Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A002603.190ON1841849871e-138
ZYRO0A04906g3.190ON1601854237e-53
Kpol_1045.683.190ON1761844152e-51
Kwal_56.231123.190ON1351454078e-51
KLTH0G16082g3.190ON1351453992e-49
TDEL0H033703.190ON1531543872e-47
KAFR0A012403.190ON1731413752e-45
AER016C3.190ON1471333672e-44
Skud_4.2433.190ON1651493663e-44
YDL008W (APC11)3.190ON1651473665e-44
CAGL0I04576g3.190ON1491333638e-44
Suva_4.2393.190ON1651493631e-43
NDAI0A065203.190ON2061343652e-43
Smik_4.2243.190ON1651513612e-43
Ecym_53123.190ON1481573567e-43
SAKL0C10516g3.190ON1441183567e-43
KNAG0J012503.190ON2021673572e-42
TPHA0H006403.190ON1801953292e-38
KLLA0E17711g3.190ON1621613133e-36
NCAS0I019203.190ON1281262871e-32
KLLA0E07151g3.28ON110711073e-06
NCAS0C044803.28ON1091131064e-06
KLLA0C14344g8.799ON1518621117e-06
Kwal_55.220543.28ON1111131031e-05
Kpol_1014.163.28ON1071131021e-05
KNAG0A012803.28ON1141131021e-05
YOL133W (HRT1)3.28ON1211131031e-05
Skud_15.203.28ON1211131032e-05
Smik_15.203.28ON1211131022e-05
Suva_15.263.28ON1221131022e-05
NDAI0G038603.28ON1231131022e-05
TDEL0A004703.28ON1181131012e-05
KLTH0F19228g3.28ON1101151003e-05
ZYRO0C03058g3.28ON1161131003e-05
SAKL0C13178g3.28ON138671014e-05
CAGL0E01567g3.28ON102113985e-05
TPHA0I005908.799ON1591611045e-05
Kpol_480.258.799ON1571461046e-05
NDAI0K007108.799ON1591461038e-05
TBLA0B087103.28ON122113971e-04
SAKL0B06226g8.799ON1557421012e-04
KAFR0B036208.799ON1560471002e-04
TBLA0D006508.799ON1568461002e-04
KAFR0C017803.28ON118104952e-04
Ecym_74188.799ON1547621002e-04
NCAS0C006808.799ON1564451002e-04
Suva_13.4328.799ON1559461002e-04
YMR247C (RKR1)8.799ON1562461002e-04
Skud_13.4198.799ON1564461002e-04
Smik_13.4608.799ON156646992e-04
KNAG0J005408.799ON156146992e-04
TDEL0B009808.799ON155947992e-04
KLTH0F18502gsingletonON26777973e-04
KLTH0E13992g8.799ON155046983e-04
Kwal_27.123278.799ON157446983e-04
ABL058C8.799ON154646974e-04
ZYRO0F12760g8.799ON155546974e-04
Ecym_20293.28ON114106924e-04
ADL181W3.28ON108106906e-04
TBLA0I019603.279ON18475890.002
TPHA0P014703.28ON111102860.003
CAGL0H02651g8.799ON154446910.003
KNAG0A074303.405ON10232840.004
Kpol_1072.552.157ON42061880.005
KLLA0F18458g3.279ON14075850.006
ABR104W3.405ON32885870.007
AGR034W3.279ON15942850.007
NCAS0A04680singletonON27489850.011
AGL079C2.542ON50647850.013
Ecym_54453.405ON32131840.016
Ecym_26583.279ON15980820.017
ZYRO0G13376g8.808ON445106840.018
TPHA0J015708.761ON1018113840.018
Suva_4.3023.279ON15059810.022
TBLA0G023102.542ON67469830.024
YBR062C3.279ON18059810.027
Smik_2.1963.279ON18559810.029
YHL010C (ETP1)2.542ON58567820.035
Kpol_1030.298.761ON1016105820.036
Suva_8.422.542ON58547820.039
TDEL0C027707.416ON20877800.039
NDAI0F027702.157ON55450810.040
SAKL0H15686g8.317ON59956810.043
Skud_8.352.542ON58547810.043
Smik_8.322.542ON58567810.043
KAFR0B034208.761ON103673810.046
KLTH0C04664g8.808ON30651800.056
NDAI0B018202.542ON62547800.056
KLLA0C15697g3.405ON30475800.056
KLTH0D07150g2.542ON54047800.058
CAGL0H10274g3.279ON17562780.060
Kwal_27.104198.808ON30052790.065
Suva_13.4158.761ON1028115800.065
Suva_2.3048.317ON62467800.065
Skud_2.1863.279ON17859780.068
KAFR0C004603.279ON15777770.068
CAGL0K02563g2.542ON58653800.069
TBLA0F032803.405ON55529790.073
Skud_4.4028.317ON61244790.077
TPHA0F018402.157ON52162790.077
SAKL0D03058g3.279ON15575770.081
ADL186C3.22ON136162790.085
YDR143C (SAN1)8.317ON61045790.087
ZYRO0E06996g3.279ON17255770.087
AGL217W8.808ON41437780.092
ZYRO0B02244g2.542ON56347780.098
KLLA0E07019g7.416ON27955780.10
SAKL0A09746g2.542ON54861780.10
TPHA0C042502.542ON55648780.11
TDEL0A031802.542ON56764780.11
Kwal_27.105463.279ON10465740.11
KAFR0A019902.542ON56047780.11
ACL019C6.45ON575138770.13
KNAG0C056602.542ON50763760.17
KAFR0F007402.157ON51062760.18
Ecym_72442.542ON53247760.20
Ecym_42508.317ON65769760.21
YOL138C (RTC1)3.22ON134155760.21
NCAS0A082803.279ON11851720.21
Kwal_55.21206singletonON27565750.22
YPL201C (YIG1)6.210ON461116750.22
Kwal_56.225226.45ON51369750.23
NCAS0G025202.157ON51869750.25
Kwal_26.80902.542ON52061750.25
Kpol_1002.82.542ON55847750.27
ZYRO0B03938g7.416ON18354730.28
TPHA0F024806.45ON60570750.28
SAKL0C13332g3.22ON135342750.29
TDEL0D034603.279ON14450720.30
NDAI0A074503.279ON17364730.31
Kpol_505.182.157ON58550740.33
KNAG0H035102.157ON55163740.34
NCAS0A125502.542ON57247740.34
KAFR0I020901.389ON146628740.35
KLLA0F25674g2.545ON75791740.36
SAKL0E04488g2.411ON112753740.42
YJR119C (JHD2)7.505ON72874740.42
KLLA0F25740g2.542ON51746730.42
NDAI0G052001.389ON158632740.42
KLLA0E04071g8.317ON70444730.43
AGL289C7.416ON24162720.45
Smik_4.3878.317ON63443730.46
Kpol_480.228.808ON42556730.46
Ecym_26848.808ON38654730.49
SAKL0C05698g1.190ON115599730.49
ACR267C2.157ON46770730.49
Suva_16.4203.405ON29066720.49
KLTH0E09834g2.157ON47954730.52
TDEL0B061701.389ON147052730.55
ZYRO0B16258g2.157ON57945720.56
Kpol_1052.193.279ON10369690.59
Suva_14.2232.157ON58067720.60
Skud_8.1762.157ON41369720.65
SAKL0D02354g8.808ON33132710.66
Smik_15.163.22ON132655720.70
CAGL0B05049g1.389ON147067720.72
Kwal_47.179042.157ON47054710.72
TPHA0K007007.416ON20855700.77
TBLA0B012602.157ON88545710.78
NCAS0B009908.808ON39235710.79
Ecym_54282.157ON47467710.80
NCAS0A145507.416ON26354700.81
Skud_15.163.22ON133255710.83
Smik_15.1576.45ON550106710.88
Smik_8.1932.157ON41661710.90
TBLA0B005606.45ON49282710.92
CAGL0A03432g2.411ON115168710.99
Suva_15.223.22ON133655711.0
TBLA0H002303.22ON133342711.0
SAKL0E10824g2.157ON47586701.1
Suva_15.3112.157ON26954691.1
Kpol_1036.668.317ON66828701.1
Kpol_1048.731.389ON1549108701.2
YLR032W (RAD5)2.411ON116955701.3
YMR231W (PEP5)8.761ON102994701.3
TDEL0F044408.317ON55462691.4
Kwal_55.220763.22ON128653701.4
Ecym_42808.288ON113254691.5
KLLA0E20967g3.22ON132180691.5
KLLA0E12475g3.311ON97148691.6
KAFR0I002007.9ON75347691.6
YHR115C (DMA1)2.157ON41669681.7
Kwal_56.239008.317ON58969691.7
KLTH0C05258g3.279ON15238671.7
AEL104W1.190ON108590691.7
ZYRO0G15642g8.761ON102486691.7
TPHA0B036501.389ON157644691.7
KLTH0C06094g7.416ON19554671.7
TDEL0G042506.45ON51742681.7
SAKL0H17116gsingletonON54444681.8
KLTH0F19338g3.22ON129034691.8
CAGL0B02013g8.288ON1120107682.0
Smik_13.4398.761ON103074682.0
KNAG0I020902.157ON427103682.0
NDAI0G038103.22ON139342682.1
Skud_15.1486.45ON548106682.2
ZYRO0E05632g2.545ON76531682.2
Kwal_56.238668.308ON81643682.2
TPHA0C008508.317ON78128682.2
KLLA0F23892g2.157ON51845682.3
KLTH0G18150g1.389ON155434682.3
Ecym_72412.545ON75831682.3
KLLA0C05874g6.45ON55357672.3
KLTH0G12408g8.317ON60356672.6
NCAS0B069902.157ON52139672.7
Skud_12.992.411ON117155672.7
KNAG0A037008.544ON81779672.8
Ecym_71377.416ON26354662.9
TBLA0C013301.389ON145234673.0
SAKL0A09812g2.545ON75131673.0
KLTH0D07216g2.545ON74727673.1
Kwal_26.80992.545ON75027673.1
Suva_15.1158.808ON41131663.1
NCAS0A041202.411ON113755673.1
SAKL0D08272g1.389ON149147673.1
TDEL0B034908.761ON102361673.1
KLTH0E04312g8.761ON103167673.2
KLTH0C10604g6.45ON51575663.4
KNAG0A070902.545ON76231663.4
NDAI0G026308.317ON66129663.4
KAFR0B055808.288ON112044663.5
YOL013C (HRD1)6.45ON55164663.5
NCAS0H019105.400ON94942663.6
Skud_11.1922.545ON75898663.7
SAKL0E01958g6.45ON52464663.7
Sklu_YGOB_Anc_8.8698.869ON22140653.7
SAKL0D00484gsingletonOFF26740653.7
Smik_14.2122.157ON52967664.0
KNAG0J008503.279ON16259644.1
YNL116W (DMA2)2.157ON52267654.2
Skud_14.2162.157ON53067654.2
Kpol_538.53.405ON33537654.3
Kwal_56.236858.288ON110240664.4
Ecym_30486.45ON67071654.5
Skud_13.4008.761ON1030115654.6
SAKL0F13046g7.416ON26983654.6
Suva_15.1596.45ON550106654.7
TBLA0B026708.808ON478111654.8
Kpol_1033.198.288ON113947655.0
Smik_11.2132.545ON75979655.3
NCAS0J017304.291ON142831655.4
TPHA0A039903.279ON17543635.5
Ecym_20243.22ON131753646.1
Kwal_47.175994.129ON125034646.2
NCAS0C044303.22ON131152646.5
NDAI0A014907.416ON29754636.7
CAGL0J09460g7.281ON344119636.9
YPR093C (ASR1)3.405ON28829637.4
TDEL0B052002.157ON52445637.6
Smik_16.3333.405ON29029637.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A00260
         (184 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...   384   e-138
ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {O...   167   7e-53
Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {...   164   2e-51
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...   161   8e-51
KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some ...   158   2e-49
TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...   153   2e-47
KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.19...   149   2e-45
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...   145   2e-44
Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W (...   145   3e-44
YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Cataly...   145   5e-44
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...   144   8e-44
Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W (...   144   1e-43
NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3....   145   2e-43
Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W (...   143   2e-43
Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON} ...   141   7e-43
SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar...   141   7e-43
KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {O...   142   2e-42
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...   131   2e-38
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...   125   3e-36
NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.19...   115   1e-32
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    46   3e-06
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       45   4e-06
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    47   7e-06
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    44   1e-05
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    44   1e-05
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    44   1e-05
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    44   1e-05
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    44   2e-05
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    44   2e-05
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    44   2e-05
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    44   2e-05
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    44   2e-05
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    43   3e-05
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    43   3e-05
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    44   4e-05
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    42   5e-05
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    45   5e-05
Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON} (57636.....    45   6e-05
NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8...    44   8e-05
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    42   1e-04
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    44   2e-04
KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {...    43   2e-04
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    43   2e-04
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    41   2e-04
Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar ...    43   2e-04
NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8....    43   2e-04
Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] ...    43   2e-04
YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}...    43   2e-04
Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] ...    43   2e-04
Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] ...    43   2e-04
KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.7...    43   2e-04
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    43   2e-04
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    42   3e-04
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    42   3e-04
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    42   3e-04
ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON} ...    42   4e-04
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    42   4e-04
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    40   4e-04
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    39   6e-04
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    39   0.002
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    38   0.003
CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} simil...    40   0.003
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    37   0.004
Kpol_1072.55 s1072 (126281..127543) [1263 bp, 420 aa] {ON} (1262...    39   0.005
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    37   0.006
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    38   0.007
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    37   0.007
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      37   0.011
AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON} S...    37   0.013
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    37   0.016
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    36   0.017
ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]...    37   0.018
TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON} Anc_8...    37   0.018
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    36   0.022
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    37   0.024
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    36   0.027
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    36   0.029
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    36   0.035
Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {...    36   0.036
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    36   0.039
TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON...    35   0.039
NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {O...    36   0.040
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    36   0.043
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    36   0.043
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    36   0.043
KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8....    36   0.046
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    35   0.056
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     35   0.056
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    35   0.056
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    35   0.058
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    35   0.060
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    35   0.065
Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR23...    35   0.065
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    35   0.065
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    35   0.068
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    34   0.068
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    35   0.069
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    35   0.073
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    35   0.077
TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {O...    35   0.077
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    34   0.081
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    35   0.085
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    35   0.087
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    34   0.087
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    35   0.092
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    35   0.098
KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some si...    35   0.10 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    35   0.10 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    35   0.11 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    35   0.11 
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    33   0.11 
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    35   0.11 
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...    34   0.13 
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    34   0.17 
KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.1...    34   0.18 
Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}...    34   0.20 
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    34   0.21 
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    34   0.21 
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    32   0.21 
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    33   0.22 
YPL201C Chr16 complement(169770..171155) [1386 bp, 461 aa] {ON} ...    33   0.22 
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...    33   0.23 
NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.1...    33   0.25 
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    33   0.25 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    33   0.27 
ZYRO0B03938g Chr2 complement(327333..327884) [552 bp, 183 aa] {O...    33   0.28 
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...    33   0.28 
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    33   0.29 
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    32   0.30 
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    33   0.31 
Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}...    33   0.33 
KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {O...    33   0.34 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    33   0.34 
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    33   0.35 
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    33   0.36 
SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} simil...    33   0.42 
YJR119C Chr10 complement(644304..646490) [2187 bp, 728 aa] {ON} ...    33   0.42 
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    33   0.42 
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    33   0.42 
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    33   0.43 
AGL289C Chr7 complement(164204..164929) [726 bp, 241 aa] {ON} Sy...    32   0.45 
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    33   0.46 
Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON} (52842..5...    33   0.46 
Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {O...    33   0.49 
SAKL0C05698g Chr3 complement(539308..542775) [3468 bp, 1155 aa] ...    33   0.49 
ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON} S...    33   0.49 
Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {O...    32   0.49 
KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {...    33   0.52 
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    33   0.55 
ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]...    32   0.56 
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    31   0.59 
Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116...    32   0.60 
Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON...    32   0.65 
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    32   0.66 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    32   0.70 
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    32   0.72 
Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {...    32   0.72 
TPHA0K00700 Chr11 (144606..145232) [627 bp, 208 aa] {ON} Anc_7.4...    32   0.77 
TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.1...    32   0.78 
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    32   0.79 
Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}...    32   0.80 
NCAS0A14550 Chr1 complement(2867437..2868228) [792 bp, 263 aa] {...    32   0.81 
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    32   0.83 
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...    32   0.88 
Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON...    32   0.90 
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...    32   0.92 
CAGL0A03432g Chr1 (349884..353339) [3456 bp, 1151 aa] {ON} simil...    32   0.99 
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    32   1.0  
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    32   1.0  
SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {...    32   1.1  
Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {O...    31   1.1  
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    32   1.1  
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    32   1.2  
YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA ...    32   1.3  
YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}  PEP5Comp...    32   1.3  
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    31   1.4  
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    32   1.4  
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    31   1.5  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    31   1.5  
KLLA0E12475g Chr5 complement(1100281..1103196) [2916 bp, 971 aa]...    31   1.6  
KAFR0I00200 Chr9 (39428..41689) [2262 bp, 753 aa] {ON} Anc_7.9 Y...    31   1.6  
YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}  ...    31   1.7  
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    31   1.7  
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    30   1.7  
AEL104W Chr5 (431236..434493) [3258 bp, 1085 aa] {ON} Syntenic h...    31   1.7  
ZYRO0G15642g Chr7 complement(1271054..1274128) [3075 bp, 1024 aa...    31   1.7  
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    31   1.7  
KLTH0C06094g Chr3 (531296..531883) [588 bp, 195 aa] {ON} some si...    30   1.7  
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...    31   1.7  
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    31   1.8  
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    31   1.8  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    31   2.0  
Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR23...    31   2.0  
KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {O...    31   2.0  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    31   2.1  
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...    31   2.2  
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    31   2.2  
Kwal_56.23866 s56 (748823..751273) [2451 bp, 816 aa] {ON} YLR115...    31   2.2  
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    31   2.2  
KLLA0F23892g Chr6 complement(2229493..2231049) [1557 bp, 518 aa]...    31   2.3  
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    31   2.3  
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    31   2.3  
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...    30   2.3  
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    30   2.6  
NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa] ...    30   2.7  
Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032...    30   2.7  
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    30   2.8  
Ecym_7137 Chr7 (277509..278300) [792 bp, 263 aa] {ON} similar to...    30   2.9  
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    30   3.0  
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    30   3.0  
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    30   3.1  
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    30   3.1  
Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054...    30   3.1  
NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {...    30   3.1  
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    30   3.1  
TDEL0B03490 Chr2 complement(621849..624920) [3072 bp, 1023 aa] {...    30   3.1  
KLTH0E04312g Chr5 complement(388173..391268) [3096 bp, 1031 aa] ...    30   3.2  
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...    30   3.4  
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    30   3.4  
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     30   3.4  
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    30   3.5  
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...    30   3.5  
NCAS0H01910 Chr8 complement(369281..372130) [2850 bp, 949 aa] {O...    30   3.6  
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    30   3.7  
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...    30   3.7  
Sklu_YGOB_Anc_8.869 Chr4 (39275..39280,39349..40008) [666 bp, 22...    30   3.7  
SAKL0D00484g Chr4 (39205..40008) [804 bp, 267 aa] {OFF} conserve...    30   3.7  
Smik_14.212 Chr14 (387986..389575) [1590 bp, 529 aa] {ON} YNL116...    30   4.0  
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    29   4.1  
YNL116W Chr14 (408341..409909) [1569 bp, 522 aa] {ON}  DMA2Ubiqu...    30   4.2  
Skud_14.216 Chr14 (398407..399999) [1593 bp, 530 aa] {ON} YNL116...    30   4.2  
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    30   4.3  
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    30   4.4  
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...    30   4.5  
Skud_13.400 Chr13 (707700..710792) [3093 bp, 1030 aa] {ON} YMR23...    30   4.6  
SAKL0F13046g Chr6 complement(1026073..1026882) [810 bp, 269 aa] ...    30   4.6  
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...    30   4.7  
TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.8...    30   4.8  
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    30   5.0  
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    30   5.3  
NCAS0J01730 Chr10 (317401..321687) [4287 bp, 1428 aa] {ON} Anc_4...    30   5.4  
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    29   5.5  
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    29   6.1  
Kwal_47.17599 s47 complement(473358..477110) [3753 bp, 1250 aa] ...    29   6.2  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    29   6.5  
NDAI0A01490 Chr1 (329693..330586) [894 bp, 297 aa] {ON} Anc_7.41...    29   6.7  
CAGL0J09460g Chr10 complement(928455..929489) [1035 bp, 344 aa] ...    29   6.9  
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    29   7.4  
TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.1...    29   7.6  
Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {O...    29   7.8  
CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa] ...    29   7.9  
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    29   8.3  
KAFR0B04600 Chr2 complement(956458..957684) [1227 bp, 408 aa] {O...    29   8.5  
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    29   8.7  
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    28   9.0  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    28   9.4  

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score =  384 bits (987), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 184/184 (100%), Positives = 184/184 (100%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT
Sbjct: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE
Sbjct: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120

Query: 121 DVFKSLELKQARQRFGAFDEDVDVDLSGFINEEDYGVVGEREVGQGANGSNDGGLAQDPT 180
           DVFKSLELKQARQRFGAFDEDVDVDLSGFINEEDYGVVGEREVGQGANGSNDGGLAQDPT
Sbjct: 121 DVFKSLELKQARQRFGAFDEDVDVDLSGFINEEDYGVVGEREVGQGANGSNDGGLAQDPT 180

Query: 181 MVVR 184
           MVVR
Sbjct: 181 MVVR 184

>ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {ON}
           similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 160

 Score =  167 bits (423), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 112/185 (60%), Gaps = 26/185 (14%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           MK++++ ++ VFAW W IP DN                G    D+D+DVCGICR +YN T
Sbjct: 1   MKVDIEEVHSVFAWTWHIPKDN--------------KDGSLEADDDDDVCGICRASYNAT 46

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CP+CK PG  C LVVG C HNFHVHCIY+WLDTTTSKGLCPMCRQ F+LK G+A+N SQ 
Sbjct: 47  CPSCKYPGDECSLVVGECNHNFHVHCIYRWLDTTTSKGLCPMCRQLFQLKRGLAINDSQL 106

Query: 121 DVFKSLELKQARQRFGAF-DEDVDVDLSGFINEEDYGVVGEREVGQGANGSNDGGLAQDP 179
           + FK L+L++     G F DED +  +   + ++D   V ++           G +  D 
Sbjct: 107 EKFKELQLRKRTNTAGEFADEDDEEAIERAMAQQDQAEVDDQ-----------GDVIMDQ 155

Query: 180 TMVVR 184
            +VVR
Sbjct: 156 GLVVR 160

>Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {ON}
           complement(160586..161116) [531 nt, 177 aa]
          Length = 176

 Score =  164 bits (415), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 114/184 (61%), Gaps = 8/184 (4%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           MK+EVK ++ VF+W W IP +   I++   E  I    G    D++EDVCGICR ++NRT
Sbjct: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CPNCK PG  CPLV+G C HNFHVHCIY+WLDT+TS+GLCPMCRQ F+LK+GV++N S  
Sbjct: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120

Query: 121 DVFKSLELKQARQRFGAFDEDVDVDLSGFINEEDYGVVGEREVGQGANGSNDGGLAQDPT 180
           + F+ L +K+ +Q    F+       S   ++         +   G N  N G +  D  
Sbjct: 121 ERFRELAIKR-QQEQNEFE-------SNLDDDAAIARAIAEQEDTGRNVDNQGDIIMDQD 172

Query: 181 MVVR 184
           +VVR
Sbjct: 173 LVVR 176

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score =  161 bits (407), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 75/145 (51%), Positives = 95/145 (65%), Gaps = 16/145 (11%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           MKIE K +YPVF+W WDIP D+    N ++E+G            DED+CGICR +YN T
Sbjct: 1   MKIEFKKVYPVFSWSWDIPGDD----NADKEIG------------DEDLCGICRVSYNGT 44

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CP C+ PG  CPLV+G C HNFHVHCI +WL+T T+KGLCPMCRQ+F LK GVA+N+ Q 
Sbjct: 45  CPGCRFPGDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQM 104

Query: 121 DVFKSLELKQARQRFGAFDEDVDVD 145
           D    L L+         D+D+ +D
Sbjct: 105 DSLAKLLLQSQPAALTTEDQDMMMD 129

>KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some
           similarities with uniprot|Q12157 Saccharomyces
           cerevisiae YDL008W APC11 Catalytic core subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 135

 Score =  158 bits (399), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 96/145 (66%), Gaps = 16/145 (11%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           M++E K +YPVF+W WDIP D+    + +RE+G            DED+CGICR +YN T
Sbjct: 1   MQLEFKKVYPVFSWSWDIPGDD----DADREIG------------DEDLCGICRVSYNGT 44

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CP CK PG  CPLV+G C HNFHVHCI +WL T T+KGLCPMCRQ+F LK GVA+N+ Q 
Sbjct: 45  CPGCKYPGDNCPLVIGECNHNFHVHCIQQWLATPTAKGLCPMCRQQFSLKRGVAINEGQV 104

Query: 121 DVFKSLELKQARQRFGAFDEDVDVD 145
           +   +L L+       A D+D+ +D
Sbjct: 105 EKLANLLLQPRPAALAADDQDMMMD 129

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score =  153 bits (387), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 102/154 (66%), Gaps = 11/154 (7%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           MK++++ ++ VFAW W IP ++   Q+   E  ID + G       +DVCGICR +YN T
Sbjct: 1   MKVKLREVHSVFAWTWHIPKES---QDAHAET-IDDNDG-------DDVCGICRASYNAT 49

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CP CK PG  CPLVVG C HNFHVHCIY+WLDT TS+GLCPMCRQ F+LK+G+A+N SQ 
Sbjct: 50  CPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQI 109

Query: 121 DVFKSLELKQARQRFGAFDEDVDVDLSGFINEED 154
             F+ L  KQ + R   F +  D + +   +++D
Sbjct: 110 SKFQELRNKQWQTRQQEFGDQQDPETNPLEDQDD 143

>KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.190
           YDL008W
          Length = 173

 Score =  149 bits (375), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 70/141 (49%), Positives = 89/141 (63%), Gaps = 6/141 (4%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           MK+ VK IYPV+AW WDI      +  K  +    YS       E +DVCGICR +YN T
Sbjct: 1   MKVTVKKIYPVYAWSWDI------VTRKGEQKSDVYSVLDKYRSEKDDVCGICRASYNGT 54

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CP+CK+PG  CPL+VG+C HNFH HCI++WL+T  SKGLCPMCRQEFKL + + +N    
Sbjct: 55  CPSCKIPGTMCPLIVGSCNHNFHYHCIFRWLNTLNSKGLCPMCRQEFKLDKKLVINSDYL 114

Query: 121 DVFKSLELKQARQRFGAFDED 141
             F+ L  K   +R    DE+
Sbjct: 115 QKFEVLARKNRERRALNVDEE 135

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score =  145 bits (367), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 66/133 (49%), Positives = 93/133 (69%), Gaps = 12/133 (9%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           M++++  I  V +W WD+P          +EL  D     +  +++EDVCGICR +YN T
Sbjct: 1   MQLQINNIQCVASWYWDVP----------KELKRDSPVYED--EDEEDVCGICRGSYNGT 48

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CPNCK+PG+ CPL+VG+C HNFHVHCIY+WL+T+TSKGLCPMCRQ F L+EG+ +N+   
Sbjct: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIRINEPHR 108

Query: 121 DVFKSLELKQARQ 133
           D F+ + +K  +Q
Sbjct: 109 DKFEKVLMKARQQ 121

>Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  145 bits (366), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 71/149 (47%), Positives = 95/149 (63%), Gaps = 12/149 (8%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           MK+++  ++ VFAW W IP+ +  +   E           N  DEDEDVCGICR +YN T
Sbjct: 1   MKVKINEVHSVFAWSWHIPSISDEVIGNEVP---------NENDEDEDVCGICRASYNGT 51

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CP+CK PG +CPLV+G C HNFH HCIY+WLDT+ SKGLCPMCRQ F+L++G+A+N +  
Sbjct: 52  CPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHI 111

Query: 121 DVFKSLELKQARQRFGAFDEDVDVDLSGF 149
             F  +    +R+R    +E V  D   F
Sbjct: 112 QKFVDI---VSRRREEMIEEGVAEDFVNF 137

>YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Catalytic
           core subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; contains a RING-H2 domain that is required
           for activity
          Length = 165

 Score =  145 bits (366), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 70/147 (47%), Positives = 94/147 (63%), Gaps = 11/147 (7%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           MK+++  ++ VFAW W IP+ +         +G          DEDEDVCGICR +YN T
Sbjct: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIG---------NDEDEDVCGICRASYNGT 51

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CP+CK PG +CPLV+G C HNFH HCIY+WLDT TSKGLCPMCRQ F+L++G+A+N +  
Sbjct: 52  CPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHV 111

Query: 121 DVFKSLELKQARQRF--GAFDEDVDVD 145
             F  +  ++  +    G  +E VD D
Sbjct: 112 QKFVEIVSRRREEMIEEGVAEEFVDFD 138

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score =  144 bits (363), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 93/133 (69%), Gaps = 13/133 (9%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           M+IE+  ++ VF W WDIP      +N++R   +D S    M DEDEDVCGICR +Y+  
Sbjct: 1   MRIELTEVHGVFNWVWDIP------KNEDR---LDES----MADEDEDVCGICRASYHAP 47

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CPNC+ PG+ C +V+G C HNFHVHCI +W+DT TSKGLCPMCRQ+F+L +   +N+   
Sbjct: 48  CPNCRYPGESCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCRQKFQLLQRTKINEPHI 107

Query: 121 DVFKSLELKQARQ 133
            +FK +E+K+ RQ
Sbjct: 108 PLFKEIEIKRYRQ 120

>Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  144 bits (363), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 100/149 (67%), Gaps = 12/149 (8%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           MK+++  ++ VFAW W IP  +   +N+  E+        N  D+DEDVCGICR +YN T
Sbjct: 1   MKVKINQVHSVFAWSWHIPRISD--ENETNEVT-------NENDDDEDVCGICRASYNGT 51

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CP+CK PG +CPLV+G C HNFH HCIY+WLDT+ SKGLCPMCRQ F+L++G+A+N +  
Sbjct: 52  CPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQVFQLQKGLAINDAH- 110

Query: 121 DVFKSLELKQARQRFGAFDEDVDVDLSGF 149
            + K +E+  +R+R    +E V  D   F
Sbjct: 111 -IRKFVEVV-SRRREEMIEEGVAEDFVDF 137

>NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3.190
           YDL008W
          Length = 206

 Score =  145 bits (365), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 72/134 (53%), Positives = 84/134 (62%), Gaps = 9/134 (6%)

Query: 1   MKIEVKGIYPVFAWKWDIPN-----DNHFIQNKERELGIDY-SSGHNMVDEDEDVCGICR 54
           MKIEV+ IYP+ AW WD+P      D+    N     GI   +   N VD   DVCGICR
Sbjct: 1   MKIEVQNIYPLVAWSWDMPKNLDDPDSDEPDNANDSYGIRRRAPNKNAVD---DVCGICR 57

Query: 55  FNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVA 114
            +YN TCPNCK PG  CPLV+G C HNFH HCIY+WL T TSKGLCPMCRQ+F+LK    
Sbjct: 58  ASYNGTCPNCKFPGTDCPLVLGRCNHNFHFHCIYQWLKTLTSKGLCPMCRQKFRLKPNAT 117

Query: 115 LNKSQEDVFKSLEL 128
           +N      FK L +
Sbjct: 118 VNTDHLGAFKELAI 131

>Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  143 bits (361), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 72/151 (47%), Positives = 95/151 (62%), Gaps = 16/151 (10%)

Query: 1   MKIEVKGIYPVFAWKWDIPN--DNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYN 58
           MK+++  ++ VFAW W IP+  D     +K            N  DE+EDVCGICR +YN
Sbjct: 1   MKVKINEVHSVFAWTWQIPSISDEKVTNDK-----------LNDNDENEDVCGICRASYN 49

Query: 59  RTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKS 118
            TCP+CK PG +CPLV+G C HNFH HCIY+WLDT TSKGLCPMCRQ F+L++G+A+N +
Sbjct: 50  GTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDA 109

Query: 119 QEDVFKSLELKQARQRFGAFDEDVDVDLSGF 149
               F  +    +R+R    +E V  D   F
Sbjct: 110 HIQKFVEI---VSRRREEMIEEGVAEDFVDF 137

>Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON}
           similar to Ashbya gossypii AER016C
          Length = 148

 Score =  141 bits (356), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 105/157 (66%), Gaps = 15/157 (9%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           M++++K +  V +W WD+P          +EL  D        ++DEDVCGICR +YN T
Sbjct: 1   MQLQIKNVQCVASWYWDVP----------KELKRDLHE--GEDEDDEDVCGICRASYNGT 48

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CPNCK+PG+ CPL+VG+C HNFHVHCIY+WL+T+TSKGLCPMCRQ F L++G+ +N+  +
Sbjct: 49  CPNCKLPGETCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHK 108

Query: 121 DVFKSLELKQARQRFGAFDEDVDVDLSGFINEEDYGV 157
           + F+ + +K  +Q   +      V+ +G +++ED  +
Sbjct: 109 EKFEKVLMKARQQNVVSVS---GVNAAGGVDQEDVMI 142

>SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008W APC11
           Catalytic core subunit of the Anaphase- Promoting
           Complex/Cyclosome (APC/C) which is a ubiquitin- protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 144

 Score =  141 bits (356), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 75/118 (63%), Gaps = 14/118 (11%)

Query: 9   YPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTCPNCKVPG 68
           + V +W W IP D               +  H   D +EDVCGICR +YN TCP+CK PG
Sbjct: 9   HAVCSWSWHIPRDG--------------THQHEAADTEEDVCGICRVSYNGTCPSCKYPG 54

Query: 69  KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQEDVFKSL 126
             CPLVVG C HNFHVHCI +WLDT TS+GLCPMCRQ F LK GVA+N SQ D F  L
Sbjct: 55  DECPLVVGECNHNFHVHCIVQWLDTATSRGLCPMCRQLFSLKRGVAINDSQLDHFAKL 112

>KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {ON}
           Anc_3.190 YDL008W
          Length = 202

 Score =  142 bits (357), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 102/167 (61%), Gaps = 18/167 (10%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKEREL-----GIDYSSGH----NMVD--EDEDV 49
           MK+++K + PVF W WD   D    ++++         +D    H    N VD  EDEDV
Sbjct: 1   MKLDIKRVNPVFTWSWDT-RDPAAAKDRQYPFLYNYYPVDVEKAHLENGNAVDGDEDEDV 59

Query: 50  CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
           CGICR +YN TCP+CK+PG  CPLV G C H+FH HCI++WLDT TSKGLCPMCRQ+F+L
Sbjct: 60  CGICRASYNGTCPSCKIPGDSCPLVAGLCHHHFHYHCIFRWLDTNTSKGLCPMCRQQFQL 119

Query: 110 KEGVALNKSQEDVFKSLELKQARQRFGAFDEDVDVDLSGFINEEDYG 156
              + +N+   + F+S+  K  R+R    DE  D    G   +E+YG
Sbjct: 120 NSKLPINRPYLEKFESI-TKAIRERV-FLDEAFD----GNSQQEEYG 160

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score =  131 bits (329), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 108/195 (55%), Gaps = 26/195 (13%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDED---------VCG 51
           MK+++K +  VFAW W IP  +   Q  +++      SG ++  ++++          CG
Sbjct: 1   MKVQIKNVNGVFAWGWQIPKHD---QKVKKDHNNSIVSGSDVDHQEQNSDDEDDEEDFCG 57

Query: 52  ICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKE 111
           ICR ++ R CPNCK P   CP+V+G C HNFHVHCI++WL+T  S+GLCPMCRQ F+L++
Sbjct: 58  ICRASFIRACPNCKFPSDGCPIVIGKCKHNFHVHCIFEWLETEASRGLCPMCRQVFELRK 117

Query: 112 GVALNKSQEDVFKSLELKQARQR--FGAFDEDVDVDLSGFINEEDYGVVGEREVGQGANG 169
           GV +N      FK L LK+ +++  F A  ED D  L+  I  +           +G NG
Sbjct: 118 GVVINDLHYVTFKELILKRQKEQNEFEATAED-DEALARMIAAQ-----------EGNNG 165

Query: 170 SNDGGLAQDPTMVVR 184
                   D  MVVR
Sbjct: 166 DVPVDDILDQDMVVR 180

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score =  125 bits (313), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 91/161 (56%), Gaps = 11/161 (6%)

Query: 1   MKIEVKGIYPVFAWKWDIPND---------NHFIQNKERELGIDYSSGHNMVDEDEDVCG 51
           M+IEV  +  V  W WDIP D         +  +  ++ E   +        +E+ +VCG
Sbjct: 1   MRIEVTDVSLVSTWAWDIPKDLSKGKHGVADQTVHMEKWEDIQNEDEDAENDEEEYEVCG 60

Query: 52  ICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKE 111
           ICR  Y+ TCP+C  PG  CP+V+G C HNFHVHCI +WL T TSKGLCP+CRQ F+L+ 
Sbjct: 61  ICRNRYDATCPSCDYPGSGCPIVLGLCNHNFHVHCIKQWLSTETSKGLCPLCRQGFQLRP 120

Query: 112 GVALNKSQEDVFKSL--ELKQARQRFGAFDEDVDVDLSGFI 150
            V +NK   D F+ L   ++Q     G  + D DV   GFI
Sbjct: 121 NVLINKMHHDEFQKLLMSVRQHNIPMGGGEIDQDVMDDGFI 161

>NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.190
           YDL008W
          Length = 128

 Score =  115 bits (287), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 73/126 (57%), Gaps = 4/126 (3%)

Query: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60
           MK+EV+ +YPVF W WDI ++    QN E E         +  D+D++VCGICR  YN  
Sbjct: 1   MKLEVREVYPVFEWSWDITSETEQQQNHEPE----EQPEDDDDDDDDEVCGICRAGYNAV 56

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           CP+C  PG  CP+VVG C H FHVHC+  WL T  ++G CPMCRQ F L     +N+   
Sbjct: 57  CPSCSHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGAT 116

Query: 121 DVFKSL 126
                L
Sbjct: 117 VTLPQL 122

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 8/71 (11%)

Query: 44  DEDEDVCGICRFNYNRTCPNCKVPGK-----RCPLVVGNCFHNFHVHCIYKWLDTTTSKG 98
           D D D C ICR +    C NC+          C    G C H FH+HCI +W+    S+ 
Sbjct: 38  DIDVDNCAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIK---SRN 94

Query: 99  LCPMCRQEFKL 109
           +CP+  + +KL
Sbjct: 95  VCPLDNKPWKL 105

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 41/113 (36%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           K E+K    V  W WDI  DN                           C ICR +    C
Sbjct: 22  KFEIKKWTAVAFWSWDIAVDN---------------------------CAICRNHIMEPC 54

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KW+ T   +  CP+  Q ++L
Sbjct: 55  IECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWQL 104

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 50   CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
            C IC +  +    + K+P K CP     C + FH  C+YKW   ++    CP+CR EF L
Sbjct: 1464 CAICYYVLHAI--DRKLPTKVCP----TCNNRFHGACLYKWF-KSSGNNTCPLCRGEFNL 1516

Query: 110  KE 111
            ++
Sbjct: 1517 RK 1518

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 39/113 (34%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           K EVK    V  W WDI  +N                           C ICR +    C
Sbjct: 24  KFEVKKWTAVAFWSWDIAVEN---------------------------CAICRNHIMEPC 56

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KWL T   +  CP+  Q +  
Sbjct: 57  IQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQT---RNACPLDNQPWSF 106

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 41/113 (36%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           + E+K    V  W WDI  DN                           C ICR +    C
Sbjct: 20  RFEIKKWTAVAFWSWDIAVDN---------------------------CAICRNHIMEPC 52

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KW+ T   +  CP+  Q ++L
Sbjct: 53  IECQPNAMTETDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWQL 102

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 41/113 (36%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           K ++K    V  W WDI  DN                           C ICR +    C
Sbjct: 27  KFQIKKWTAVAFWSWDIAVDN---------------------------CAICRNHIMEPC 59

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KW+ T   +  CP+  Q ++L
Sbjct: 60  IECQPKAMTDTDNECVAAWGACGHAFHLHCINKWIKT---RDACPLDNQPWQL 109

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 41/113 (36%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           + E+K    V  W WDI  DN                           C ICR +    C
Sbjct: 34  RFEIKKWTAVAFWSWDIAVDN---------------------------CAICRNHIMEPC 66

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KW+ T   +  CP+  Q ++L
Sbjct: 67  IECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 116

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 41/113 (36%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           + E+K    V  W WDI  DN                           C ICR +    C
Sbjct: 34  RFEIKKWTAVAFWSWDIAVDN---------------------------CAICRNHIMEPC 66

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KW+ T   +  CP+  Q ++L
Sbjct: 67  IECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 116

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 41/113 (36%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           + E+K    V  W WDI  DN                           C ICR +    C
Sbjct: 34  RFEIKKWTAVAFWSWDIAVDN---------------------------CAICRNHIMEPC 66

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KW+ T   +  CP+  Q ++L
Sbjct: 67  IECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 116

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 41/113 (36%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           + E+K    V  W WDI  DN                           C ICR +    C
Sbjct: 35  RFEIKKWTAVAFWSWDIAVDN---------------------------CAICRNHIMEPC 67

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KW+ T   +  CP+  Q ++L
Sbjct: 68  IECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 117

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 41/113 (36%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           + E+K    V  W WDI  DN                           C ICR +    C
Sbjct: 36  RFEIKKWTAVAFWSWDIAVDN---------------------------CAICRNHIMEPC 68

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KW+ T   +  CP+  Q ++L
Sbjct: 69  IECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIQT---RDACPLDNQPWQL 118

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 40/113 (35%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           + E+K    V  W WDI  DN                           C ICR +    C
Sbjct: 31  RFEIKKWTAVAFWSWDIAVDN---------------------------CAICRNHIMEPC 63

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KW+ T   +  CP+  Q + L
Sbjct: 64  IECQPLAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWHL 113

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 41/115 (35%), Gaps = 35/115 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           + EVK    V  W WDI  +N                           C ICR +    C
Sbjct: 23  RFEVKKWTAVAFWSWDIAVEN---------------------------CAICRNHIMEPC 55

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKE 111
             C+          C    G C H FH+HCI KWL T   +  CP+  Q ++  +
Sbjct: 56  IQCQPTAMTDTDNECVAAWGACNHAFHLHCINKWLQT---RNACPLDNQTWQFAK 107

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 41/113 (36%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           K E+K    V  W WDI  DN                           C ICR +    C
Sbjct: 29  KFEIKKWTAVAFWSWDIAVDN---------------------------CAICRNHIMEPC 61

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KW+ T   +  CP+  Q ++L
Sbjct: 62  IECQPMAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 111

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 50  CGICRFNYNRTCPNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           C ICR +    C  C+          C    G C H FH+HCI KWL T   +  CP+  
Sbjct: 72  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQT---RNACPLDN 128

Query: 105 QEFKLKE 111
           Q ++  +
Sbjct: 129 QPWQFAK 135

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 42.4 bits (98), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 40/113 (35%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           K ++K    V  W WDI  DN                           C ICR +    C
Sbjct: 15  KFQIKKWTAVAFWSWDIAVDN---------------------------CAICRNHIMEPC 47

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KW+ T   +  CP+  Q + L
Sbjct: 48  IECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWHL 97

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 50   CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
            C IC    +    + K+P K CP     C + FH  C+YKW   +++   CP+CR E  L
Sbjct: 1537 CAICYSTLHAV--DRKLPTKVCP----TCNNKFHGSCLYKWF-RSSNNNTCPLCRSEIAL 1589

Query: 110  K 110
            +
Sbjct: 1590 R 1590

>Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON}
            (57636..62351) [4716 nt, 1572 aa]
          Length = 1571

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K CP     C + FH  C+YKW   ++    CPMCR E  ++
Sbjct: 1530 KLPTKTCP----TCRNKFHGACLYKWF-RSSGNNTCPMCRSEIAIR 1570

>NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K CP     C + FH  C+YKW   ++    CP+CR E  L+
Sbjct: 1550 KLPTKTCP----TCKNKFHGACLYKWF-KSSGNNTCPLCRSEIALR 1590

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 41/113 (36%), Gaps = 35/113 (30%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           + +VK    V  W WDI  DN                           C ICR +    C
Sbjct: 35  RFQVKKWTAVAFWSWDIAVDN---------------------------CAICRNHIMEPC 67

Query: 62  PNCKVPGKR-----CPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
             C+          C    G C H FH+HCI KW+ T   +  CP+  Q ++L
Sbjct: 68  IECQPKAMTDTDTDCVAAWGTCNHAFHLHCINKWIKT---REACPLDNQPWQL 117

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1557

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 5/42 (11%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQE 106
            K+P K CP     C + FH  C+YKW   ++    CPMCR E
Sbjct: 1516 KLPTKTCP----TCNNKFHGACLYKWF-RSSGNNTCPMCRSE 1552

>KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {ON}
            Anc_8.799 YMR247C
          Length = 1560

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKE 111
            K+P K CP     C + FH  C+YKW   ++    CP+CR E   ++
Sbjct: 1519 KLPSKTCP----TCKNRFHGACLYKWF-RSSGNNTCPLCRSEIPFRK 1560

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
            YMR247C
          Length = 1568

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K CP     C + +H  C+YKW   ++    CPMCR E   +
Sbjct: 1527 KLPSKTCP----TCNNKYHGACLYKWF-RSSGNNTCPMCRSEIPFR 1567

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 38/104 (36%), Gaps = 35/104 (33%)

Query: 11  VFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTCPNCKV---- 66
           V  W WDI  DN                           C ICR +    C  C+     
Sbjct: 40  VAFWSWDIAVDN---------------------------CAICRNHIMEPCIECQPKAMT 72

Query: 67  -PGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
            P   C    G C H FH+HCI KW+ T   +  CP+  Q ++L
Sbjct: 73  DPDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQL 113

>Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar to
            Ashbya gossypii ABL058C
          Length = 1547

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 9/62 (14%)

Query: 50   CGICRFNYNRTCP-NCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFK 108
            C IC   Y+   P + K+P K CP     C + FH  C+YKW  ++ +   CP+CR E  
Sbjct: 1493 CAIC---YSILHPVDRKLPTKVCP----TCNNRFHGACLYKWFRSSGNNS-CPLCRSEIP 1544

Query: 109  LK 110
             +
Sbjct: 1545 FR 1546

>NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8.799
            YMR247C
          Length = 1564

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 5/45 (11%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
            K+P K CP     C + FH  C+YKW   ++    CP+CR E  L
Sbjct: 1523 KLPTKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRSEIPL 1562

>Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] {ON}
            YMR247C (REAL)
          Length = 1559

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K CP     C + FH  C+YKW   ++    CP+CR E   +
Sbjct: 1518 KLPSKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRSEIPFR 1558

>YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}
            RKR1RING domain E3 ubiquitin ligase; involved in the
            ubiquitin-mediated degradation of non-stop proteins;
            functional connections to chromatin modification; nuclear
            protein that also co-localizes with ribosomes; homolog of
            mouse Listerin, whose mutation has been reported to cause
            neurodegeneration in mice
          Length = 1562

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K CP     C + FH  C+YKW   ++    CP+CR E   +
Sbjct: 1521 KLPSKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRSEIPFR 1561

>Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] {ON}
            YMR247C (REAL)
          Length = 1564

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K CP     C + FH  C+YKW   ++    CP+CR E   +
Sbjct: 1523 KLPSKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRSEIPFR 1563

>Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] {ON}
            YMR247C (REAL)
          Length = 1566

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K CP     C + FH  C+YKW   ++    CP+CR E   +
Sbjct: 1525 KLPSKTCP----TCKNRFHGACLYKWF-RSSGNNTCPLCRSEIPFR 1565

>KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.799
            YMR247C
          Length = 1561

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K CP     C + FH  C+YKW   ++    CP+CR E   +
Sbjct: 1520 KLPNKTCP----TCKNRFHGACLYKWF-RSSGNNTCPLCRNEIPFR 1560

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKE 111
            K+P K CP     C + FH  C+YKW   ++    CP+CR E   ++
Sbjct: 1518 KLPTKTCP----TCNNKFHGACLYKWF-RSSGNNTCPLCRSEIPFRK 1559

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 12/77 (15%)

Query: 36  YSSGHNMVDEDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTT 95
           Y+S    V ++E+ C IC+  +N    N +V G         C H FH HCI +W+    
Sbjct: 96  YASFRKNVSDEEESCVICQEQFNEL-NNIRVLG---------CSHIFHSHCIDRWI--CR 143

Query: 96  SKGLCPMCRQEFKLKEG 112
           +   CP+C++ + L  G
Sbjct: 144 NSACCPLCKRSYSLPVG 160

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K CP     C + FH  C+YKW   ++    CP+CR E   +
Sbjct: 1509 KLPSKVCP----TCNNRFHGACLYKWF-RSSGNNTCPLCRSEIPFR 1549

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K CP     C + FH  C+YKW   ++    CP+CR E   +
Sbjct: 1533 KLPSKVCP----TCNNRFHGACLYKWF-RSSGNNTCPLCRSEIPFR 1573

>ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR247C
          Length = 1546

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K CP     C + FH  C+YKW   ++    CP+CR E   +
Sbjct: 1505 KLPSKVCP----TCSNRFHGACLYKWF-KSSGNNTCPLCRGEIPFR 1545

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K CP     C + FH  C+YKW   ++    CP+CR E   +
Sbjct: 1514 KLPTKTCP----TCNNKFHGSCLYKWF-RSSGNNTCPLCRGEIPFR 1554

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 37/106 (34%), Gaps = 35/106 (33%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           K ++K    V  W WDI  +N                           C ICR +    C
Sbjct: 27  KFQIKKWTAVAFWSWDIAVEN---------------------------CAICRNHIMEPC 59

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPM 102
             C+          C    G C H FH+HCI KWL T   +  CP+
Sbjct: 60  IQCQPNAMTDTDNECVAAWGTCNHAFHLHCINKWLLT---RNACPL 102

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 37/106 (34%), Gaps = 35/106 (33%)

Query: 2   KIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTC 61
           K ++K    V  W WDI  +N                           C ICR +    C
Sbjct: 21  KFQIKKWIAVAFWSWDIAVEN---------------------------CAICRNHIMEPC 53

Query: 62  PNCKVPG-----KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPM 102
             C+          C    G C H FH+HCI KWL T   +  CP+
Sbjct: 54  IQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLT---RNACPL 96

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 15/75 (20%)

Query: 47  EDVCGICRFNYNRTCPNCKVPGKRCPLVV--GNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           +++C ICR         CK      PL++   NC H F + CI  WL   +S   CP+CR
Sbjct: 112 DEICSICR---------CKFFDDDYPLIIELPNCKHYFDLECITLWLQKNSS---CPICR 159

Query: 105 QEFKLKEGVALNKSQ 119
            +  L++   ++ SQ
Sbjct: 160 NDV-LEKKFKIDDSQ 173

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 36/102 (35%), Gaps = 35/102 (34%)

Query: 14  WKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTCPNCKVPG----- 68
           W WDI  DN                           C ICR +    C  C+        
Sbjct: 36  WSWDIAVDN---------------------------CAICRNHIMEPCIECQPMAMTETD 68

Query: 69  KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
             C +    C H FH+HCI KW+ T   +  CP+  Q ++L 
Sbjct: 69  NECVVAWAACNHAFHLHCINKWIKT---RDACPLDNQPWQLA 107

>CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247c
          Length = 1544

 Score = 39.7 bits (91), Expect = 0.003,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 65   KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
            K+P K C      C + FH  C+YKW   ++    CP+CR E   +
Sbjct: 1503 KLPTKTC----STCKNKFHGACLYKWF-RSSGNNTCPLCRSEINFR 1543

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {ON}
           Anc_3.405 YPR093C
          Length = 102

 Score = 37.0 bits (84), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 3/32 (9%)

Query: 78  CFHNFHVHCIYKWLDTTTS---KGLCPMCRQE 106
           C H FH  CI KW  TTT    + LCP CR++
Sbjct: 29  CHHKFHSDCIRKWHTTTTGEIRRPLCPFCREQ 60

>Kpol_1072.55 s1072 (126281..127543) [1263 bp, 420 aa] {ON}
           (126281..127543) [1263 nt, 421 aa]
          Length = 420

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 10/61 (16%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           ++E++C IC  N             + P+ + +CFH +H +CI   + TT  +  CP CR
Sbjct: 339 QNEEICSICLNNI----------AIQQPVFISHCFHFWHFNCIMPIIQTTYPQFNCPNCR 388

Query: 105 Q 105
            
Sbjct: 389 S 389

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 37.4 bits (85), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 15/75 (20%)

Query: 47  EDVCGICRFNYNRTCPNCKVPGKRCPLV--VGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           ED C IC+ N+              PLV  V  C H F + C+  WL    +   CPMCR
Sbjct: 68  EDTCAICQCNFL---------DDPYPLVAKVPRCNHKFDLECLSIWLQNNHT---CPMCR 115

Query: 105 QEFKLKEGVALNKSQ 119
            + + K+ V ++ SQ
Sbjct: 116 DDLRSKK-VEIDTSQ 129

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 35/85 (41%), Gaps = 10/85 (11%)

Query: 61  CPN--CKVPGKRCPLVVGN---CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVAL 115
           CP   C +  +  P  VG    C H +H+ CI KW    +    CP+CR      E   L
Sbjct: 13  CPQDECSICWESMPSGVGRLMPCGHEYHLACIRKWFHLHSGNRSCPVCR-----TEASVL 67

Query: 116 NKSQEDVFKSLELKQARQRFGAFDE 140
             +  +V   L + Q    +G  DE
Sbjct: 68  VDTDHEVKIDLSVGQLLDFYGLLDE 92

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 5/42 (11%)

Query: 72  PLVV--GNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKE 111
           PLVV   NC H F + C+  WL  +T+   CPMCR +  +++
Sbjct: 103 PLVVELPNCGHTFDLQCVSVWLSRSTT---CPMCRSDVLVRK 141

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 35/89 (39%), Gaps = 23/89 (25%)

Query: 19  PNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYN---RTCPNCKVPGKRCPLVV 75
           P  N FI+   R    + S+         D C ICR  Y+    T   C          +
Sbjct: 186 PCTNEFIEQLPRTNCAELSNS-------SDECPICRIAYSDDFETEITC----------L 228

Query: 76  GNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
            NC H+FH  CI  WL       LCP+CR
Sbjct: 229 PNCSHHFHFECIKLWLQ---KNSLCPLCR 254

>AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL010C
          Length = 506

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           TCP C  ++      L+   C H FH  C+ KW D     G CP+CR
Sbjct: 211 TCPVCLERMDSDTTGLITTACQHTFHCQCLDKWKD-----GRCPVCR 252

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 17/31 (54%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFK 108
           C H FH+ CI KW  +  S   CP CR E +
Sbjct: 26  CQHEFHLSCIRKWYHSRISDRTCPNCRVEIR 56

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 36.2 bits (82), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 17/80 (21%)

Query: 47  EDVCGICRFNYNRTCPNCKVPGKRCPLVVG--NCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           +D C IC          C       PLVV   NC H F + CI  WL  +++   CPMCR
Sbjct: 87  DDTCAIC---------CCVYLEDSYPLVVKLPNCNHKFDLQCITLWLSKSST---CPMCR 134

Query: 105 QEF---KLKEGVALNKSQED 121
            +    K K   ++ + +ED
Sbjct: 135 NDVMSSKTKIDTSMVELEED 154

>ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]
           {ON} some similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 445

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 43/106 (40%), Gaps = 16/106 (15%)

Query: 74  VVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFK---------------LKEGVALNKS 118
           V+  C HN+   C+  W D+ +++  CP CR                   + E V  ++ 
Sbjct: 41  VMTQCGHNYCYDCLSSWFDSNSNELSCPQCRASISDPPSLNSVLQQWLVHIIELVGPDED 100

Query: 119 QEDVFKSLELKQARQRFGAFDEDVDVDLSGFINEEDYGVVGEREVG 164
            E+    L  K++ ++   FDE  D+   G       GVV E + G
Sbjct: 101 SEEFKTLLSAKESSEKSYRFDEKNDL-FGGVFKTSAMGVVDEDDDG 145

>TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON} Anc_8.761
            YMR231W
          Length = 1018

 Score = 37.0 bits (84), Expect = 0.018,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 20/113 (17%)

Query: 58   NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKG--LCPMCRQEFKLKEGVAL 115
            N  C  CK      P++   C H +H  C+ K LD  +     +CP C         +A 
Sbjct: 915  NEKCDYCKA-NLEIPIIYFQCGHTYHERCLNKELDQNSGDEVYVCPKC---------IAN 964

Query: 116  NKSQEDVF-KSLELKQARQRFGAFDEDVDVDLSGFINEEDYGVVGEREVGQGA 167
             +S E +F K  ++K+++       E +++DL    N  D   V    +G+GA
Sbjct: 965  KESTEALFNKQKDMKESK-------ELIEIDLKNAKNGSDCFKVVADFIGRGA 1010

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 35.8 bits (81), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 48  DVCGICRFNYNRTCPNCKVPGKRCPLVV--GNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           D C IC  NY            + PLVV   +C H F + C+  WL  +T+   CP+CR
Sbjct: 77  DNCSICYTNYLE---------DKYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 123

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 36.6 bits (83), Expect = 0.024,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR-QEFKLKEGVALN 116
           +CP C  ++      L+   C H FH  C+ KW ++      CP+CR    ++   + +N
Sbjct: 282 SCPVCLERMDSSITGLITIPCQHTFHCQCLNKWKNSK-----CPICRFSTLRISRDLVIN 336

Query: 117 KSQEDVFKS 125
           K Q ++  S
Sbjct: 337 KKQVNIKDS 345

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 14/59 (23%)

Query: 48  DVCGICRFNYNRTCPNCKVPGKRCPLVV--GNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           D C IC  NY              PLVV   +C H F + C+  WL  +T+   CP+CR
Sbjct: 107 DNCSICYTNYLE---------DEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 153

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 14/59 (23%)

Query: 48  DVCGICRFNYNRTCPNCKVPGKRCPLVV--GNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           D C IC  NY              PLVV   +C H F + C+  WL  +T+   CP+CR
Sbjct: 112 DNCSICYTNYLE---------DEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 158

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 14/67 (20%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNK 117
           TCP C  ++  +   LV   C H FH  C+ KW ++      CP+CR         +L  
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS-------SLRL 286

Query: 118 SQEDVFK 124
           S+E + K
Sbjct: 287 SRESLLK 293

>Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {ON}
            complement(56650..59700) [3051 nt, 1017 aa]
          Length = 1016

 Score = 36.2 bits (82), Expect = 0.036,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 8/105 (7%)

Query: 58   NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGL---CPMCRQEFKLKEGVA 114
            N  C  C+  G   P+VV  C HN+H  C+ +  D  T   +   CP C  + +  E +A
Sbjct: 914  NVNCCMCEA-GLELPIVVFKCTHNYHQRCLNEE-DKKTDGSIVYKCPKCIVDLESSERLA 971

Query: 115  LNKSQEDVFKSLELKQARQRFGAFDE-DVDVDLSGFINEEDYGVV 158
              KSQ++V  +++L +     G  D   V  D  G    ED  V+
Sbjct: 972  --KSQQEVKNNIKLVKMALNQGQEDSFKVVTDFIGRGGLEDKKVI 1014

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 36.2 bits (82), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           TCP C  ++  +   LV   C H FH  C+ KW ++      CP+CR
Sbjct: 239 TCPVCLERMDSETSGLVTIPCQHTFHCQCLNKWKNSR-----CPVCR 280

>TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON}
           Anc_7.416 YER116C
          Length = 208

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 16/77 (20%)

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTT---TSKGLCPMCRQEFKLKEGVALNK 117
           CP C  P +    V+  C H F V C+++ L+++      GLC +CR+   +++      
Sbjct: 139 CPICFDPPENS--VITPCGHTFCVSCLFQMLNSSRGPKKNGLCALCRKSVAIRD------ 190

Query: 118 SQEDVFKSLELKQARQR 134
                 K ++LK+ R R
Sbjct: 191 -----IKMIKLKKKRVR 202

>NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {ON}
           Anc_2.157 YHR115C
          Length = 554

 Score = 35.8 bits (81), Expect = 0.040,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 56  NYNRTCPNCKVPGKRC-PLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           N +  C  C    K C  + +  C H++H HCI + +  T  + +CP CR
Sbjct: 466 NEDEDCSICLSKIKACQAIFISPCAHSWHFHCIRRLVMLTYPQFVCPNCR 515

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 35.8 bits (81), Expect = 0.043,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 3/56 (5%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQEDVFKSLELKQARQ 133
           C H F   CIY+W   T     CP+CR E   +EG+  +   E+    +   + R+
Sbjct: 247 CGHRFGRMCIYQW---TKEHNSCPICRAEIVGREGLNRDLPDEETGDGISFDRIRE 299

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           TCP C  ++  +   LV   C H FH  C+ KW ++      CP+CR
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCR 280

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 14/67 (20%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNK 117
           TCP C  ++  +   LV   C H FH  C+ KW ++      CP+CR         +L  
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS-------SLRL 286

Query: 118 SQEDVFK 124
           S+E + K
Sbjct: 287 SRESLLK 293

>KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8.761
            YMR231W
          Length = 1036

 Score = 35.8 bits (81), Expect = 0.046,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 5/73 (6%)

Query: 58   NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGL--CPMCRQEFKLKEGVAL 115
            N+TC  CK+P    P+V   C H +H +C+ +   T  ++ +  CP C  E  L+    L
Sbjct: 933  NQTCFMCKLP-MHLPMVYFKCGHIYHQNCMDEEYSTEENELIFKCPKCIVE--LETSNRL 989

Query: 116  NKSQEDVFKSLEL 128
            +++Q++V    EL
Sbjct: 990  SEAQKEVATKTEL 1002

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
           similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 306

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 74  VVGNCFHNFHVHCIYKWLDTTTSKGL-CPMCRQEFKLKEGVALNKSQEDVF 123
           V+ +C HN+   CI  WL +  +  L CP CR    LKE  ALN + +++ 
Sbjct: 5   VMTSCGHNYCYECISNWLVSNNANELTCPQCRS--PLKEPPALNVALQNLL 53

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           TCP C  ++  +   L+   C H FH  C+ KW D+      CP+CR
Sbjct: 267 TCPVCLERMDSETTGLITIPCQHTFHCSCLDKWNDSR-----CPVCR 308

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 16/75 (21%)

Query: 48  DVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEF 107
           ++CGIC  + N T     +P          C H +HV CI KW    ++   CP CR+E 
Sbjct: 3   EICGICLESMNETDQGELLP----------CEHRYHVSCIRKW-HLYSNDFKCPTCRKES 51

Query: 108 KLKEGVALNKSQEDV 122
           K     +L +  +D+
Sbjct: 52  K-----SLRRKHDDI 61

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 35.4 bits (80), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           TCP C  ++  +   L    C H FH  C+ KW D+      CP+CR
Sbjct: 246 TCPVCLERLDSEVTGLATIPCQHTFHCQCLNKWKDSR-----CPVCR 287

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 34.7 bits (78), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 54  RFNYNRTCPNC--KVPGKRCPLVV--GNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
           +   + TCP C         PLVV   +C H F   C+  WL   T+   CPMCR +   
Sbjct: 97  KLKSDDTCPICCSNFIADEYPLVVELPHCGHKFDFECVSMWLTKNTT---CPMCRDDVTH 153

Query: 110 KE 111
           K+
Sbjct: 154 KK 155

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W -
           Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 74  VVGNCFHNFHVHCIYKWLDTTTSKGL-CPMCRQEFKLKEGVALNKSQEDVFK 124
           V+  C HN+   CI  WL +  +  L CP CR    LKE  +LN + +++ +
Sbjct: 5   VMTTCGHNYCYDCISNWLVSNNANELTCPQCRS--PLKEQPSLNSALQNLLE 54

>Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR231W
           (REAL)
          Length = 1028

 Score = 35.4 bits (80), Expect = 0.065,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 9/115 (7%)

Query: 17  DIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTCPNCKVPGKRCPLVVG 76
           +I  +   I++ ++EL        ++++ D+ +    +   N+TC  C +     P+V  
Sbjct: 885 EIKRNEKLIESYDKELNEKKEKLKSLINSDQPIHVPLK---NQTCFMCNLT-LDIPVVFF 940

Query: 77  NCFHNFHVHCIYKWLDTTTSKG---LCPMCRQEFKLKEGVALNKSQEDVFKSLEL 128
            C H +H HC+ +  DT  S+     CP C  E  L+    L ++Q +V +  +L
Sbjct: 941 KCGHTYHQHCLNEEEDTLESERKLFKCPKCLVE--LETSNKLYEAQHEVIQKNDL 993

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 35.4 bits (80), Expect = 0.065,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 8/67 (11%)

Query: 56  NYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVAL 115
           N   T P+ K    R P     C H F   C+YKW     S   CP+CR +     GV +
Sbjct: 258 NDEETNPSYKHSPIRLP-----CGHVFGRECLYKWSRLENS---CPLCRHKISESAGVPV 309

Query: 116 NKSQEDV 122
            +  ++V
Sbjct: 310 QQDTDEV 316

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 14/59 (23%)

Query: 48  DVCGICRFNYNRTCPNCKVPGKRCPLVV--GNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           D C IC  NY              PLVV   +C H F + C+  WL  +T+   CP+CR
Sbjct: 105 DNCSICYTNYLE---------DEYPLVVELPHCNHRFDLECLSVWLSRSTT---CPLCR 151

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 34.3 bits (77), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 14/77 (18%)

Query: 48  DVCGICRFNYNRTCPNCKVPGKRCPLVV--GNCFHNFHVHCIYKWLDTTTSKGLCPMCRQ 105
           D+C IC  N+              PLV+   +C H F + CI  WL   +S   CP+CR 
Sbjct: 85  DLCSICFENFRE---------DEYPLVIELPHCSHKFDLQCISVWL---SSNSTCPVCRD 132

Query: 106 EFKLKEGVALNKSQEDV 122
           +      + ++ ++ ++
Sbjct: 133 KVNHNAKLDIDTTEAEL 149

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 35.4 bits (80), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 8/53 (15%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR-QEFKL 109
           TCP C  ++  +   L+   C H FH  C+ KW ++      CP+CR   F+L
Sbjct: 246 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSK-----CPVCRLSSFRL 293

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {ON}
           Anc_3.405 YPR093C
          Length = 555

 Score = 35.0 bits (79), Expect = 0.073,   Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 3/29 (10%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGL-CPMCRQ 105
           C HNFH +CI +W    TSK L CP+CR+
Sbjct: 22  CQHNFHFNCIRQW--HLTSKSLECPVCRR 48

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 35.0 bits (79), Expect = 0.077,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQED 121
           C H F   CIYKW     S   CP+CR +     G+  N +Q+D
Sbjct: 256 CGHIFGRECIYKWSKLENS---CPLCRHKISESAGIQ-NTAQQD 295

>TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {ON}
           Anc_2.157 YHR115C
          Length = 521

 Score = 35.0 bits (79), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 61  CPNCKVPGKRCPLV-VGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQ 119
           C  C    K C  + +  C H++H HCI + +  +  + +CP CR    L+   +L  S 
Sbjct: 413 CSICLSAIKPCQAIFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSSCDLE--ASLESSS 470

Query: 120 ED 121
           ED
Sbjct: 471 ED 472

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 34.3 bits (77), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 31/75 (41%), Gaps = 16/75 (21%)

Query: 38  SGHNMVDEDEDVCGICRFNYNRTCPNCKVPGKRCPLVV--GNCFHNFHVHCIYKWLDTTT 95
           +  N+V  DE  C IC   YN             PLVV   +C H F + C+  WL    
Sbjct: 76  TARNLVKGDE--CSICCSKYNE---------DDYPLVVELPHCSHRFDLECLTPWL---L 121

Query: 96  SKGLCPMCRQEFKLK 110
               CP+CR +   K
Sbjct: 122 KNSTCPLCRDDVMEK 136

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 35.0 bits (79), Expect = 0.085,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 28/62 (45%), Gaps = 4/62 (6%)

Query: 41   NMVDEDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKW-LDTTTSKGL 99
            NM +     C  CR   N  C  C+ P K+  L   NC H  H  C+ +W LD   S+  
Sbjct: 1295 NMTNFGYWYCDSCR-KPNSLCVYCEQPMKKLALSFLNCGHGGHFECLQQWFLDEGMSE-- 1351

Query: 100  CP 101
            CP
Sbjct: 1352 CP 1353

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 35.0 bits (79), Expect = 0.087,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 6/45 (13%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNK-SQED 121
           C H F   CIYKW     S   CP+CRQ  K+ E V + + +Q+D
Sbjct: 257 CGHIFGRECIYKWSRLENS---CPLCRQ--KISESVGVQRAAQQD 296

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 34.3 bits (77), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 7/55 (12%)

Query: 54  RFNYNRTCPNCKVPGKR--CPLV--VGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           +   + +CP C    K    PLV  + +C H F + CI  WL  +TS   CP+CR
Sbjct: 96  KIKEDDSCPICCCTYKEDDHPLVAELPHCNHKFDLECISVWLSKSTS---CPLCR 147

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 34.7 bits (78), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 72  PLVVGNCFHNFHVHCIYKWLDTTTSKGL-CPMCRQEF 107
           P++ G C HN+   CI  WL+ T+S  L CP CR   
Sbjct: 48  PVMTG-CGHNYCYFCISNWLNNTSSTELNCPQCRSSI 83

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 34.7 bits (78), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           TCP C  ++      L+   C H FH  C+ KW ++      CP+CR
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCR 274

>KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some
           similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 279

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTT----SKGLCPMCRQEFKLKE 111
           CP C  P +    +V  C H F   C+Y  ++++       GLC +CR+  KL++
Sbjct: 212 CPICMEPPEAA--LVTKCGHVFCTTCLYGMVNSSKGNGRRNGLCALCRENVKLQD 264

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 8/61 (13%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR-QEFKLKEGVALN 116
           +CP C  ++      L+   C H FH  C+ KW D+      CP+CR    KL  G  L 
Sbjct: 236 SCPVCLERMDSDITGLITIPCQHTFHCQCLDKWKDSR-----CPVCRYSNLKLTRGNLLK 290

Query: 117 K 117
           +
Sbjct: 291 Q 291

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 7/48 (14%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQ 105
           TCP C  K+      L+   C H FH  C+ KW ++      CP+CR 
Sbjct: 240 TCPVCLEKMDSLVTGLITIPCSHTFHCQCLDKWKNSK-----CPVCRH 282

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR-QEFKLKEGVALN 116
           TCP C  ++      L+   C H FH  C+ KW ++      CP+CR    +L    A+ 
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSR-----CPVCRYSSIRLSRNSAVR 287

Query: 117 KSQE 120
           ++ E
Sbjct: 288 QTGE 291

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 33.1 bits (74), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 14/65 (21%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLVV--GNCFHNFHVHCIYKWLDTTTSKGLCPM 102
           +D + C IC  NY            + PLVV   +C H F + C+  WL  + +   CP+
Sbjct: 30  KDAEACSICCCNYR---------DDKYPLVVELPHCNHRFDLECVAVWLSKSRT---CPL 77

Query: 103 CRQEF 107
           CR + 
Sbjct: 78  CRDDV 82

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           TCP C  ++  +   L+   C H FH  C+ KW ++      CP+CR
Sbjct: 240 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSQ-----CPVCR 281

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score = 34.3 bits (77), Expect = 0.13,   Method: Composition-based stats.
 Identities = 34/138 (24%), Positives = 58/138 (42%), Gaps = 15/138 (10%)

Query: 43  VDEDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPM 102
           +D+ + +C IC  +   T    K+  +R  ++   C H  H  C+  W++ + +   CP+
Sbjct: 313 LDDTDSMCIICMDDMLPTTETTKM-NRRAKML--PCGHMLHFGCLKSWMERSQT---CPI 366

Query: 103 CRQEFKLKEGVALNKSQEDVFKSLELKQARQRFGAFDEDVDV----DLS-GFINEEDYGV 157
           CR      +  +   +Q       +L Q R      DE +DV    D+S   I+  +   
Sbjct: 367 CRLSVFANDSNSHATTQAREQTPPDLLQER----GIDEHIDVIGMQDMSVQSISLHEGTA 422

Query: 158 VGEREVGQGANGSNDGGL 175
           V     G   N + DGGL
Sbjct: 423 VRRGTTGNCMNQAYDGGL 440

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 8/63 (12%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR-QEFKLKEGVALN 116
            CP C  ++  +   L+   C H FH  C+ +W ++      CP+CR   F+L     + 
Sbjct: 170 ACPVCLERMDSETTGLITIPCQHTFHCQCLNRWKNSK-----CPVCRYSSFRLSRDTLMR 224

Query: 117 KSQ 119
            S+
Sbjct: 225 TSR 227

>KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.157
           YHR115C
          Length = 510

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 61  CPNCKVPGKRC-PLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQ 119
           C  C    K C  + +  C H++H HCI + +  +  + +CP CR    L+  +     +
Sbjct: 403 CSICLSKIKPCQAIFISPCSHSWHFHCIRRLVMVSYPQFVCPNCRASCDLEATLESEDGE 462

Query: 120 ED 121
           ED
Sbjct: 463 ED 464

>Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AGL079C
          Length = 532

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           TCP C  ++      L+   C H FH  C+ +W       G CP+CR
Sbjct: 234 TCPVCLERMDSDTTGLITTACQHTFHCQCLDQW-----KGGRCPVCR 275

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 33.9 bits (76), Expect = 0.21,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 31/69 (44%), Gaps = 8/69 (11%)

Query: 69  KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGV--ALNKSQ--EDVFK 124
           K CP  +  C H F   CI+KW   T     CP+CR      EG+  A+N S    D F 
Sbjct: 273 KHCPTEL-PCGHIFGRDCIFKW---TKEHNSCPICRSRIVEDEGLNHAINDSPVVMDEFD 328

Query: 125 SLELKQARQ 133
               ++ RQ
Sbjct: 329 RQSFERIRQ 337

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 33.9 bits (76), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 50   CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKW-LDTTTSK--GLCP 101
            C  C+   N +C  C+ P K+  +V+  C H  H  CI +W LD    +  G CP
Sbjct: 1283 CDSCK-KKNTSCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLDENEQECPGGCP 1336

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 32.3 bits (72), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 7/51 (13%)

Query: 58  NRTCP--NCKVPGKRCPLVV--GNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           N  CP   CK    + PL+V    C H F + CI  WL  + +   CP+CR
Sbjct: 46  NDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVT---CPLCR 93

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           +    C IC+ ++N+    C +           C H FH +CI +W+    +   CP+C+
Sbjct: 115 DSRTTCAICQEDFNKLNNVCLL----------GCNHVFHTYCIDQWI--CRNSACCPLCK 162

Query: 105 QEFKL 109
           + + L
Sbjct: 163 RSYSL 167

>YPL201C Chr16 complement(169770..171155) [1386 bp, 461 aa] {ON}
           YIG1Protein that interacts with glycerol 3-phosphatase
           and plays a role in anaerobic glycerol production;
           localizes to the nucleus and cytosol
          Length = 461

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 20/116 (17%)

Query: 41  NMVDEDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHV--HCIYKWLDTTTSK- 97
           N++  D  +C  C F YN       V  +   L+  NC  N +V  H + K   T++ + 
Sbjct: 155 NLLLSDAIICMDCNFGYNSNTIQILVGFQNGKLLKLNCDLNGNVNNHLLLKDPSTSSHQS 214

Query: 98  ---------GLCPMCRQEFKLKEGVALNKSQEDVFKSLELKQARQRFGAFDEDVDV 144
                    GL P     F LK+G+ +         SL+ +Q+   F +F  ++D+
Sbjct: 215 HLSILNVWAGLLPHFVVSFSLKDGLLI--------TSLDHQQSNGSFQSFHTNIDL 262

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 10/69 (14%)

Query: 38  SGHNMVDEDEDVCGICR--FNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTT 95
           S   +   D+ +C +C         C N K   KR P     C H  H+ C+  W++ + 
Sbjct: 304 SEAQLAASDDKMCIVCMDDMLAPSECTNAKQKPKRLP-----CNHCLHLGCLKSWMERSQ 358

Query: 96  SKGLCPMCR 104
           +   CP+CR
Sbjct: 359 T---CPICR 364

>NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.157
           YHR115C
          Length = 518

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 10/69 (14%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           E E+ C IC  +  R C           + +  C H++H HCI + +  +  + +CP CR
Sbjct: 424 EQEEDCSIC-LSKIRPCQA---------IFISPCAHSWHFHCIRRLVMLSYPQFVCPNCR 473

Query: 105 QEFKLKEGV 113
               L+  +
Sbjct: 474 SACDLEAAL 482

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 12/61 (19%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNK 117
           TCP C  ++  +   L    C H FH  C+ KW D       CP+CR       G+ L K
Sbjct: 226 TCPVCLERLDSEVTGLATIPCQHTFHCVCLNKWGDNR-----CPVCRY-----SGLKLTK 275

Query: 118 S 118
           S
Sbjct: 276 S 276

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           TCP C  ++      L+   C H FH  C+ KW ++      CP+CR
Sbjct: 234 TCPVCLERLDDGTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCR 275

>ZYRO0B03938g Chr2 complement(327333..327884) [552 bp, 183 aa] {ON}
           some similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 183

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTS---KGLCPMCRQEFKLKE 111
           CP C  P      V+  C H F V C+++ ++++ +    G C +CR E KLK+
Sbjct: 118 CPICFEPPDTA--VMTPCGHIFCVACLFQMVNSSRTHRKSGNCALCRSEVKLKD 169

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score = 33.5 bits (75), Expect = 0.28,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 6/70 (8%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEG--VALNKSQEDVFKSLELKQARQRF 135
           C H  H+ C+  W++ + +   CP+CR       G  +  N ++ D  ++ EL  A    
Sbjct: 371 CCHILHLGCLKNWMERSQT---CPICRLSVFDSNGNILPFNNTRSDTMRNTELT-ATNSN 426

Query: 136 GAFDEDVDVD 145
            A DE  + D
Sbjct: 427 DAADESTEND 436

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} similar
            to uniprot|Q92271 Saccharomyces cerevisiae YOL138C
            Hypothetical ORF
          Length = 1353

 Score = 33.5 bits (75), Expect = 0.29,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 1/42 (2%)

Query: 50   CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWL 91
            C +C    N  C  C+ P K+  + V NC H  H  C  KW 
Sbjct: 1296 CDLCS-KPNSLCVFCERPIKKLAMCVLNCGHEGHFECFKKWF 1336

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 32.3 bits (72), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 6/50 (12%)

Query: 72  PLVV--GNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQ 119
           PLVV   +C H+F + C+  W   +TS   CP+CR +  L     ++ SQ
Sbjct: 88  PLVVRLPHCGHDFDLECLSVWFSKSTS---CPLCRDDV-LSHRAEVDTSQ 133

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 11/64 (17%)

Query: 64  CKVPGKRCPLV--VGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQED 121
           CK    + PLV  + +C H F + CI  WL  + +   CP+CR      + V  +K+  D
Sbjct: 109 CKFLEDKYPLVAELPHCGHRFDLECISVWLSKSDT---CPLCR------DSVLSHKTDID 159

Query: 122 VFKS 125
           V K+
Sbjct: 160 VSKT 163

>Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}
           complement(48530..50287) [1758 nt, 586 aa]
          Length = 585

 Score = 33.1 bits (74), Expect = 0.33,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 61  CPNCKVPGKRC-PLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
           C  C    K C  + +  C H++H HCI + +  +  + +CP CR    L
Sbjct: 502 CSICLSAIKPCQAIFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSSCDL 551

>KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {ON}
           Anc_2.157 YHR115C
          Length = 551

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 10/63 (15%)

Query: 43  VDEDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPM 102
           V+++E+ C IC    ++  P C+       + +  C H++H HC+ + +  +  + +CP 
Sbjct: 444 VEQEEEDCSIC---LSKIKP-CQA------IFISPCSHSWHFHCVRRLVMLSYPQFVCPN 493

Query: 103 CRQ 105
           CR 
Sbjct: 494 CRS 496

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 60  TCPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           TCP C  ++  +   L+   C H FH  C+ KW ++      CP+CR
Sbjct: 237 TCPVCLEQLDCETTGLITIPCQHTFHCQCLDKWKNSR-----CPVCR 278

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 33.1 bits (74), Expect = 0.35,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 3/28 (10%)

Query: 78   CFHNFHVHCIYKWLDTTTSKGLCPMCRQ 105
            C H F  HCI+ WL    +K +CP+C++
Sbjct: 1166 CGHFFCKHCIFSWL---KNKSVCPICKK 1190

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 33.1 bits (74), Expect = 0.36,   Method: Composition-based stats.
 Identities = 23/91 (25%), Positives = 40/91 (43%), Gaps = 14/91 (15%)

Query: 18  IPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNY----NRTCPNCKVPGKRCPL 73
           IP+  H+ +   + + ++Y S +N       VC IC  +       T    K+  +    
Sbjct: 671 IPDGYHYHRPVPQSILMEYGSQNNCF-----VCPICMVDVPVYVEETEETHKIDAQS--Y 723

Query: 74  VVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           ++  C H FH  C+  W+   + K  CP+CR
Sbjct: 724 MITPCSHIFHTECLENWM---SYKLQCPVCR 751

>SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032W RAD5
           Single-stranded DNA-dependent ATPase involved in
           postreplication repair contains RING finger domain
          Length = 1127

 Score = 33.1 bits (74), Expect = 0.42,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 73  LVVGNCFHNFHVHCIYKWLDTTTSKGL---CPMCRQEFKLKEGVALNKSQEDV 122
           ++   C H F  HC+ +++D  T K L   CP CR+    K  + L +   +V
Sbjct: 888 VIFTECAHAFCEHCLLEYIDFQTQKKLELKCPNCRESIDPKRLLTLKERGGEV 940

>YJR119C Chr10 complement(644304..646490) [2187 bp, 728 aa] {ON}
           JHD2JmjC domain family histone demethylase specific for
           H3-K4 (histone H3 Lys4); removes methyl groups
           specifically added by Set1p methyltransferase; protein
           levels regulated by Not4p (E3 ubiquitin ligase)
           polyubiquitin-mediated degradation
          Length = 728

 Score = 33.1 bits (74), Expect = 0.42,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 11/74 (14%)

Query: 31  ELGIDYSSGHNMVDEDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKW 90
           +LG D +SG +  ++D+D C +CR          K    +  ++  +C   FH++C+   
Sbjct: 219 DLGPDSNSGSDFEEDDDDACIVCR----------KTNDPKRTILCDSCDKPFHIYCLSPP 268

Query: 91  LDTTTSKG-LCPMC 103
           L+   S   +C  C
Sbjct: 269 LERVPSGDWICNTC 282

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 7/46 (15%)

Query: 61  CPNC--KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           CP C  K+  +   LV   C H FH  C+ +W       G CP+CR
Sbjct: 215 CPVCLEKLDSEVTGLVTTPCQHTFHCKCLDQW-----KNGNCPVCR 255

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 33.1 bits (74), Expect = 0.42,   Method: Composition-based stats.
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 3/32 (9%)

Query: 78   CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKL 109
            C H F   CIY WL T T   +CP+C+ +  L
Sbjct: 1282 CGHFFCEDCIYDWLQTRT---ICPICKHKASL 1310

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 32.7 bits (73), Expect = 0.43,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQED 121
           C H F   C+YKW   TT    CP+CR     +E +    S +D
Sbjct: 219 CGHVFGRECLYKW---TTEHNSCPICRAPILSEEELQALHSSDD 259

>AGL289C Chr7 complement(164204..164929) [726 bp, 241 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER116C
           (SLX8)
          Length = 241

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 53  CRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTS---KGLCPMCRQEFKL 109
           C+   +  CP C  P +    ++  C H +   C+++ ++++      G C +CR++ KL
Sbjct: 165 CKKAMDYKCPICFDPPEAA--LMTPCGHIYCTVCLFQMVNSSRGYRRNGQCALCRKDVKL 222

Query: 110 KE 111
           KE
Sbjct: 223 KE 224

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 32.7 bits (73), Expect = 0.46,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 3/43 (6%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120
           C H F   CIYKW     S   CP+CR +     GV     Q+
Sbjct: 267 CGHIFGRECIYKWSRLENS---CPLCRHKISENAGVQRAAEQD 306

>Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON}
           (52842..54119) [1278 nt, 426 aa]
          Length = 425

 Score = 32.7 bits (73), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 72  PLVVGNCFHNFHVHCIYKWLDTTTSKGL-CPMCRQEFKLKEGVALNKSQEDVFKSL 126
           P++V  C HN+   C+  W  +  ++ L CP CR    +    ALN + + + ++L
Sbjct: 46  PMMVA-CGHNYCYSCLSSWFTSNETQELSCPQCRA--NVTTAPALNTTLQQLLETL 98

>Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {ON}
           similar to Ashbya gossypii AGL217W
          Length = 386

 Score = 32.7 bits (73), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 74  VVGNCFHNFHVHCIYKWLDTTTSKGL-CPMCRQEFKLKEGVALNKSQEDVFKSL 126
           V+ +C HN+  +CI  WL+   +  L CP CR    +    ALN S     +SL
Sbjct: 5   VMTSCGHNYCYYCISNWLNNNNATELNCPQCRT--TIGAMPALNVSLLQTLESL 56

>SAKL0C05698g Chr3 complement(539308..542775) [3468 bp, 1155 aa]
           {ON} weakly similar to uniprot|P21268 Saccharomyces
           cerevisiae YJL157C FAR1 Cyclin-dependent kinase
           inhibitor that mediates cell cycle arrest in response to
           pheromone also forms a complex with Cdc24p Ste4p and
           Ste18p that may specify the direction of polarized
           growth during mating potential Cdc28p substrate
          Length = 1155

 Score = 32.7 bits (73), Expect = 0.49,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 41/99 (41%), Gaps = 13/99 (13%)

Query: 54  RFNYNRTCPNCK------VPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEF 107
           RF YN TC  C       + G+R  +V   C H  H +C    L+TT  +   P C   +
Sbjct: 223 RFTYN-TCSMCDEKLSTALSGER--VVELTCGHQCHHNCYLAVLETTLPENQFPACDTCY 279

Query: 108 KL---KEGVALNKSQEDVFKSLELKQARQRFGAFDEDVD 143
           K+   +    LN     +  + E  +  QRFG     VD
Sbjct: 280 KVTKPRMDSVLNSMTSSLLTNRE-PELHQRFGRMSVSVD 317

>ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL116W and
           YHR115C
          Length = 467

 Score = 32.7 bits (73), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 13/70 (18%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLV-VGNCFHNFHVHCIYKWLDTTTSKGLCPMC 103
           E+ED C IC          CK+  K C  + +  C H++H  CI + + T   + +CP C
Sbjct: 364 EEED-CSICL---------CKI--KPCQAIFISPCSHSWHYQCIRRLVMTQYPQFICPNC 411

Query: 104 RQEFKLKEGV 113
           R    L+  +
Sbjct: 412 RSSCDLEASL 421

>Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 2/66 (3%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFK-LKEGVALNKSQEDVFKSLELKQARQRFG 136
           C H FH++CI +W   +     CP+CR E   LK G   N    D+     +K A +   
Sbjct: 23  CRHEFHLNCIREWHKYSIDLK-CPICRTESSHLKVGEGQNAVSVDLKMGFMIKHALEHAE 81

Query: 137 AFDEDV 142
           A   D 
Sbjct: 82  ATTTDA 87

>KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {ON}
           some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 479

 Score = 32.7 bits (73), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 1/54 (1%)

Query: 61  CPNCKVPGKRCPLV-VGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGV 113
           C  C    K C  + +  C H++H  C+ + + TT  + +CP CR    L+  +
Sbjct: 398 CSICLSKIKPCQAIFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLEASL 451

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 32.7 bits (73), Expect = 0.55,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 5/52 (9%)

Query: 60   TCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKE 111
            +CP C   GK     +  C H F   CI+ WL    S   CPMC+    + E
Sbjct: 1153 SCPICL--GKITMGAIIKCGHFFCRSCIHSWLKNHNS---CPMCKTSTSIME 1199

>ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116W DMA2 Protein involved in regulating spindle
           position and orientation functionally redundant with
           Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 579

 Score = 32.3 bits (72), Expect = 0.56,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 61  CPNCKVPGKRC-PLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           C  C    K C  + +  C H++H  CI + + T+  + +CP CR
Sbjct: 493 CSICLSKIKPCQAMFISPCSHSWHFQCIRRLVMTSYPQFVCPNCR 537

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 31.2 bits (69), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 14/69 (20%)

Query: 41  NMVDEDEDVCGICRFNYNRTCPNCKVPGKRCPLV--VGNCFHNFHVHCIYKWLDTTTSKG 98
           ++ D   D C IC          C     + PL+  + +C HNF   C+  WL   +   
Sbjct: 25  DLKDPINDSCSICC---------CTYADDKYPLISKLPHCGHNFDYECLSIWL---SKNK 72

Query: 99  LCPMCRQEF 107
            CPMCR + 
Sbjct: 73  TCPMCRDDI 81

>Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116W
           (REAL)
          Length = 580

 Score = 32.3 bits (72), Expect = 0.60,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 13/67 (19%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRC-PLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMC 103
           E+ED C IC          CK+  K C  + +  C H++H  C+ + +  +  + +CP C
Sbjct: 487 EEED-CSICL---------CKI--KPCQAIFISPCAHSWHFRCVRRLVMLSYPQFICPNC 534

Query: 104 RQEFKLK 110
           R    L+
Sbjct: 535 RSSCDLE 541

>Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON}
           YHR115C (REAL)
          Length = 413

 Score = 32.3 bits (72), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 11/69 (15%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           E ED C IC    N+  P C+       + +  C H++H HC+ + +  +  + +CP CR
Sbjct: 318 EQED-CSIC---LNKIKP-CQA------IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCR 366

Query: 105 QEFKLKEGV 113
               L+  +
Sbjct: 367 SNCDLETTL 375

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054W PSH1 Nuclear protein putative RNA polymerase II
           elongation factor isolated as Pob3p/Spt16p- binding
           protein
          Length = 331

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 74  VVGNCFHNFHVHCIYKWLDTTTSKGL-CPMCR 104
           V+ +C HN+   CI  WL+   +  L CP CR
Sbjct: 5   VMTSCGHNYCYDCISNWLNNNNATELTCPQCR 36

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 32.3 bits (72), Expect = 0.70,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 4/55 (7%)

Query: 50   CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWL---DTTTSKGLCP 101
            C  C+   N  C  C+ P K+  +V+  C H  H  CI +W    +     G CP
Sbjct: 1268 CDSCK-KKNTLCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLNENEHECPGGCP 1321

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 32.3 bits (72), Expect = 0.72,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 27/67 (40%), Gaps = 15/67 (22%)

Query: 56   NYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQ---------- 105
            N    C  C  P     +V  NC H F   CI+ WL    ++  CP+C+           
Sbjct: 1159 NTTMECSICLQPITNGAMV--NCGHLFCTSCIFSWL---KNRKTCPLCKHPTSNCEVYNF 1213

Query: 106  EFKLKEG 112
             FKL+ G
Sbjct: 1214 TFKLESG 1220

>Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {ON}
           YNL116W - Hypothetical ORF [contig 204] FULL
          Length = 470

 Score = 32.0 bits (71), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 1/54 (1%)

Query: 61  CPNCKVPGKRCPLV-VGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGV 113
           C  C    K C  + +  C H++H  C+ + + TT  + +CP CR    L+  +
Sbjct: 389 CSICLSKIKPCQAIFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLEASL 442

>TPHA0K00700 Chr11 (144606..145232) [627 bp, 208 aa] {ON} Anc_7.416
           YER116C
          Length = 208

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 6/55 (10%)

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTT----SKGLCPMCRQEFKLKE 111
           CP C  P      V+ NC H F   C++  ++++     S G+C +CR   K K+
Sbjct: 141 CPICMDPPTAA--VITNCGHIFCNDCLFPMINSSKKNARSDGICALCRCNVKCKD 193

>TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.157
           YHR115C
          Length = 885

 Score = 32.0 bits (71), Expect = 0.78,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 61  CPNCKVPGKRC-PLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           C  C    K C  + +  C H++H HCI + +     + +CP CR
Sbjct: 769 CSICLSKIKPCQAIFISPCSHSWHFHCIRRLVMLQYPQFVCPNCR 813

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {ON}
           Anc_8.808 YOL054W
          Length = 392

 Score = 32.0 bits (71), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 74  VVGNCFHNFHVHCIYKWLDTTTSKGL-CPMCRQEF 107
           ++ +C HN+   C+  W+ T + K L CP CR + 
Sbjct: 41  MMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDI 75

>Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ACR267C
          Length = 474

 Score = 32.0 bits (71), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 13/67 (19%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLV-VGNCFHNFHVHCIYKWLDTTTSKGLCPMC 103
           E+ED C IC          CK+  K C  + +  C H++H  CI + + T   + +CP C
Sbjct: 373 EEED-CSICL---------CKI--KPCQAIFISPCSHSWHYQCIRRLVMTQYPQFVCPNC 420

Query: 104 RQEFKLK 110
           R    L+
Sbjct: 421 RSSCDLE 427

>NCAS0A14550 Chr1 complement(2867437..2868228) [792 bp, 263 aa] {ON}
           Anc_7.416 YER116C
          Length = 263

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTS---KGLCPMCRQEFKLKE 111
           CP C  P +    ++  C H F   C+++ ++++ +    G C +CR+E +L++
Sbjct: 197 CPICMDPPETA--LIAPCGHVFCCDCLFQMVNSSRTYRKDGHCALCRKEVRLRD 248

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
            YOL138C (REAL)
          Length = 1332

 Score = 32.0 bits (71), Expect = 0.83,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 4/55 (7%)

Query: 50   CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKW-LDTTTSK--GLCP 101
            C  C+   N  C  C+ P K+  +V+  C H  H  CI +W LD    +  G CP
Sbjct: 1274 CDSCK-KKNTPCILCERPLKKLTMVILPCGHEGHFQCIQEWFLDEKEHECPGGCP 1327

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 43/106 (40%), Gaps = 16/106 (15%)

Query: 4   EVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGIC-----RFNYN 58
           ++  +Y      W I  +N   Q  +  L +      N  +ED ++C IC          
Sbjct: 305 DILALYQSATGLWKIWRNNK--QLDDSLLTVTVEQLQNSANED-NICIICMDELIHSTNQ 361

Query: 59  RTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           +T  N     KR P     C H  H+ C+  W++ + +   CP+CR
Sbjct: 362 QTWKNKNKKPKRLP-----CGHILHLSCLKNWMERSQT---CPICR 399

>Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON}
           YHR115C (REAL)
          Length = 416

 Score = 32.0 bits (71), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 11/61 (18%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           E ED C IC    N+  P C+       + +  C H++H HC+ + +  +  + +CP CR
Sbjct: 323 EQED-CSIC---LNKIKP-CQA------IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCR 371

Query: 105 Q 105
            
Sbjct: 372 S 372

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score = 32.0 bits (71), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 41/82 (50%), Gaps = 9/82 (10%)

Query: 25  IQNKERELGIDYSSGHNMVDEDEDVCGICR--FNYNRTCPNCKVPGKRCPLVVGNCFHNF 82
           + N++ +  +   + H +   ++ +C IC    + N    N +   KR P ++  C H  
Sbjct: 301 VNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFE---KRKPKMLP-CGHIL 356

Query: 83  HVHCIYKWLDTTTSKGLCPMCR 104
           H++C+  W++ + +   CPMCR
Sbjct: 357 HMNCLKNWMERSQT---CPMCR 375

>CAGL0A03432g Chr1 (349884..353339) [3456 bp, 1151 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032w RAD5
          Length = 1151

 Score = 32.0 bits (71), Expect = 0.99,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 4/68 (5%)

Query: 61  CPNCKV-PGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGL---CPMCRQEFKLKEGVALN 116
           C  C   P +    VV  C H F   C+ ++ +    K L   CP CR++  L   +A  
Sbjct: 897 CSICTAEPIESSSAVVTECEHVFCKECLEEYGNFQKEKSLQQKCPNCRRDINLNRCLAFE 956

Query: 117 KSQEDVFK 124
           K  + + K
Sbjct: 957 KGSDGILK 964

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 32.0 bits (71), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 4/55 (7%)

Query: 50   CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSK---GLCP 101
            C  C+   N  C  C+ P K+  +V+  C H  H  CI +W      +   G CP
Sbjct: 1278 CDSCK-KRNSLCVLCERPLKKLTMVLLPCGHEGHFQCIQEWFLNEKERECPGGCP 1331

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1333

 Score = 32.0 bits (71), Expect = 1.0,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 1/42 (2%)

Query: 50   CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWL 91
            C  CR   N  C  C+ P K+  + +  C H FH  C  +W 
Sbjct: 1275 CDSCR-KPNTLCVICEQPMKKLAICLLECGHEFHFECGQQWF 1315

>SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q75BK4 Ashbya gossypii ACR267C
           ACR267Cp and some similarites with YNL116W
           uniprot|P53924 Saccharomyces cerevisiae YNL116W DMA2
           Protein involved in regulating spindle position and
           orientation functionally redundant with Dma1p homolog of
           S. pombe Dma1 and H. sapiens Chfr
          Length = 475

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 9/86 (10%)

Query: 61  CPNCKVPGKRCPLV-VGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQ 119
           C  C    K C  + +  C H++H  C+ + + T+  + +CP CR    L+   +L+   
Sbjct: 389 CSICLSKIKPCQAIFISPCSHSWHYQCVRRLVMTSYPQFVCPNCRSSCDLE--ASLDSDF 446

Query: 120 EDVFKSLELKQARQRFGAFDEDVDVD 145
           ED       +   + FG   EDV  +
Sbjct: 447 EDS------ESDDENFGVIMEDVKTE 466

>Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {ON}
           YHR115C (REAL)
          Length = 269

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 1/54 (1%)

Query: 61  CPNCKVPGKRC-PLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGV 113
           C  C    K C  + +  C H++H HC+ + +  +  + +CP CR    L+  +
Sbjct: 180 CSICLNKIKPCQAIFISPCAHSWHFHCVRRLVILSYPQFMCPNCRSNCDLEATL 233

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 31.6 bits (70), Expect = 1.1,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQ 105
           C H F   C+YKW   T  +  CP+CR 
Sbjct: 264 CHHIFGRECLYKW---TRHENTCPLCRH 288

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 31.6 bits (70), Expect = 1.2,   Method: Composition-based stats.
 Identities = 30/108 (27%), Positives = 42/108 (38%), Gaps = 15/108 (13%)

Query: 18   IPNDNHFIQNKER----ELGIDYSSGHNMVDEDEDVCGICRFNYNRTCPNCKVPGKRCPL 73
            I ND+ + QN +     E  I Y +  N++ E        R N +  C  C        +
Sbjct: 1185 IRNDDKYSQNLKHINTAESRIKYLNSLNILRES------ARDNKSFNCTICLNQIYTGSI 1238

Query: 74   VVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQED 121
            +   C H F   CI  WL    S   CP+C+ E  L E       +ED
Sbjct: 1239 I--KCGHFFCKKCIQSWLKNKNS---CPLCKTETGLSEIYNFKFKEED 1281

>YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA
           helicase proposed to promote replication fork regression
           during postreplication repair by template switching;
           RING finger containing ubiquitin ligase; stimulates the
           synthesis of free and PCNA-bound polyubiquitin chains by
           Ubc13p-Mms2p
          Length = 1169

 Score = 31.6 bits (70), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGL---CPMCRQEFKLKEGVALNKSQEDVFKSLELK 129
           C H+F   C++++++   SK L   CP CR +      +AL ++  +  K+LE K
Sbjct: 932 CGHSFCEKCLFEYIEFQNSKNLGLKCPNCRNQIDACRLLALVQTNSNS-KNLEFK 985

>YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}  PEP5Component
            of CORVET tethering complex; peripheral vacuolar membrane
            protein required for protein trafficking and vacuole
            biogenesis; interacts with Pep7p
          Length = 1029

 Score = 31.6 bits (70), Expect = 1.3,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 14/94 (14%)

Query: 58   NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKG---LCPMCRQEFKLKEGVA 114
            N+TC  C++     P+V   C H +H HC+ +  DT  S+     CP C  +  L+    
Sbjct: 925  NQTCFMCRLT-LDIPVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKCLVD--LETSNK 981

Query: 115  LNKSQEDVFKSLEL--------KQARQRFGAFDE 140
            L ++Q +V +  +L        + +R RF    E
Sbjct: 982  LFEAQHEVVEKNDLLNFALNSEEGSRDRFKVITE 1015

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 31.2 bits (69), Expect = 1.4,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 62  PNCKVPG--KRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQ 119
           PN   P   K  P+V+  C H F   C++KW     S   CP+CR   K+ E  A  +S 
Sbjct: 201 PNVMEPPTYKHSPVVL-PCNHVFGRECLFKWSQLENS---CPLCRH--KIVEAAA-GQSG 253

Query: 120 ED 121
           ED
Sbjct: 254 ED 255

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL138C
            - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 31.6 bits (70), Expect = 1.4,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 4/53 (7%)

Query: 50   CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKW-LDTTTSKGLCP 101
            C +C    N  C  C+ P K+  + + +C H  H  C  +W +D   S+  CP
Sbjct: 1228 CDLCS-RMNTLCALCERPLKKLTMCILSCGHEGHPECFQRWFMDEEMSE--CP 1277

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
            similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 58   NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKW--LDTTTSKGLCPMCRQEFKL 109
            ++ C  C +  KR  LV GNC H  H  C  +W  LD     G    C + F +
Sbjct: 1078 SKNCTYCGLKTKRRILVCGNCQHILHASCAVEWWQLDEECPSGCGCYCPKMFNV 1131

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} similar
            to uniprot|Q92271 Saccharomyces cerevisiae YOL138C
            Hypothetical ORF
          Length = 1321

 Score = 31.2 bits (69), Expect = 1.5,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 33/80 (41%), Gaps = 12/80 (15%)

Query: 34   IDYSSGHNMVDE--DEDVCGICRFNY---------NRTCPNCKVPGKRCPLVVGNCFHNF 82
            ++ SS   ++ E  + +   + RF Y         N  C  C  P K   + + NC H  
Sbjct: 1236 VNESSKEKIIKERLEGNSSAMSRFGYWYCDSCSKRNTLCCFCNKPMKSLAISMLNCGHEG 1295

Query: 83   HVHCIYKWLDTTTSKGLCPM 102
            H  C+ KW     +  +CP+
Sbjct: 1296 HFECLKKWF-FDENMDVCPL 1314

>KLLA0E12475g Chr5 complement(1100281..1103196) [2916 bp, 971 aa]
           {ON} highly similar to uniprot|P09440 Saccharomyces
           cerevisiae YBR084W MIS1 Mitochondrial
           C1-tetrahydrofolate synthase involved in interconversion
           between different oxidation states of tetrahydrofolate
           (THF) provides activities of formyl-THF synthetase
           methenyl-THF cyclohydrolase and methylene-THF
           dehydrogenase
          Length = 971

 Score = 31.2 bits (69), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 98  GLCPMCRQ-----EFKLKEGVALNKSQEDVFKSLE-LKQARQRFGAFD 139
           G   MC+Q     +F +   VA+NK + D    ++ +K+A QR GAFD
Sbjct: 771 GTANMCKQIENIKQFGVPVVVAINKFESDTEAEIDAIKEAAQRVGAFD 818

>KAFR0I00200 Chr9 (39428..41689) [2262 bp, 753 aa] {ON} Anc_7.9
           YAL056W
          Length = 753

 Score = 31.2 bits (69), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 127 ELKQARQRFGAFDEDVDVDLSGFINEEDYGVVGEREVGQGANGSNDG 173
           +LKQ  +  GA+D D+D D   F+N+ED   +  R +G   N    G
Sbjct: 593 DLKQNFEFNGAYDSDLDFDPETFMNKEDLENI--RRIGVNTNEKRGG 637

>YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}
           DMA1Ubiquitin-protein ligase (E3); controls septin
           dynamics and the spindle position checkpoint (SPOC)
           along with functionally redundant ligase Dma2p by
           regulating the recruitment of Elm1p to the bud neck;
           regulates levels of the translation initiation factor
           eIF2 subunit Gcd11p, as well as abundance, localization,
           and ubiquitination of Cdk inhibitory kinase Swe1p;
           ortholog of human RNF8 protein, with sequence similarity
           to human Chfr; contains FHA and RING finger domains
          Length = 416

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 11/69 (15%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           E ED C IC    N+  P C+       + +  C H++H HC+ + +     + +CP CR
Sbjct: 323 EQED-CSIC---LNKIKP-CQA------IFISPCAHSWHFHCVRRLVIMNYPQFMCPNCR 371

Query: 105 QEFKLKEGV 113
               L+  +
Sbjct: 372 TNCDLETTL 380

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 31.2 bits (69), Expect = 1.7,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 65  KVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQEDVFK 124
           KV  K  P+ +  C H F   CI +W   T     CP+CR      +G+  N + +D+  
Sbjct: 215 KVTYKHSPVQL-PCSHVFGRECIRQW---TNLHNTCPICRANIVGADGLNNNFAMDDLED 270

Query: 125 SLELKQARQ 133
              L++ R+
Sbjct: 271 QASLERIRR 279

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 5/38 (13%)

Query: 72  PLVVG--NCFHNFHVHCIYKWLDTTTSKGLCPMCRQEF 107
           PLVV   +C H F + C+  WL  + +   CP+CR + 
Sbjct: 96  PLVVKLPHCSHRFDLECVAVWLSKSRT---CPLCRDDV 130

>AEL104W Chr5 (431236..434493) [3258 bp, 1085 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL157C (FAR1)
          Length = 1085

 Score = 31.2 bits (69), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 36/90 (40%), Gaps = 10/90 (11%)

Query: 46  DEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKG---LCPM 102
           + + C IC  N N       + G+R  +V   C H  H HC +  L+ +        C +
Sbjct: 213 NSNACSICGENLNAL-----LAGER--IVELTCDHQSHYHCYFTLLEVSVQNDKYPRCQL 265

Query: 103 CRQEFKLKEGVALNKSQEDVFKSLELKQAR 132
           C QE K K    L   +  +  +  L+  +
Sbjct: 266 CGQERKPKSDEILTDMKSSILLTKPLRSTQ 295

>ZYRO0G15642g Chr7 complement(1271054..1274128) [3075 bp, 1024 aa]
            {ON} similar to uniprot|P12868 Saccharomyces cerevisiae
            YMR231W PEP5 Peripheral vacuolar membrane protein
            required for protein trafficking and vacuole biogenesis
            forms complex with Pep3p that promotes vesicular
            docking/fusion reactions in conjunction with SNARE
            proteins also interacts with Pep7p
          Length = 1024

 Score = 31.2 bits (69), Expect = 1.7,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 5/86 (5%)

Query: 58   NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGL--CPMCRQEFKLKEGVAL 115
            N+TC  C       P+V   C H +H  C+ +       + L  CP C  E +  E +  
Sbjct: 920  NKTCFMCHT-ALELPIVFFKCRHIYHQRCLNEEESAKEGRRLFRCPRCMAELETSEKIF- 977

Query: 116  NKSQEDVFKSLELKQARQRFGAFDED 141
             ++Q+++ K  +L +     G   ED
Sbjct: 978  -QTQQEMSKKTDLLKIALDNGDDSED 1002

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 31.2 bits (69), Expect = 1.7,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 11/44 (25%)

Query: 71   CPLVVG--------NCFHNFHVHCIYKWLDTTTSKGLCPMCRQE 106
            CP+ +G        +C H F  +CI+ WL   ++   CP+C+++
Sbjct: 1271 CPICLGLIHTGSMISCGHFFCNNCIFSWLKLNSN---CPLCKRD 1311

>KLTH0C06094g Chr3 (531296..531883) [588 bp, 195 aa] {ON} some
           similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 195

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTT---SKGLCPMCRQEFKLKE 111
           CP C  P +    +V  C H F   C+++ ++++    S G C +CR++ + K+
Sbjct: 130 CPICFDPPE--AALVTPCGHVFCTECLFQMVNSSRGQRSAGHCALCRRDVRFKD 181

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 8/42 (19%)

Query: 63  NCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           N K   KR P     C H  H++C+  W++ + +   CP+CR
Sbjct: 337 NTKNKPKRLP-----CGHVLHLYCLKNWMERSQT---CPICR 370

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQED 121
           C H F   CIY+W   T     CP+CR     +EG+ + +S +D
Sbjct: 231 CGHVFGRVCIYQW---TKENNSCPICRANIVGREGL-IQRSPDD 270

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} similar
            to uniprot|Q92271 Saccharomyces cerevisiae YOL138C
            Hypothetical ORF
          Length = 1290

 Score = 31.2 bits (69), Expect = 1.8,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 15/34 (44%)

Query: 58   NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWL 91
            N  C  C+ P K+    V NC H  H  C  KW 
Sbjct: 1240 NTLCVLCEQPLKKLTFCVLNCGHEGHPECFKKWF 1273

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 43/107 (40%), Gaps = 29/107 (27%)

Query: 9    YPVFAWKWDIP--------------NDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICR 54
            Y    ++W++P               ++ ++ N   E+GI++      V  D   CG  R
Sbjct: 1015 YSSLLYQWNLPIERVKVLKASTIKKEEDRYLTNYTEEVGIEW------VRND---CG--R 1063

Query: 55   FNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCP 101
               NR C  C +  +    V GNC H  H+ C  +W + +     CP
Sbjct: 1064 EGLNR-CTYCHLKAQYSIFVCGNCQHVLHLKCSKEWWNVSKE---CP 1106

>Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR231W
           (REAL)
          Length = 1030

 Score = 30.8 bits (68), Expect = 2.0,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 58  NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKG---LCPMCRQEFKLKEGVA 114
           N+TC  C +     P+V   C H +H HC+ +  DT  ++     CP C  E  L+    
Sbjct: 926 NQTCFMCNLT-LDVPVVFFKCGHIYHQHCLNEEEDTLKNERKLFKCPKCLVE--LETSNK 982

Query: 115 LNKSQEDVFKSLEL 128
           L ++Q++V +  +L
Sbjct: 983 LFEAQQEVVEKNDL 996

>KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {ON}
           Anc_2.157 YHR115C
          Length = 427

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 43/103 (41%), Gaps = 20/103 (19%)

Query: 44  DEDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMC 103
           D   ++C IC          CK+  +   L    C H +H  CI  +++       CP C
Sbjct: 333 DTRHELCSIC-------LEECKLQHR---LFFAPCSHCWHSACIQPYMNKDVPLFTCPNC 382

Query: 104 RQEFKLKEGVALNKSQEDVFKSLELKQARQRFGAFDEDVDVDL 146
           R  F L        S++D+ +  E+ Q  +  G F E+ +V +
Sbjct: 383 RCIFDL--------SEDDITEIAEMFQREK--GIFLENTNVTV 415

>NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1393

 Score = 30.8 bits (68), Expect = 2.1,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 1/42 (2%)

Query: 50   CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWL 91
            C  CR   N  C  C+ P K+  L    C H  H  C   W 
Sbjct: 1336 CDSCR-KPNSLCVICECPMKKLTLTALRCGHEAHFQCFKNWF 1376

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 44/106 (41%), Gaps = 16/106 (15%)

Query: 4   EVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGIC-----RFNYN 58
           +V  +Y      W I  +N   Q  +  + +      N  +ED ++C IC         +
Sbjct: 301 DVLALYQSGTSLWKIWRNNK--QLDDALITVTAEQLQNSANED-NICIICMDELMHSQAD 357

Query: 59  RTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           +T  N     KR P     C H  H+ C+  W++ + +   CP+CR
Sbjct: 358 QTWKNKNKKPKRLP-----CGHILHLSCLKNWMERSQT---CPICR 395

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 30.8 bits (68), Expect = 2.2,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 74  VVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           +V  C H FH  C+  W+   + K  CP+CR
Sbjct: 732 MVTPCAHIFHTQCLENWM---SYKLQCPVCR 759

>Kwal_56.23866 s56 (748823..751273) [2451 bp, 816 aa] {ON} YLR115W
           (CFT2) - Component of cleavage factor II (CF II);
           105-kDa protein associated with polyadenylation factor 1
           (PF I) [contig 171] FULL
          Length = 816

 Score = 30.8 bits (68), Expect = 2.2,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 91  LDTTTSKGLCPMCRQEFKLKEGVALNKSQEDVFKSLELKQARQ 133
           L  TT +GLC + +    L E ++LN   +DV  S+  K A++
Sbjct: 348 LIATTVQGLCQLEKTTVILTEPISLNSESQDVLTSMYEKWAKK 390

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 30.8 bits (68), Expect = 2.2,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQ 105
           C H F   C+YKW   T  +  CP+CR 
Sbjct: 281 CKHIFGRECLYKW---TRVQNTCPLCRH 305

>KLLA0F23892g Chr6 complement(2229493..2231049) [1557 bp, 518 aa]
           {ON} some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 518

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 61  CPNCKVPGKRCPLV-VGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           C  C    K C  V +  C H++H  CI + +  T  + +CP CR
Sbjct: 392 CSICLSKIKACQAVFIAPCSHSWHFKCIRQLVSKTYPQFVCPNCR 436

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 30.8 bits (68), Expect = 2.3,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 3/34 (8%)

Query: 78   CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKE 111
            C H F   CI+ WL    S   CP+C+ +  + E
Sbjct: 1238 CGHFFCQSCIFSWLKNHAS---CPLCKMQTSMSE 1268

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 30.8 bits (68), Expect = 2.3,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 74  VVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           +V  C H FH  C+  W+   + K  CP+CR
Sbjct: 725 MVTPCAHVFHTECLENWM---SYKLQCPVCR 752

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score = 30.4 bits (67), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 48  DVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           D+C +C  ++  +    K  GK+  ++   C H  H+ C+  W+  + +   CP+CR
Sbjct: 351 DICIVCMEDFLPSHQR-KSDGKKVKIL--PCTHALHLSCLKNWIARSPT---CPICR 401

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 30.4 bits (67), Expect = 2.6,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 3/56 (5%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQEDVFKSLELKQARQ 133
           C H F   CI +W   T     CP+CR      +G+  +   +D+   + L++ R+
Sbjct: 231 CGHIFGRECIRQW---TNEHNTCPICRARIVGADGLEDHSVNDDLEDQISLERIRR 283

>NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa]
           {ON} Anc_2.157 YHR115C
          Length = 521

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 10/39 (25%), Positives = 19/39 (48%)

Query: 72  PLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLK 110
           P+ +  C H++H  C+   +        CP C+ +F L+
Sbjct: 357 PIFISPCSHHWHYKCVKDLITVEYPFFFCPTCKNQFDLE 395

>Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032W
           (REAL)
          Length = 1171

 Score = 30.4 bits (67), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGL---CPMCRQEFKLKEGVALNKSQEDVFKSLELK 129
           C H+F   C+++++D    K L   CP CR        +AL + + D  + LE K
Sbjct: 934 CGHSFCEKCLFEYIDFQNGKKLCLKCPNCRDSIDGGRLLALGRQRSDS-ERLEFK 987

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score = 30.4 bits (67), Expect = 2.8,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 9/79 (11%)

Query: 108 KLKEGVA-LNKSQEDVFKSLELKQARQRFGAFDEDVDVDLSGFINE--EDYGVVGEREVG 164
           KL +G+  L   ++     LEL  A  + G F +D D     F+ E   +  +  ++E  
Sbjct: 279 KLSDGIEILTDGEKGKNADLELNSAPVKLGPFPQDED-----FVKEVETELKIKDDQEAA 333

Query: 165 -QGANGSNDGGLAQDPTMV 182
            QG + SND G    PT+V
Sbjct: 334 AQGVSESNDSGETAKPTLV 352

>Ecym_7137 Chr7 (277509..278300) [792 bp, 263 aa] {ON} similar to
           Ashbya gossypii AGL289C
          Length = 263

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTS---KGLCPMCRQEFKLKE 111
           CP C  P +    ++  C H +   C+++ ++++      G C +CR++ KLKE
Sbjct: 197 CPICFDPPE--AALMTPCGHVYCTVCLFQMVNSSRGYRRNGQCALCRKDVKLKE 248

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 30.4 bits (67), Expect = 3.0,   Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 78   CFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKE 111
            C H +   CI+ WL+ +  K  CP+C+ E  + +
Sbjct: 1152 CGHYYCQDCIWNWLEKSKKKN-CPICKIETNIND 1184

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 30.4 bits (67), Expect = 3.0,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 74  VVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           +V  C H FH  C+  W+   + K  CP+CR
Sbjct: 718 MVTPCGHIFHTQCLESWM---SYKLQCPVCR 745

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 30.4 bits (67), Expect = 3.1,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           C H FH  C+  W+   + K  CP+CR
Sbjct: 718 CSHIFHTQCLESWM---SYKLQCPVCR 741

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 30.4 bits (67), Expect = 3.1,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           C H FH  C+  W+   + K  CP+CR
Sbjct: 721 CSHIFHTQCLESWM---SYKLQCPVCR 744

>Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054W
           (REAL)
          Length = 411

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGL-CPMCRQEF 107
           C HN+   C+  W  + T K L CP CR + 
Sbjct: 45  CGHNYCYGCLNTWFSSNTQKELACPQCRSDI 75

>NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {ON}
           Anc_2.411
          Length = 1137

 Score = 30.4 bits (67), Expect = 3.1,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 3/55 (5%)

Query: 73  LVVGNCFHNFHVHCIYKWLDTTTSKGL---CPMCRQEFKLKEGVALNKSQEDVFK 124
           +V   C H F   CI ++ +    K L   CP CR++      + + K + + FK
Sbjct: 897 IVFTECGHPFCESCIEEYFEFQAGKNLELKCPNCREQINSNRLLTVEKIEAETFK 951

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 3/47 (6%)

Query: 75   VGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQED 121
            +  C H F   CI+ WL    +K  CP+C+ E  + E  +     ED
Sbjct: 1176 IIKCGHFFCKSCIHSWL---RNKNACPLCKMETNITEVYSFKLQDED 1219

>TDEL0B03490 Chr2 complement(621849..624920) [3072 bp, 1023 aa] {ON}
           Anc_8.761 YMR231W
          Length = 1023

 Score = 30.4 bits (67), Expect = 3.1,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 4/61 (6%)

Query: 72  PLVVGNCFHNFHVHCIYKWLDTTTSKGL--CPMCRQEFKLKEGVALNKSQEDVFKSLELK 129
           P+V   C H +H+ C+ +   +   K L  CP C  E +  E   L ++Q +    LEL 
Sbjct: 931 PIVYFKCDHIYHMRCLNEEAVSEEGKKLFRCPKCLIELETSE--KLFQAQREASTKLELL 988

Query: 130 Q 130
           Q
Sbjct: 989 Q 989

>KLTH0E04312g Chr5 complement(388173..391268) [3096 bp, 1031 aa]
           {ON} similar to uniprot|P12868 Saccharomyces cerevisiae
           YMR231W PEP5 Peripheral vacuolar membrane protein
           required for protein trafficking and vacuole biogenesis
           forms complex with Pep3p that promotes vesicular
           docking/fusion reactions in conjunction with SNARE
           proteins also interacts with Pep7p
          Length = 1031

 Score = 30.4 bits (67), Expect = 3.2,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 3/67 (4%)

Query: 58  NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGL--CPMCRQEFKLKEGVAL 115
           N+TC  C+      PLV   C H +H  C+ +   + ++     CP C  +F+  E +  
Sbjct: 925 NQTCNICQT-ALSAPLVFFKCDHIYHQRCLNEEESSESNNRFFRCPQCVVDFEASENMKR 983

Query: 116 NKSQEDV 122
            +S+  +
Sbjct: 984 AQSETQI 990

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQE-FKLKEGVAL---NKSQEDVFKSLELKQARQ 133
           C H  H+ C+  W++ + +   CP+CR   F  K  VAL   N +Q+ +  S +   A+Q
Sbjct: 339 CNHCLHLGCLKSWMERSQT---CPICRVSVFDSKGNVALPNQNAAQQPI--SEDASVAQQ 393

Query: 134 RFGAFDEDVDVDLSG 148
              A +E     L+ 
Sbjct: 394 PLSAANESNSTSLAS 408

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 30.0 bits (66), Expect = 3.4,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 74  VVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           +V  C H FH  C+  W+   + K  CP+CR
Sbjct: 729 MVTPCNHIFHTECLENWM---SYKLQCPVCR 756

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 30.0 bits (66), Expect = 3.4,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQE 106
           C H F   C+YKW     S   CP+CR +
Sbjct: 246 CDHIFGRECLYKWSKLENS---CPLCRHK 271

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_8.288
            YDR128W
          Length = 1120

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 3/44 (6%)

Query: 58   NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCP 101
            +R+C  C +  K    + G+C H  H  C  +W    T+ G CP
Sbjct: 1066 HRSCNYCNLKVKGTAFICGSCQHILHSSCAKEWW---TTGGECP 1106

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 46  DEDVCGICRFNY-----NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLC 100
           D+++C IC          +T  N     KR P     C H  H+ C+  W++ + +   C
Sbjct: 345 DDNICIICMDELIHSPNQQTWKNKNKKPKRLP-----CGHILHLSCLKNWMERSQT---C 396

Query: 101 PMCR 104
           P+CR
Sbjct: 397 PICR 400

>NCAS0H01910 Chr8 complement(369281..372130) [2850 bp, 949 aa] {ON}
           Anc_5.400 YHR098C
          Length = 949

 Score = 30.0 bits (66), Expect = 3.6,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 20/42 (47%)

Query: 58  NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGL 99
           + T  N  V   R  ++ G C+  F    +Y W+D  T+K L
Sbjct: 784 DTTMENVAVRASRAHIMQGGCYFIFQGEVVYLWIDANTNKML 825

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 30.0 bits (66), Expect = 3.7,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 39/98 (39%), Gaps = 14/98 (14%)

Query: 12  FAWKWDIPNDNHFIQNKERELGIDYSSG--HNMVDEDEDVCGICRFN---YNRTCPNCKV 66
           F  K  IP+   + +    E   ++ SG   N VD     C IC  +   Y    P    
Sbjct: 664 FLPKHTIPDGYTYFKPLSNEYISEHGSGAAENTVD-----CTICMSDVPIYIEEIPETHK 718

Query: 67  PGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
             +   +V   C H FH  C+  W+   + K  CP+CR
Sbjct: 719 VDQHSYMVT-PCDHVFHTSCLENWM---SYKLQCPVCR 752

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 31/64 (48%), Gaps = 10/64 (15%)

Query: 43  VDEDEDVCGICRFNY--NRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLC 100
           +++  ++C +C  +   N    N  +  K+ P     C H  H+ C+  W++ + +   C
Sbjct: 305 LNQGNNMCIVCMDDMLPNSETRNANLKPKKLP-----CGHILHLSCLKSWMERSQT---C 356

Query: 101 PMCR 104
           P+CR
Sbjct: 357 PICR 360

>Sklu_YGOB_Anc_8.869 Chr4 (39275..39280,39349..40008) [666 bp, 221
           aa] {ON} ANNOTATED BY YGOB - Replaces SAKL0D00484g to
           add intron.
          Length = 221

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 88  YKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQEDVFKSLE 127
           YK L  T ++  CP C++ FK K+ V LN + +D   +LE
Sbjct: 139 YKLLQETKNETKCPSCQKVFKSKDIVTLNPNCKDEQDALE 178

>SAKL0D00484g Chr4 (39205..40008) [804 bp, 267 aa] {OFF} conserved
           hypothetical protein
          Length = 267

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 88  YKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQEDVFKSLE 127
           YK L  T ++  CP C++ FK K+ V LN + +D   +LE
Sbjct: 185 YKLLQETKNETKCPSCQKVFKSKDIVTLNPNCKDEQDALE 224

>Smik_14.212 Chr14 (387986..389575) [1590 bp, 529 aa] {ON} YNL116W
           (REAL)
          Length = 529

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 13/67 (19%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLV-VGNCFHNFHVHCIYKWLDTTTSKGLCPMC 103
           E+ED C IC          CK+  K C  + +  C H++H  C+ + +  +  + +CP C
Sbjct: 436 EEED-CSICL---------CKI--KPCQAIFISPCAHSWHFRCVRRLVMLSYPQFVCPNC 483

Query: 104 RQEFKLK 110
           R    L+
Sbjct: 484 RSSCDLE 490

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 14/59 (23%)

Query: 48  DVCGIC--RFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           D C IC  RF  +      ++P         +C H F + CI  WL    +   CPMCR
Sbjct: 90  DTCSICFERFGNDNYPLLAQLP---------HCGHIFDLQCISMWLSNQVT---CPMCR 136

>YNL116W Chr14 (408341..409909) [1569 bp, 522 aa] {ON}
           DMA2Ubiquitin-protein ligase (E3); controls septin
           dynamics and the spindle position checkpoint (SPOC)
           along with functionally redundant ligase Dma1p by
           regulating the recruitment of Elm1p to the bud neck;
           regulates levels of the translation initiation factor
           eIF2 subunit Gcd11p, as well as abundance, localization,
           and ubiquitination of Cdk inhibitory kinase Swe1p;
           ortholog of human RNF8 protein, with sequence similarity
           to human Chfr; contains FHA and RING finger domains
          Length = 522

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 13/67 (19%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLV-VGNCFHNFHVHCIYKWLDTTTSKGLCPMC 103
           E+ED C IC          CK+  K C  + +  C H++H  C+ + +  +  + +CP C
Sbjct: 429 EEED-CSICL---------CKI--KPCQAIFISPCAHSWHFRCVRRLVMLSYPQFVCPNC 476

Query: 104 RQEFKLK 110
           R    L+
Sbjct: 477 RSSCDLE 483

>Skud_14.216 Chr14 (398407..399999) [1593 bp, 530 aa] {ON} YNL116W
           (REAL)
          Length = 530

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 13/67 (19%)

Query: 45  EDEDVCGICRFNYNRTCPNCKVPGKRCPLV-VGNCFHNFHVHCIYKWLDTTTSKGLCPMC 103
           E+ED C IC          CK+  K C  + +  C H++H  C+ + +  +  + +CP C
Sbjct: 437 EEED-CSICL---------CKI--KPCQAIFISPCAHSWHFRCVRRLVMLSYPQFVCPNC 484

Query: 104 RQEFKLK 110
           R    L+
Sbjct: 485 RSSCDLE 491

>Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)
           [1008 nt, 336 aa]
          Length = 335

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 3/37 (8%)

Query: 70  RCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQE 106
           RC L    C H FH+ CI  W  +      CP CR E
Sbjct: 17  RCAL--NPCHHTFHLECIRIW-HSYADDLKCPTCRTE 50

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] {ON}
            YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 19/40 (47%)

Query: 55   FNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTT 94
            F+ +R C  C++  K    V GNC H  H  C  +W   +
Sbjct: 1045 FHLSRNCNYCELHVKGRGFVCGNCQHILHATCAKRWWSVS 1084

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 8/71 (11%)

Query: 34  IDYSSGHNMVDEDEDVCGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDT 93
           +D ++GH  +D  +  C IC  +      + KV  K+  ++   C H  H  C+  W+  
Sbjct: 324 LDVTAGH--LDGVDITCTIC-MDDMLPSKDVKVNNKKAKML--PCGHMLHFGCLKSWMQR 378

Query: 94  TTSKGLCPMCR 104
             +   CP+CR
Sbjct: 379 AQT---CPICR 386

>Skud_13.400 Chr13 (707700..710792) [3093 bp, 1030 aa] {ON} YMR231W
           (REAL)
          Length = 1030

 Score = 29.6 bits (65), Expect = 4.6,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 51/115 (44%), Gaps = 9/115 (7%)

Query: 17  DIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRTCPNCKVPGKRCPLVVG 76
           +I  +   I++ ++EL          ++ D+ +    +   N+ C  C +     P+V  
Sbjct: 887 EIKRNEKLIESYDKELNEKKEKLKGTINSDQPIHVPLK---NQVCFMCNLK-LEIPVVFF 942

Query: 77  NCFHNFHVHCIYKWLDTTTSKG---LCPMCRQEFKLKEGVALNKSQEDVFKSLEL 128
            C H +H HC+ +  DT  ++     CP C  E  L+    L ++Q +V +  +L
Sbjct: 943 KCGHIYHQHCLNEEEDTLKNERKLFKCPKCLVE--LETSNKLYEAQREVVEKNDL 995

>SAKL0F13046g Chr6 complement(1026073..1026882) [810 bp, 269 aa]
           {ON} weakly similar to uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 269

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 37/83 (44%), Gaps = 19/83 (22%)

Query: 44  DEDEDVCGICRFNYNRTCPNC----KVPGKRCPL--------VVGNCFHNFHVHCIYKWL 91
           D+ ED+      N   +CP      K    RCP+        ++  C H F   C+++ +
Sbjct: 176 DDSEDIMS----NMKDSCPTPIQHKKASEYRCPICFDPPDAALMTPCGHIFCTECLFQMV 231

Query: 92  DTTT---SKGLCPMCRQEFKLKE 111
           +++      G C +CR++ K K+
Sbjct: 232 NSSRGYRKHGHCALCRKDVKFKD 254

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 42/106 (39%), Gaps = 16/106 (15%)

Query: 4   EVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNY-----N 58
           +V  +Y      W I  +N   Q  +  + +      N  +ED ++C IC          
Sbjct: 304 DVLALYQSATTLWKIWRNNK--QLDDTLITVTIEQMQNSANED-NICIICMDELIHSANQ 360

Query: 59  RTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           +   N     KR P     C H  H+ C+  W++ + +   CP+CR
Sbjct: 361 QAWKNKNKKPKRLP-----CGHILHLSCLKNWMERSQT---CPICR 398

>TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.808
           YOL054W
          Length = 478

 Score = 29.6 bits (65), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 48/111 (43%), Gaps = 20/111 (18%)

Query: 72  PLVVGNCFHNFHVHCIYKWLDTTTSKGL-CPMCRQEF--------KLKEGVAL------- 115
           P+V   C H+F   C+  W  ++   GL CP CR            LK+ + +       
Sbjct: 40  PMVTP-CGHSFCYGCLCSWFSSSNVDGLSCPHCRTSITSAPYFNSTLKQWLEIFLDTLDD 98

Query: 116 NKSQEDVFKSLELKQARQRFGAFDEDVDVD--LSGFINEEDYGVVGEREVG 164
           N   +D+FKS+  +   + F  + +D + D   +G  +E    V+ E + G
Sbjct: 99  NDKIKDIFKSM-TEGKEESFKKYQKDKNNDQLYNGVFSETALAVIDEDDDG 148

>Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON}
            (40266..43685) [3420 nt, 1140 aa]
          Length = 1139

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 3/47 (6%)

Query: 55   FNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCP 101
            FN  R C  C +   R     GNC H  H +C  +W +++     CP
Sbjct: 1082 FNTVRNCCFCNLKLTRSIFNCGNCQHVMHSYCAKEWWNSSNE---CP 1125

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 29.6 bits (65), Expect = 5.3,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 32/79 (40%), Gaps = 8/79 (10%)

Query: 30  RELGIDYSSGHNMVDEDEDV-CGICRFN---YNRTCPNCKVPGKRCPLVVGNCFHNFHVH 85
           + L  +Y S H     +  V C IC  +   Y    P      +   +V   C H FH  
Sbjct: 679 KALSTEYISEHGGGTAENTVDCAICMSDVPIYIEEVPETHKVDQHSYMVT-PCNHVFHTP 737

Query: 86  CIYKWLDTTTSKGLCPMCR 104
           C+  W+   + K  CP+CR
Sbjct: 738 CLENWM---SYKLQCPVCR 753

>NCAS0J01730 Chr10 (317401..321687) [4287 bp, 1428 aa] {ON}
           Anc_4.291
          Length = 1428

 Score = 29.6 bits (65), Expect = 5.4,   Method: Composition-based stats.
 Identities = 9/31 (29%), Positives = 21/31 (67%)

Query: 120 EDVFKSLELKQARQRFGAFDEDVDVDLSGFI 150
           ED+ K+L+ K  R+++ ++D D + +  G++
Sbjct: 790 EDILKTLDFKIKREKYNSYDSDEEEEQDGYL 820

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 5/43 (11%)

Query: 64  CKVPGKRCPLV--VGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           CK      PL+  + +C H+F   CI  WL   +    CP+CR
Sbjct: 111 CKYTDDDYPLIAQLPHCGHHFDFECISIWL---SKNETCPICR 150

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
            similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 29.3 bits (64), Expect = 6.1,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 50   CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKW-LDTTTSKGLCP 101
            C +C+   +  C  C+ P K+  + + +C H  H  C  +W LD   ++  CP
Sbjct: 1260 CDLCK-KPSSLCVFCETPMKKLTMCLLHCGHEGHFGCFKRWFLDEGMTE--CP 1309

>Kwal_47.17599 s47 complement(473358..477110) [3753 bp, 1250 aa] {ON}
            YAL002W (VPS8) - Vps8p is a membrane-associated
            hydrophilic protein which contains a C-terminal
            cysteine-rich region that conforms to the H2 variant of
            the RING finger Zn2+ binding motif. [contig 206] FULL
          Length = 1250

 Score = 29.3 bits (64), Expect = 6.2,   Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 70   RCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMC 103
            +C ++  +CFH FH+ C+ K L  +     C +C
Sbjct: 1217 KCSIIAFSCFHAFHIRCL-KNLGQSEGSYKCLVC 1249

>NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1311

 Score = 29.3 bits (64), Expect = 6.5,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 20/52 (38%), Gaps = 2/52 (3%)

Query: 50   CGICRFNYNRTCPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCP 101
            C  C+   N  C  C+ P K+  + +  C H  H  C   W        +CP
Sbjct: 1253 CDSCK-KPNSLCIFCERPMKKLTMAILQCGHEAHFQCFRSWF-LDDGMDICP 1302

>NDAI0A01490 Chr1 (329693..330586) [894 bp, 297 aa] {ON} Anc_7.416
           YER116C
          Length = 297

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSK---GLCPMCRQEFKLKE 111
           CP C  P      ++  C H F   C+++ ++++ +    G C +CR   KLK+
Sbjct: 227 CPICMDPPDEA--LLTPCGHVFCCDCLFQMVNSSRTNRRDGHCALCRSSVKLKD 278

>CAGL0J09460g Chr10 complement(928455..929489) [1035 bp, 344 aa]
           {ON} similar to uniprot|P40507 Saccharomyces cerevisiae
           YIL079c and similar to uniprot|Q12476 Saccharomyces
           cerevisiae YDL175c
          Length = 344

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 49/119 (41%), Gaps = 23/119 (19%)

Query: 4   EVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGIC--RFNYNRTC 61
           ++K + P      + PN+  F++ + R  G+D S G   + E E  C  C  R ++ R C
Sbjct: 26  DIKVVAPSIEQVGNDPNELRFLRGEGRYFGLDDSEG---IKEPEPKCRNCSQRGHFKRDC 82

Query: 62  PN--CKVPG-------KRCPLVV--GNC--FHNFHVHCIYKWLDTTTSKGLCPMCRQEF 107
           P+  C   G       + CP  +   NC    ++   C  KW      +  C +C  + 
Sbjct: 83  PHVICTFCGSMDDHYSQHCPKAIKCANCNKVGHYRSQCPNKW-----KRVFCTLCNSKL 136

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQE 106
           C H FH++CI +W   + +   CP+CR E
Sbjct: 23  CGHKFHLNCIREWHKYSINLK-CPICRVE 50

>TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.157
           YHR115C
          Length = 524

 Score = 28.9 bits (63), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 61  CPNCKVPGKRC-PLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCR 104
           C  C    K C  + +  C H +H  CI + + T+  + +CP CR
Sbjct: 436 CSICLSKIKPCQAMFISPCSHCWHFQCIRRLVMTSYPQFVCPNCR 480

>Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQE 106
           C H FH++CI +W   +     CP+CR E
Sbjct: 23  CRHQFHLNCIREWHKYSIDLK-CPICRIE 50

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.140    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,259,223
Number of extensions: 1006914
Number of successful extensions: 3023
Number of sequences better than 10.0: 294
Number of HSP's gapped: 3052
Number of HSP's successfully gapped: 294
Length of query: 184
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 81
Effective length of database: 41,670,801
Effective search space: 3375334881
Effective search space used: 3375334881
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)