Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.435.699ON51351322450.0
Smik_9.235.699ON52743015590.0
Skud_9.225.699ON53742915310.0
YIL146C (ATG32)5.699ON52943014350.0
ZYRO0G06666g5.699ON5033936566e-79
TDEL0B022205.699ON4893926494e-78
CAGL0H06545g5.699ON4921563988e-42
SAKL0E14850g5.699ON4703273652e-37
NCAS0G002605.699ON5103153513e-35
TBLA0E020905.699ON7491663502e-34
Ecym_40215.699ON4594053264e-32
KNAG0L021005.699ON4443203113e-30
AFR283W5.699ON4523153071e-29
KLTH0E01122g5.699ON4723193035e-29
Kwal_55.197165.699ON4673113011e-28
KAFR0D022505.699ON5561433003e-28
KLLA0A00660g5.699ON5243412293e-19
TPHA0D045805.699ON47053870.045
Ecym_25608.507ON816106723.7
Suva_3.1791.39ON35683704.3
ZYRO0G07612g4.6ON1695101697.6
Smik_12.114.6ON1661101698.3
NOTE: 1 genes in the same pillar as Suva_9.43 were not hit in these BLAST results
LIST: Kpol_2001.73

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.43
         (513 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   869   0.0  
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   605   0.0  
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   594   0.0  
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   557   0.0  
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   257   6e-79
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   254   4e-78
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...   157   8e-42
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   145   2e-37
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...   139   3e-35
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...   139   2e-34
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   130   4e-32
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....   124   3e-30
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...   122   1e-29
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...   121   5e-29
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...   120   1e-28
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...   120   3e-28
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...    93   3e-19
TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON}             38   0.045
Ecym_2560 Chr2 complement(1090441..1092891) [2451 bp, 816 aa] {O...    32   3.7  
Suva_3.179 Chr3 (272175..273245) [1071 bp, 356 aa] {ON} YCL034W ...    32   4.3  
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...    31   7.6  
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...    31   8.3  

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/513 (84%), Positives = 432/513 (84%)

Query: 1   MVLDYQHRETKGXXXXXXXXXXXXXXIRPRSEGQAEEDKGLLDPHLSVLELLGKTGSSPS 60
           MVLDYQHRETKG              IRPRSEGQAEEDKGLLDPHLSVLELLGKTGSSPS
Sbjct: 1   MVLDYQHRETKGSSSKNMAPNSSSMNIRPRSEGQAEEDKGLLDPHLSVLELLGKTGSSPS 60

Query: 61  PLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120
           PLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGASFIPERCSSQTTNGSILSSSDTSE
Sbjct: 61  PLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120

Query: 121 EEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDVVC 180
           EEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDVVC
Sbjct: 121 EEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDVVC 180

Query: 181 IDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTPK 240
           IDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTPK
Sbjct: 181 IDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTPK 240

Query: 241 EYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQ 300
           EYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQ
Sbjct: 241 EYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQ 300

Query: 301 VKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDLSLEYVXXXXXXXXXXXXXXXI 360
           VKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDLSLEYV               I
Sbjct: 301 VKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDLSLEYVEDEKNEDEDEDNDDEI 360

Query: 361 IQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRWFTWGVSITIGISFGCCVTYFV 420
           IQP                                 TRWFTWGVSITIGISFGCCVTYFV
Sbjct: 361 IQPYSRSYYRSKKGGSSKKKSSKSNKKSKKKKQRSSTRWFTWGVSITIGISFGCCVTYFV 420

Query: 421 TAAYDHQTIRXXXXXXXXXXXXXXXXXXXDTDGHSRHYFCLFWGHASDKLQFGRIHYEKS 480
           TAAYDHQTIR                   DTDGHSRHYFCLFWGHASDKLQFGRIHYEKS
Sbjct: 421 TAAYDHQTIRSLNSRSSFFASFLSLDPSSDTDGHSRHYFCLFWGHASDKLQFGRIHYEKS 480

Query: 481 QRHKGNMGTISIKTLIFPLMNLIGFWHSVIFYY 513
           QRHKGNMGTISIKTLIFPLMNLIGFWHSVIFYY
Sbjct: 481 QRHKGNMGTISIKTLIFPLMNLIGFWHSVIFYY 513

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/430 (71%), Positives = 332/430 (77%), Gaps = 11/430 (2%)

Query: 1   MVLDYQHRETKGXXXXXXXXXXXXXXIRPRSEGQAEEDKGLLDPHLSVLELLGKTGSSPS 60
           MVL+Y  RE K               I  RS+ QAEED+GLLDPHLSVLELLGKTG SPS
Sbjct: 1   MVLNYPQREIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPS 60

Query: 61  PLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120
           P+GQSLVTSIDIS H NV D+ISGSWQ IQPLDLGASFIPERCSSQTTNGSILSSSDTSE
Sbjct: 61  PMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120

Query: 121 EEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDVVC 180
           EEQ+LLQAPAADIINIIKQGQ+GT+VTS SHPF+QLH VISLP+P RE+T Y EQ+    
Sbjct: 121 EEQELLQAPAADIINIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDI--- 177

Query: 181 IDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTPK 240
             NDD++G YEEDSVTITKSLTSSTNSFVMPKLSLS+KNPVFRLLILGRTG+NFYQS PK
Sbjct: 178 --NDDEDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPK 235

Query: 241 EYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQ 300
           EYQSLFELPK HDS  FPQYTGI+I+FQELREMVSLLNRIV+Y+QGKPIIPICQPGQTIQ
Sbjct: 236 EYQSLFELPKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQ 295

Query: 301 VKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDLSLEYVXXXXXXXXXXXXXXXI 360
           VKNVLKSFL+N LIKLL+PPVV TNRKDLKKMFQRLQDLSLEY                 
Sbjct: 296 VKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSLEYAEDENEEGDDDETT--- 352

Query: 361 IQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRWFTWGVSITIGISFGCCVTYFV 420
                                               T WFTWG+SITIGISFGCCVTYFV
Sbjct: 353 ---KSRSYYRYKKANNSKRKSPKSNKKPKKKKQRFFTSWFTWGISITIGISFGCCVTYFV 409

Query: 421 TAAYDHQTIR 430
           TAAYDHQT++
Sbjct: 410 TAAYDHQTVK 419

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/429 (72%), Positives = 331/429 (77%), Gaps = 3/429 (0%)

Query: 1   MVLDYQHRETKGXXXXXXXXXXXXXXIRPRSEGQAEEDKGLLDPHLSVLELLGKTGSSPS 60
           MVLDY  RETKG              IRP SE +A EDKGLLDPHLSVLELLGKTG SPS
Sbjct: 1   MVLDYPQRETKGSSSKNMAPNSSSMNIRPSSEVEAGEDKGLLDPHLSVLELLGKTGHSPS 60

Query: 61  PLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120
           P+G SLVTSIDIS+HH V D+ISGSWQ I PLDLGASF+PER SSQTTNGSILSSSDTSE
Sbjct: 61  PMGHSLVTSIDISSHHYVNDSISGSWQAIHPLDLGASFVPERSSSQTTNGSILSSSDTSE 120

Query: 121 EEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDVVC 180
           EEQ+LLQAPAADIINIIKQGQ+G SVTSPS PF+QLH VISLP+P + RT YGEQ+D   
Sbjct: 121 EEQELLQAPAADIINIIKQGQEGASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQDDDDN 180

Query: 181 IDNDDDN-GMYEEDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTP 239
             +DD + G YEEDS TITKSLTSSTNSFVMPKLSLS+KNPVFRLLILGRTG+NFYQS P
Sbjct: 181 NVDDDYDDGAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP 240

Query: 240 KEYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTI 299
           KE+QSLFELPK HDST FPQYTGI+I+FQELREMVSLLNRIV+Y+QGKPIIPICQPGQTI
Sbjct: 241 KEHQSLFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI 300

Query: 300 QVKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDLSLEYVXXXXXXXXXXXXXXX 359
           QVKNVLKSFL+N LIKLLYPPVV TNR+DLKKMFQRLQDLSLEY                
Sbjct: 301 QVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKKMFQRLQDLSLEYA--EDGDNDDEDNDDE 358

Query: 360 IIQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRWFTWGVSITIGISFGCCVTYF 419
           II                                   TRWFTWGVSITIGISFGCCVTYF
Sbjct: 359 IIHTNSRSYYRNKKANSSKKKSFKSNKKPKKKKQRSLTRWFTWGVSITIGISFGCCVTYF 418

Query: 420 VTAAYDHQT 428
            TAAYDHQT
Sbjct: 419 ATAAYDHQT 427

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/430 (68%), Positives = 325/430 (75%), Gaps = 9/430 (2%)

Query: 1   MVLDYQHRETKGXXXXXXXXXXXXXXIRPRSEGQAEEDKGLLDPHLSVLELLGKTGSSPS 60
           MVL+YQ RE KG              I   SE Q  EDKGLLDPHLSVLELL KTG SPS
Sbjct: 1   MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS 60

Query: 61  PLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120
           P+GQ+LVTSIDIS +HNV D+ISGSWQ IQPLDLGASFIPERCSSQTTNGSILSSSDTSE
Sbjct: 61  PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120

Query: 121 EEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDVVC 180
           EEQ+LLQAPAADIINIIKQGQ+G +V SPSHPFKQL  +ISLP+P +E+T + EQ+D   
Sbjct: 121 EEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGD 180

Query: 181 IDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTPK 240
            D       +EEDSVTITKSLTSSTNSFVMPKLSL++KNPVFRLLILGRTG++FYQS PK
Sbjct: 181 EDE-----AFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPK 235

Query: 241 EYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQ 300
           EYQSLFELPK HDS  FPQYTGIVI+FQELREMVSLLNRIV+Y+QGKP+IPICQPGQ IQ
Sbjct: 236 EYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQ 295

Query: 301 VKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDLSLEYVXXXXXXXXXXXXXXXI 360
           VKNVLKSFL+N L+KLL+PPVV TN++DLKKMFQRLQDLSLEY                 
Sbjct: 296 VKNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEY----GEDVNEEDNDDEA 351

Query: 361 IQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRWFTWGVSITIGISFGCCVTYFV 420
           I                                   T WFTWG+SITIGISFGCCVTYFV
Sbjct: 352 IHTKSRSYCRNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFV 411

Query: 421 TAAYDHQTIR 430
           TAAY+HQT++
Sbjct: 412 TAAYEHQTVK 421

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  257 bits (656), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 154/393 (39%), Positives = 215/393 (54%), Gaps = 15/393 (3%)

Query: 37  EDKGLLDPHLSVLELLGK-TGSSPSPLGQSLVTSIDISNHHNVID----NISGSWQTIQP 91
           E + +LDPHLSVLELL + + + P    +  V+ I + N          +IS SWQTI  
Sbjct: 22  ERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDI-VGNCAGTTGTGNGSISQSWQTIHR 80

Query: 92  LDLGASFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPSH 151
            D   S +PERC SQ T   ILSSSDTSE+E D + +P+A  ++           T    
Sbjct: 81  NDSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSA--VHQQLHATPPQKHTKSLE 138

Query: 152 PFKQLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVMP 211
            ++ L+  I L +P          ++     ++ +    E+D+ TITKSL SS+NSF+MP
Sbjct: 139 DYRSLNVGIPLVLPEDSNNINNNNKNGSTTGSNGE----EDDNDTITKSLNSSSNSFIMP 194

Query: 212 KLSLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFELPKSHDSTIFPQYTGIVIVFQELR 271
           KLSLS+K   FR+L+LGR G  FY S PK+YQ +FELP+SHD   F QYTGI++VFQEL+
Sbjct: 195 KLSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELK 254

Query: 272 EMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVATNRKDLKK 331
           EMVSLLNR+ +    +P+IP+CQ GQ  QV+N+L+S LKN L+ LLYPPVV  N+ DL  
Sbjct: 255 EMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLG 314

Query: 332 MFQRLQDLSLEYVXXXXXXXXXXXXXXXIIQPXXXXXXXXXXXXXXXXXXXXXXXXXXXX 391
           MF+ LQ+LS                    ++                             
Sbjct: 315 MFRFLQELSKTVSDNSDMDAEEPNNGSKRLK---RSLQRKKKKFIETSAERNGRPHKKRH 371

Query: 392 XXXXXTRWFTWGVSITIGISFGCCVTYFVTAAY 424
                 RW  WGVS+T+G+  G C+++ V++ +
Sbjct: 372 NNEKVNRWVLWGVSLTLGVGVGYCISHLVSSTW 404

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  254 bits (649), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 166/392 (42%), Positives = 217/392 (55%), Gaps = 23/392 (5%)

Query: 32  EGQAEEDKGLLDPHLSVLELLGKTGSSPSPLGQSLVTSIDISNHHNVIDNISGSWQTIQP 91
           E  A E K LLDPHLSVLELL +TG +   +G+ +  + D++N  N   +IS SWQ I  
Sbjct: 22  ETTAFEKKSLLDPHLSVLELLERTGDTQR-VGRGVEKADDMANTTN---SISSSWQAIHR 77

Query: 92  LDLGASFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPSH 151
            D   + +PERCSSQ     ILSSSDTSEEE D   +P     N+    Q   S   P  
Sbjct: 78  NDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSP-----NVAHFTQFHQSQQPPRL 132

Query: 152 PFKQLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVMP 211
           PFK    VI   +P R++   G+ +     DNDD     E D  T+TKSL++S+NSFVMP
Sbjct: 133 PFKLDVPVI---LPARDQEPSGQTQ---TPDNDD-----ERDDETLTKSLSNSSNSFVMP 181

Query: 212 KLSLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFELPKSHDSTIFPQYTGIVIVFQELR 271
           KLSLS+K+   R+LILGR G  FYQS PK YQ  FEL +  D + F Q+TGI+IVFQEL+
Sbjct: 182 KLSLSQKSHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQELK 241

Query: 272 EMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVATNRKDLKK 331
           EMVSLLNR+ + A  +P+IP+CQ GQ  QV+NVL+S LK+ LI LLYPPVV +N  DL  
Sbjct: 242 EMVSLLNRVCQCAPTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISNHSDLNN 301

Query: 332 MFQRLQDLSLEYVXXXXXXXXXXXXXXXIIQPXXXXXXXXXXXXXXXXXXXXXXXXXXXX 391
           M++ L DLS                    +                              
Sbjct: 302 MYRFLLDLS---KTISDNSEDDEDEEERELLDKKIKKSHQRKKKRAGSYDKTDKPRKRRS 358

Query: 392 XXXXXTRWFTWGVSITIGISFGCCVTYFVTAA 423
                 +W  WG+S+T+G+  G C++YF ++ 
Sbjct: 359 KETKINKWIVWGISLTVGVGVGYCMSYFASSG 390

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score =  157 bits (398), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 82/156 (52%), Positives = 111/156 (71%), Gaps = 1/156 (0%)

Query: 180 CIDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKLSLSRK-NPVFRLLILGRTGTNFYQST 238
            +D  + N ++  DS+++TKS  SS+ SFVMPKLSL+ K +   +LL++GR    F+Q  
Sbjct: 167 SLDEHELNSIFTSDSMSLTKSTGSSSTSFVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDI 226

Query: 239 PKEYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQT 298
           P+EY+  F + +S D + F  Y GIVIVFQEL+E V++LNRIV+Y   KPIIPICQPGQ 
Sbjct: 227 PREYRQYFHISQSSDPSEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQR 286

Query: 299 IQVKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQ 334
           I+VKN+LKSFLKN  I L YPPV   N K ++K+F+
Sbjct: 287 IRVKNILKSFLKNDAITLWYPPVTIANEKSMEKLFK 322

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%)

Query: 397 TRWFTWGVSITIGISFGCCVTYFVT 421
           ++W TWG+S+TIG+S G   TY +T
Sbjct: 372 SKWITWGISLTIGVSIGYYATYMIT 396

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  145 bits (365), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 105/327 (32%), Positives = 171/327 (52%), Gaps = 52/327 (15%)

Query: 37  EDKGLLDPHLSVLELLGKTG----------SSPSPLGQSLVTSIDISNHHN----VIDNI 82
           + + +LDPH SVL+LL + G          SS  P+      +  +S H      +  +I
Sbjct: 27  QKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALNQSI 86

Query: 83  SGSWQTIQPLDLGA-SFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQ 141
           S SWQ+I+ +D    + + +  SSQ     ILSSSDTSEEE D L +P+     +   G 
Sbjct: 87  SDSWQSIKMVDYSILNSLHDTSSSQAVG--ILSSSDTSEEELDHLNSPSPSSQQVFPNG- 143

Query: 142 DGTSVTSPSHPFKQLHTVI----SLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTI 197
                  P   F+    V+    +LP P                       + E+D+ T+
Sbjct: 144 -------PPISFQTQAGVLTASATLPNP---------------------GVLEEDDNETV 175

Query: 198 TKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFELP--KSHDST 255
           T SL +S+NSFVMP+LSLS+++  F +L++G+    F+ + PK YQ +F++   +S  + 
Sbjct: 176 TVSLAASSNSFVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAP 235

Query: 256 IFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIK 315
               YT ++I+FQ+ +E+  +L+ +V    GK IIPICQ GQ  Q+ ++L+ F+K   I+
Sbjct: 236 KVSHYTAVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIR 295

Query: 316 LLYPPVVATNRKDLKKMFQRLQDLSLE 342
           L++ P V +N +++ K+ + L  LS E
Sbjct: 296 LMFQPTVMSNHQEIHKLLRYLHRLSTE 322

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 18/23 (78%)

Query: 398 RWFTWGVSITIGISFGCCVTYFV 420
           RW  WG+S+T+G+  GCC+++ +
Sbjct: 353 RWVIWGLSLTVGVGIGCCISFIL 375

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score =  139 bits (351), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 114/315 (36%), Positives = 167/315 (53%), Gaps = 53/315 (16%)

Query: 39  KGLLDPHLSVLELLGKTGSSPSPLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGASF 98
           K LLDPHLSVLE+L +  +          T ++ S+       IS SWQ I+        
Sbjct: 36  KSLLDPHLSVLEMLERKDND---------TVMEASSR------ISRSWQNIESPADSKQL 80

Query: 99  IPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQLHT 158
           +  + SSQ +N   + SS +   ++++      D IN +    +G+S    +        
Sbjct: 81  LSAK-SSQVSNLVSILSSSSDTSDEEV------DRINSLNSAGEGSSKNYNN-------- 125

Query: 159 VISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSST---NSFVMPKLSL 215
               P P +   +  E  DV   DNDD  G+    + TITKSLTSS+   NSFVMP LSL
Sbjct: 126 ----PSPLQNPIYLPEFTDVTAGDNDD--GI----ASTITKSLTSSSTISNSFVMPTLSL 175

Query: 216 SRKNPV---FRLLILGRTGTNFYQSTPKEYQSLFELPKSHDSTI---FPQYTGIVIVFQE 269
           S        F++LI GR G +FY++ PK+YQ LF +P   ++        +T  +I+F+E
Sbjct: 176 SSSQSQQRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEE 235

Query: 270 LREMVSLLNRIVEYAQGKPIIPI----CQPGQTIQVKNVLKSFLKNSLIKLLYPPVVATN 325
           L+E+VSLLNRI E    K + P     CQPGQ I+VK++LK FLKN+ + LL P ++  +
Sbjct: 236 LKELVSLLNRISEELSFKKVPPPIIPICQPGQKIKVKSILKYFLKNNFVTLLSPIIIIND 295

Query: 326 RKDLKKMFQRLQDLS 340
            + L KMF+ +Q +S
Sbjct: 296 ERALLKMFKTMQSIS 310

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score =  139 bits (350), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 105/166 (63%), Gaps = 5/166 (3%)

Query: 180 CIDNDDDNG---MYEEDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRT-GTNFY 235
            +DNDD +        +++ +TKS+TSS+NSF+MPKLS +     FR+LILG      FY
Sbjct: 305 SLDNDDQSNSTITNSYNNLNLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFY 364

Query: 236 QSTPKEYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGK-PIIPICQ 294
           Q+ P  Y+ LFELP ++    F  Y GI IV  +L +  S+LN+I +Y+  K PIIPIC+
Sbjct: 365 QNIPTSYKYLFELPPNNFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICE 424

Query: 295 PGQTIQVKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDLS 340
            GQ  +VKN+LK ++K   + LLYPP+V TNR  +  ++  L DLS
Sbjct: 425 KGQINEVKNILKPYIKTKDLSLLYPPIVGTNRDGMNTLYLHLNDLS 470

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 57/128 (44%), Gaps = 36/128 (28%)

Query: 31  SEGQAEEDK-GLLDPHLSVLELLGKTGSS-------------------PSPLGQSLV--- 67
           S G  + DK G LDPH S++ELL     S                    SPL +  +   
Sbjct: 16  SSGSMDYDKRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQPDNPTSPLNEIRLELS 75

Query: 68  -TSIDISNHHN-----VIDNISGSWQTIQ-----PLDLGASFIPERCSSQTTNGSILSSS 116
             ++D  N  N     +  ++S SWQ IQ     PLD+  S      ++ T    ILSS+
Sbjct: 76  GMNVDDINSENQESSELSQSLSNSWQRIQTPDYSPLDVKDSNSINNINNNTV--GILSST 133

Query: 117 DTSEEEQD 124
           D+SEEEQD
Sbjct: 134 DSSEEEQD 141

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  130 bits (326), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 118/405 (29%), Positives = 172/405 (42%), Gaps = 79/405 (19%)

Query: 39  KGLLDPHLSVLELL-GKTGSS---PSPL-GQSLVTSIDISNHHNVIDNISGSWQTIQPLD 93
           + +LDPHLSVLE+L GK  +    P  L G S V+         +  +IS SWQ+I+  D
Sbjct: 25  RSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHHSISESWQSIKSTD 84

Query: 94  -LGASFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPA----------ADIINIIKQGQD 142
            L  S   +    Q +   ILSSSDTSEEEQD+  +P           + IINI  Q   
Sbjct: 85  YLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHPSPPPPNSASSAFDSRIINIAGQAFS 144

Query: 143 GTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLT 202
            T           L +                       +++DD+G       T+T SL 
Sbjct: 145 AT--------LSHLRS-----------------------EDEDDDGE------TVTVSLP 167

Query: 203 SSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFE---LPKSHDSTIFPQ 259
           ++  S VMPKLSLS +    ++LI+G+    F+ S PK YQ +FE   L    D  +  +
Sbjct: 168 NTMTSLVMPKLSLSDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEK 227

Query: 260 YTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYP 319
           Y+ I+++F ++     LL+RI        IIPICQ GQ   + ++LK ++  + IKL   
Sbjct: 228 YSTIMVIFHDMGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCN 287

Query: 320 PVVATNRKDLKKMFQRLQDLSLEYVXXXXXXXXXXXXXXXIIQPXXXXXXXXXXXXXXXX 379
           P+V +N  +  ++ + L  LS                    ++P                
Sbjct: 288 PIVMSNHHEKHRLLKHLHQLS--------SGSDSGYETEVTVEPVKKLPRKAKKRPSKPS 339

Query: 380 XXXXXXXXXXXXXXXXXTRWFTWGVSITIGISFGCCVTYFVTAAY 424
                              W  W  SITIGI  GCCV+  V+  Y
Sbjct: 340 TFRD---------------WVVWTASITIGIGIGCCVSLMVSTRY 369

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score =  124 bits (311), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 107/320 (33%), Positives = 156/320 (48%), Gaps = 65/320 (20%)

Query: 41  LLDPHLSVLELLGKT----GSSPSPLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGA 96
           +LDPHLSVLELL K+    G + +P       +  I         +S SW T++  +L A
Sbjct: 8   VLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQI--------QLSESWCTVERDELSA 59

Query: 97  SFIPERCSSQTTNGSILSSSDTSEE---EQDLLQAPAADIINIIKQGQDGTSVTSPSHPF 153
               ER +SQ TN  +LSSSDTSEE   EQ          +   +  +   S+ S S   
Sbjct: 60  M---ERSASQQTNNGVLSSSDTSEEGEPEQGSPGDGEGGGVADTRMARPAMSLQSTS--- 113

Query: 154 KQLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKL 213
                                      +D  DD      DS T++KSLTSS+NSF+MPKL
Sbjct: 114 -------------------------STLDGVDD------DSATVSKSLTSSSNSFIMPKL 142

Query: 214 -----------SLSRKNPVFRLLILGRTGTNFYQST-PKEYQSLFELPKS-HDSTIFPQY 260
                      S + +   F++ +LGR    F Q T P++++  FEL    HD       
Sbjct: 143 YTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQCADR 202

Query: 261 TGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPP 320
            GI+IV QE+RE++SLLNR+       P++ +    + +QVKNVL++F +  L+ LL+PP
Sbjct: 203 QGILIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRLVSLLHPP 262

Query: 321 VVATNRKDLKKMFQRLQDLS 340
           V  +N + L KMF  + +L+
Sbjct: 263 VPLSNNEALDKMFHFVDNLA 282

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%), Gaps = 1/27 (3%)

Query: 398 RWFTWGVSITIGISFG-CCVTYFVTAA 423
           RW  WGVSI++GI  G  CV+Y V+++
Sbjct: 323 RWLLWGVSISLGIGAGYYCVSYVVSSS 349

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score =  122 bits (307), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 91/315 (28%), Positives = 157/315 (49%), Gaps = 47/315 (14%)

Query: 37  EDKGLLDPHLSVLELLGKT-GSSPSPLGQSLVTSI-----DISNHHNVIDNISGSWQTIQ 90
           + KG+LDPHLSVLE+L +  G     + +  V ++     + S HH+    IS SWQ I+
Sbjct: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHHS----ISESWQAIK 82

Query: 91  PLDLGASFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPS 150
             D           +  ++  ILSSSDTSEEE ++ +  A   +++      G+S+ SP 
Sbjct: 83  RSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEM-RPSAHGTVHL------GSSLASP- 134

Query: 151 HPFKQLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVM 210
              +QL                        +  +D++   E+D  T+T S+ SS+ S VM
Sbjct: 135 --MRQL------------------------LVEEDNSCAEEDDCQTVTISMPSSSTSLVM 168

Query: 211 PKLSLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFELPKSHDST---IFPQYTGIVIVF 267
           PKLSLS++    +LL++G+    F+ + PK YQ LF++      T   +  +Y  +++VF
Sbjct: 169 PKLSLSQRLGEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVF 228

Query: 268 QELREMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVATNRK 327
            ++ +   LL+ + E A    +IP+CQ GQ   +  +LK +     I++   P++ +N  
Sbjct: 229 HDIAQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHH 288

Query: 328 DLKKMFQRLQDLSLE 342
           +  ++ + L +L  E
Sbjct: 289 EKHRLLKHLHNLCNE 303

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 399 WFTWGVSITIGISFGCCVTYFVTAAY 424
           W  W  S TIGI  GCC++   T  +
Sbjct: 336 WAIWTASFTIGIGIGCCISLMATTRF 361

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score =  121 bits (303), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 96/319 (30%), Positives = 158/319 (49%), Gaps = 44/319 (13%)

Query: 37  EDKGLLDPHLSVLELLGKTGSSPSPLGQ------SLVTSIDISNHHNVIDNISGSWQTIQ 90
           +   +LDPHLSVL+LL +    PS L        +   +   S   +V  +IS SWQ+I+
Sbjct: 36  QRNSILDPHLSVLQLLDR-ADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIK 94

Query: 91  PLDLGASFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPS 150
             D   S +  +  +   +  ILSSSDTSE+E D   +P+    N        TS+    
Sbjct: 95  HTD--CSMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSP---NNFAFPNSATSI---- 145

Query: 151 HPFKQLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVM 210
                       P  P        +E     +++  N   E D+ T+T SL +S+NSFVM
Sbjct: 146 -----------FPEAPHNLEASSLRE---YQNSEIANPREENDNETVTMSLMNSSNSFVM 191

Query: 211 PKLSLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFEL-------PKSHDSTIFPQYTGI 263
           PKLSL +++  F +LI+G+    FY+  P+ Y  +FE+       P+  +     +Y+ +
Sbjct: 192 PKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMN-----KYSAV 246

Query: 264 VIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVA 323
           +++F E +E   LL ++   A    II +CQ GQ  Q+ N+L  + K++ I+L+Y   V 
Sbjct: 247 MVIFGEPKEGKELLEKVA--AHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVM 304

Query: 324 TNRKDLKKMFQRLQDLSLE 342
           ++ +D+ ++ + L  LS E
Sbjct: 305 SDHQDVHRLLRYLNTLSTE 323

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 8/20 (40%), Positives = 13/20 (65%)

Query: 397 TRWFTWGVSITIGISFGCCV 416
            RW  W +S+T+G+  G C+
Sbjct: 354 NRWVIWSISLTVGVGLGYCI 373

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score =  120 bits (301), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 152/311 (48%), Gaps = 30/311 (9%)

Query: 39  KGLLDPHLSVLELL--GKTGSSPSPLGQSLVTS---IDISNHHNVIDNISGSWQTIQPLD 93
             +LDPHLSVL+LL   +  S P     S + S   +  S+   +  +IS SWQ+I+  D
Sbjct: 29  NSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHTD 88

Query: 94  LGASFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPSHPF 153
                +    S Q     ILSSSDTSE+E D   +P+ +        +  T     SH  
Sbjct: 89  YSILNLIGETSHQP--AGILSSSDTSEDEPDHFLSPSPNEYAFANGAK--TVFPEASHA- 143

Query: 154 KQLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKL 213
                    P  P   T      +   +  D+DN        T+T SL +S+NSFVMPKL
Sbjct: 144 ---------PEGPSLATLQDSVYEHSNVAEDNDNE-------TVTLSLINSSNSFVMPKL 187

Query: 214 SLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFEL--PKSHDSTIFPQYTGIVIVFQELR 271
           SL++    F +LI+G+    FY+  P+ YQ +FE+   +S  +    Q++ I+++F + +
Sbjct: 188 SLAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIMVIFTDPK 247

Query: 272 EMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVATNRKDLKK 331
              SLL  +    +   II +CQ GQ  Q+ N+L  F K   ++L+Y   V ++ +D+ +
Sbjct: 248 NGQSLLEMVT--GRSSNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHR 305

Query: 332 MFQRLQDLSLE 342
           + + L  LS E
Sbjct: 306 LLRYLYTLSNE 316

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score =  120 bits (300), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 60/143 (41%), Positives = 96/143 (67%), Gaps = 7/143 (4%)

Query: 208 FVMPKLSLSRKN------PVFRLLILGRTGTNFYQSTPKEYQSLFELPKSHDSTIFPQYT 261
           F+MP+LSL++K         FR+LI+GR  +  ++  P ++Q+LF+L KS+D   + ++T
Sbjct: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDINEYQKFT 283

Query: 262 GIVIVFQELREMVSLLNRIVEYAQGK-PIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPP 320
            I++V QE RE++SLLNRI    + K P+I IC+    +Q KNVLKS+L+N LI LLY P
Sbjct: 284 AILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQP 343

Query: 321 VVATNRKDLKKMFQRLQDLSLEY 343
            V +N ++L +M   L++ S+++
Sbjct: 344 FVISNTEELDRMLVFLKETSIKF 366

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 20/28 (71%)

Query: 397 TRWFTWGVSITIGISFGCCVTYFVTAAY 424
            +W  WG+S++IG+  G C++YF ++ +
Sbjct: 435 NKWIIWGISLSIGVGIGYCISYFGSSPW 462

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/341 (26%), Positives = 159/341 (46%), Gaps = 56/341 (16%)

Query: 41  LLDPHLSVLELLGKTGSSPSPLGQSLVTSIDI------SNH--HNVID------NISGSW 86
           +LDPH SV++LL   G         L+ + D+      SN+  HN I+       ++ SW
Sbjct: 41  ILDPHDSVMDLL--NGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSW 98

Query: 87  QTIQP-----LDLGASFIPERCSSQTTN---GSILSSSDTSEEEQDLLQAPAADI----- 133
           Q I       L+ G        S+   N   G +LSS DTSEEE ++  AP+ ++     
Sbjct: 99  QAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSS-DTSEEEVEINAAPSPNLSASQQ 157

Query: 134 --------INIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDVVCIDNDD 185
                   ++    G  G S T+  H F     V S       +   G            
Sbjct: 158 HNQFLAYPLSSTGFGDQGNSETTV-HQFSDGDPVKSTKTGQFSKAELGA----------- 205

Query: 186 DNGMYEEDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLIL--GRTGTNFYQSTPKEYQ 243
             G  E++++ +    + + + FVMPKLSLS     F++LIL  G +  +FY    + ++
Sbjct: 206 --GTGEDETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHR 263

Query: 244 SLFELPKSHDSTIFP--QYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQV 301
            +F++ K ++++     +YT  +I+F + +++ ++LNR+ +      +IPICQ GQ   V
Sbjct: 264 LMFDVGKLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSV 323

Query: 302 KNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDLSLE 342
              +K+F  ++ IKL+  PVV ++  ++  + + L  L +E
Sbjct: 324 TEKVKTFANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVE 364

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 4/32 (12%)

Query: 398 RWFTWGVSITIGISFGCCVTY----FVTAAYD 425
           RW+ W +SI +G+  GCCVT+    F T++Y+
Sbjct: 394 RWWFWPISIALGVGIGCCVTFYFSKFETSSYN 425

>TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON} 
          Length = 470

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 37 EDKGLLDPHLSVLELLGKTGSSPSPLGQSLVTSIDISNHHNVIDNISGSWQTI 89
          E + +++PH SVL+LL      P P    +  S +  N  N I ++S SWQ +
Sbjct: 13 ERRSVIEPHYSVLDLLEANMGGPPPSANVISNSTNTQNDWNAIIDLSDSWQIL 65

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 198 TKSLTSSTNSFVMPKLSLSRKNPVFRLL-ILGRTGTNFYQ 236
           + S TSS+N FVMP+LS S+K    + + ++G    +FYQ
Sbjct: 110 SASDTSSSNQFVMPRLSYSKKEGSLKAISVVGSHADSFYQ 149

>Ecym_2560 Chr2 complement(1090441..1092891) [2451 bp, 816 aa] {ON}
           similar to Ashbya gossypii AGL269W
          Length = 816

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 48/106 (45%), Gaps = 15/106 (14%)

Query: 112 ILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTF 171
           +++ SD   +E D ++ P +     +    + T+ +SP  P+K   T+       +E T+
Sbjct: 140 LVNVSDIDHQEDDRIKEPESATPKAVINKHEDTAKSSPWSPYKVAKTL-------KEGTY 192

Query: 172 YGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKLSLSR 217
              Q +    ++ D N  +E DSVT          S +  K+SLS+
Sbjct: 193 KQLQHESENTNSADHNTTHETDSVT--------EKSIIQSKISLSK 230

>Suva_3.179 Chr3 (272175..273245) [1071 bp, 356 aa] {ON} YCL034W
           (REAL)
          Length = 356

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 192 EDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFELPKS 251
           +D++  + SLTS+   + +PK++++++ P  RL+I     ++   S      SL  LP++
Sbjct: 185 DDTLYQSGSLTSADRLYRIPKINMNKEAPKIRLII-----SDALASAVSLQNSLIGLPRA 239

Query: 252 HDSTIFPQYTGIVIVFQELREMV 274
             ST   + T   I  + +R  V
Sbjct: 240 KCSTDDEEATSKFIQARAIRRKV 262

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 50/101 (49%), Gaps = 3/101 (2%)

Query: 51   LLGKTGSSPSPLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGASFIPERCSSQTTNG 110
            ++G+TG+  S +  +L   +D    H  IDN+  S   +Q L    + IP+  +  T  G
Sbjct: 1454 VVGRTGAGKSTIITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFT--G 1511

Query: 111  SILSSSDTSEEEQDLLQAPAADIINIIKQGQ-DGTSVTSPS 150
            +I S+ D  +E  D     A   +N++ Q + D +++ + S
Sbjct: 1512 TIKSNLDPYDEYSDEDIFAALKRVNLVSQEELDRSNIDAAS 1552

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 4/101 (3%)

Query: 47   SVLELLGKTGSSPSPLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGASFIPERCSSQ 106
            S + ++G+TG+  S +  +L   ++    H  IDNI  S   +Q L    + IP+     
Sbjct: 1409 SKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQ--DPT 1466

Query: 107  TTNGSILSSSDTSEEEQDLLQAPAADIINII--KQGQDGTS 145
              +G+I ++ D  +E  D     A   +N+I  +Q Q GT+
Sbjct: 1467 LFSGTIKTNLDPYDEFSDRKIFEALKRVNLISEEQSQQGTT 1507

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,421,112
Number of extensions: 1974264
Number of successful extensions: 6981
Number of sequences better than 10.0: 61
Number of HSP's gapped: 7168
Number of HSP's successfully gapped: 79
Length of query: 513
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 399
Effective length of database: 40,409,475
Effective search space: 16123380525
Effective search space used: 16123380525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)