKSYYYPILGQGFAGEGDKDTF 441

Query: 442 TIAAHILDKP--FYQVKATPF--LDGIVKTKERPMF--------------SSTLYHDFQQ 483
            +A+ ++  P  FYQVK TP   L      K+                   + L HD+ +
Sbjct: 442 ALASRVMHGPGSFYQVK-TPVDTLGHWADAKDEIRLLEEEYENVEKKFRGCAMLQHDYIE 500

Query: 484 DFAFYTFAKMNIKSTY----------------------------DLKDSNDIQFDPSYTY 515
           D  F + A+  + +T                             + K S ++Q      +
Sbjct: 501 DSKFSSLAREVLGNTIRNNEEKFCDEWAAKNKGKFSAEEKARREECKKSKEVQ---DALH 557

Query: 516 EKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDP-KLLKNRKLLID------DISKEPLLM 568
           EK   +Y    + A  +   + F HS+L   DP +  +N  ++ D      +   +P  +
Sbjct: 558 EKMRASYKLDDYLAFFSFTGVSFVHSHLPKYDPWEWYENGDMMFDGKKAKKNHKNDPDYV 617

Query: 569 ---TWNIAIFEKQ-------NIELESFKTMHEYLC--EKAYY-FDYLEDEYVDET----N 611
              + N  +++ +       ++EL ++     YLC  E  Y  F YL ++ +D T     
Sbjct: 618 PAHSGNYRMYDSKFNQISSYDLELANWSAFKSYLCDLEGGYKNFGYLSNK-IDSTKSPKQ 676

Query: 612 ALPGMCLFIKQRLDFLQSSA 631
           +   MC +I++R+++L+S++
Sbjct: 677 SNKDMCKYIEERVEYLKSTS 696

>Kwal_56.22779 s56 complement(277096..279183) [2088 bp, 695 aa] {ON}
           YBR015C (MNN2) - putative Golgi
           alpha-1,2-mannosyltransferase [contig 184] FULL
          Length = 695

 Score =  109 bits (272), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 110/404 (27%), Positives = 173/404 (42%), Gaps = 84/404 (20%)

Query: 299 VLSPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIMGKQINFDKRIRMFLD 358
           +L   N+ +  LD  F  +   E G I WP +WRR  HP TYDI+   ++  K  R  +D
Sbjct: 299 MLDADNYVVNSLDEYFTHQKLKEKGLILWPDYWRRLHHPKTYDIVNLGVS-TKSQRYSID 357

Query: 359 DITPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTILLALYYSV 418
           + TP  VY  + ++        P HD    LPD  T   Q LI K K++D++L+ LYY+ 
Sbjct: 358 NATPDFVYKKDAKET-------PFHDFFDALPDGSTESGQVLIDKKKHLDSLLMTLYYNF 410

Query: 419 NGPSWYYILWYQKISPHSSKDELTIAAHILDKP--FYQVKATPFLDG------------- 463
           NG S++Y L  Q  +    KD   +   ++  P  +YQVK      G             
Sbjct: 411 NGKSYFYPLLGQGFAGEGDKDTFALGCRVMHGPEAYYQVKTPVDTLGHWADKDEIRIPDE 470

Query: 464 -IVKTKERPMFSST--LYHDFQQDFAFYTFAKMNIKS---------------TYDLKDSN 505
            + K+ +   F  T  + HDF  D  F + A+  I +               +++ K S 
Sbjct: 471 DLEKSIDGKQFRGTAMIQHDFTDDVRFSSLAREVIGNAIRDRFHSFCDEWARSHEGKLSK 530

Query: 506 DI-----QFDPSYTYEKFSNN-----YMDVGWEAIRNGNHLMFAHSNLFDGDP------- 548
           D      Q D S   +K  N+     Y    + +  +   + F HS+L   DP       
Sbjct: 531 DQKERREQCDKSDEVKKAFNDKESPSYGLKDYLSFFHFTKVSFIHSHLPKYDPWEWSHTG 590

Query: 549 -------KLLKNRKLLIDDISKEPL------LMTWNIAIFEKQNIELESFKTMHEYLCE- 594
                  K LKN K   D+    P+      +    I+     ++EL ++    +YLC+ 
Sbjct: 591 DMMFNGAKALKNHK---DEPEYSPMHAGHYRMYDSKISQLTSYDLELANWSAFKDYLCDI 647

Query: 595 KAYY--FDYL-----EDEYVDETNALPGMCLFIKQRLDFLQSSA 631
           K  Y  F YL     E E+  ++N    MC +I++R+++LQS+ 
Sbjct: 648 KDGYKNFGYLVQVLEETEFPHQSN--ENMCNYIRERVEYLQSNT 689

>Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C
           (REAL)
          Length = 1013

 Score = 35.8 bits (81), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 62/163 (38%), Gaps = 23/163 (14%)

Query: 455 VKATPFLDGIVKTKERPMFSSTLYHDF--QQDFAFYTFAKMNIKSTYDLKDSNDIQFDPS 512
           V A   + G++      +FS T  H+    +   FY     N K      D   I+    
Sbjct: 152 VNAGTVMGGVII---WDLFSETKIHNLLGHEGSIFYVNLSNNGKYVASCSDDRSIRLWDL 208

Query: 513 YTYEKFSNNYMDVGWEAIRNGNHLMFAHSNLFDGDPKLLKNRKLLIDDISKEPLLMTWNI 572
            T E+ S     +GW       +LMF     FD D KL+         +S++     WNI
Sbjct: 209 QTGEQLS-----IGWSHTARIWNLMF-----FDNDTKLIS--------VSEDCTCRIWNI 250

Query: 573 AIFEKQNIELESFKTMHEYLCEKAYYFDYLEDEYVDETNALPG 615
              +K++ EL        +L +  +  D  EDE +  T+   G
Sbjct: 251 VESQKKDAELSISNVYEVHLIKSIWGVDVKEDEMIAVTSGNDG 293

>Suva_16.350 Chr16 complement(614396..615601) [1206 bp, 401 aa] {ON}
           YPR023C (REAL)
          Length = 401

 Score = 32.7 bits (73), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query: 133 PIKRPVASKSIREDEWEYLTFNNLNQCLIIDDTTLQNL--KTDHQ--NFLESLNILQDLP 188
           P++ P+  KS+  D+WEY+T  +   C +  D T++ L  K +H+    LES      L 
Sbjct: 221 PLQIPIKLKSVLVDDWEYVT-KDKKICKLPADVTVEQLLNKYEHEVSQELESPGSQSQLS 279

Query: 189 -----INMYYGK--GIVLIGGGKNTLFASIVAKFIRDQGNEIPVEIFIP 230
                + +Y+ K  G +L+   +   +  I+ K  +DQ   IP++++ P
Sbjct: 280 EYCAGLKLYFDKCLGNMLLYRLERLQYDEILKKSAKDQKPLIPIKVYGP 328

>TDEL0G01170 Chr7 complement(238219..241326) [3108 bp, 1035 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1035

 Score = 32.3 bits (72), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 42/92 (45%), Gaps = 9/92 (9%)

Query: 818 REKDDLSLFNDIDKQEENSDQKIEGTGV-KGAPKKDGKLNLRDDPVMQELVRKKKQELME 876
           REKD  ++   +D+Q E+S+Q  E   V   AP  D +L++R D  + EL        + 
Sbjct: 486 REKDTPAVDLSMDRQRESSEQVFEEINVLNQAPTPDLELDIRGDTPIIELPDVSLDHSIA 545

Query: 877 ENKRKNGVNVIKYAPIPEGQDVPKGFNPMEKA 908
           E          K A I E    P   NPME+A
Sbjct: 546 EPG--------KDASIKEVVGSPHDLNPMEQA 569

>CAGL0C04004g Chr3 complement(394614..396512) [1899 bp, 632 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 632

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 29/129 (22%)

Query: 306 PLKPLDTIFQLKPYPETGFISWPGFWRRA------------IHPST--YDIMGKQINFDK 351
           P   LD  F LK Y +TG   W    R +            + PS   ++++G ++ F  
Sbjct: 350 PYVSLDEFFNLKGYKDTGLQFWRDRNRGSDTHKFCSNLGVYLEPSLEEHNLLGTELKFR- 408

Query: 352 RIRMFLDDITPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKKSKNIDTIL 411
                ++ +   KV +SEE+    F N + +H+++        SG   L KK K    I+
Sbjct: 409 -----INSLAKKKVRSSEERAFHRFFNELKVHNID--------SGIIVLNKKQKLHSLIM 455

Query: 412 LALYYSVNG 420
             ++Y+ NG
Sbjct: 456 GEIFYT-NG 463

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,320,218
Number of extensions: 4860246
Number of successful extensions: 19356
Number of sequences better than 10.0: 200
Number of HSP's gapped: 19780
Number of HSP's successfully gapped: 223
Length of query: 957
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 838
Effective length of database: 39,836,145
Effective search space: 33382689510
Effective search space used: 33382689510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)