Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.415.700ON1219121955120.0
Smik_9.225.700ON1230121848370.0
Skud_9.215.700ON1221121847680.0
YIL147C (SLN1)5.700ON1220121847430.0
SAKL0E14872g5.700ON1140122929420.0
ZYRO0G06644g5.700ON116696026060.0
AFR284W5.700ON1103122624440.0
KAFR0D022405.700ON118773221570.0
NCAS0G002505.700ON118372420240.0
KNAG0L021105.700ON120074920010.0
CAGL0H06567g5.700ON116979119770.0
KLTH0E01100g5.700ON117772719720.0
Kpol_2001.745.700ON111371518260.0
Kwal_55.197075.700ON114371418260.0
KLLA0A00638g5.700ON115572918200.0
TBLA0I016805.700ON121477917770.0
NDAI0F003105.700ON125937514471e-178
TDEL0B022105.700ON109549513891e-172
TPHA0D045905.700ON112748212961e-158
Ecym_40205.700ON112547612691e-154
Kpol_1043.685.700ON104245411721e-141
TPHA0E002505.700ON106846511151e-132
TBLA0E021005.700ON11403879231e-105
Ecym_74744.385ON4961191656e-11
ADL388W4.385ON4821191631e-10
KAFR0B069904.385ON5451191622e-10
KNAG0M001804.385ON6151191603e-10
NCAS0A064504.385ON6091191585e-10
SAKL0B12408g4.385ON4651191567e-10
CAGL0F09097g4.385ON6301171577e-10
TDEL0D003204.385ON5471191577e-10
ZYRO0G00484g4.385ON6471711578e-10
KLLA0A10219g4.385ON4751191551e-09
KLTH0D17182g4.385ON4641191522e-09
Smik_8.2964.385ON6251191523e-09
YHR206W (SKN7)4.385ON6221191513e-09
Suva_15.4124.385ON6171191514e-09
Skud_8.2734.385ON6231191514e-09
NDAI0D034304.385ON5971171504e-09
Kpol_265.24.385ON5491191471e-08
Kwal_47.167704.385ON4611191452e-08
TBLA0A107004.385ON5871191452e-08
Ecym_50775.230ON7951471443e-08
KNAG0B051405.230ON6481261391e-07
Kwal_33.152885.230ON5871681381e-07
TPHA0C001504.385ON5101191362e-07
TDEL0E039805.230ON7301281362e-07
KAFR0J007005.230ON6201421344e-07
CAGL0D02882g5.230ON6671461336e-07
ZYRO0A11154g5.230ON7761821329e-07
KLTH0B02684g5.230ON5952081301e-06
ADR343C5.230ON7491471282e-06
Suva_10.845.230ON6951341255e-06
Kpol_1004.45.230ON7141551255e-06
TPHA0N008505.230ON6701651238e-06
NCAS0D029005.230ON7621901231e-05
KLLA0E09505g5.230ON635701221e-05
Skud_12.725.230ON7021461202e-05
YLR006C (SSK1)5.230ON7121461193e-05
Smik_12.685.230ON7121341174e-05
NDAI0I020005.230ON8901421167e-05
TBLA0D031705.230ON7651551060.001
SAKL0G12100g5.230ON73870980.007
KLLA0E04533g7.222ON42181890.087
Skud_6.388.34ON1758111820.73
YFL033C (RIM15)8.34ON1770110810.92
TBLA0B015507.222ON39481800.95
TBLA0E049804.385ON791101800.95
Klac_YGOB_Anc_8.348.34ON1571110791.6
Smik_6.468.34ON1760111781.8
SAKL0F08184g7.222ON41287771.9
Kwal_47.181517.222ON41481772.1
Suva_6.268.34ON1753111763.1
Kpol_1035.408.34ON1517113746.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.41
         (1219 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...  2127   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...  1867   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...  1841   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...  1831   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1137   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1008   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   946   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   835   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   784   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   775   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   766   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   764   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   707   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...   707   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   705   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   689   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   561   e-178
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   539   e-172
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   503   e-158
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   493   e-154
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   456   e-141
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   434   e-132
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   360   e-105
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    68   6e-11
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    67   1e-10
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    67   2e-10
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    66   3e-10
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    65   5e-10
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    65   7e-10
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    65   7e-10
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    65   7e-10
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    65   8e-10
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    64   1e-09
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    63   2e-09
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    63   3e-09
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    63   3e-09
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    63   4e-09
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    63   4e-09
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     62   4e-09
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    61   1e-08
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    60   2e-08
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    60   2e-08
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    60   3e-08
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    58   1e-07
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    58   1e-07
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    57   2e-07
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    57   2e-07
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    56   4e-07
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    56   6e-07
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    55   9e-07
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    55   1e-06
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    54   2e-06
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    53   5e-06
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    53   5e-06
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    52   8e-06
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    52   1e-05
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    52   1e-05
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    51   2e-05
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    50   3e-05
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    50   4e-05
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    49   7e-05
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    45   0.001
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    42   0.007
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    39   0.087
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    36   0.73 
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    36   0.92 
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    35   0.95 
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    35   0.95 
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    35   1.6  
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    35   1.8  
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    34   1.9  
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    34   2.1  
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    34   3.1  
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    33   6.4  

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score = 2127 bits (5512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1066/1219 (87%), Positives = 1066/1219 (87%)

Query: 1    MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60
            MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120
            AAQLKSSQIDQTLN          SRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120

Query: 121  NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180
            NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL
Sbjct: 121  NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180

Query: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240
            NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV
Sbjct: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240

Query: 241  YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA 300
            YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA
Sbjct: 241  YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELITEGRGLXXXXXXXXXXXXXFKRGFSSGFAVPSSLLQFNXXXXXXXXXXX 420
            IVRLQKATELITEGRGL             FKRGFSSGFAVPSSLLQFN           
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTSAS 420

Query: 421  XXXXXXRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLA 480
                  RGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLA
Sbjct: 421  GHGCSGRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLA 480

Query: 481  PNALXXXXXXXXXXXXXILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540
            PNAL             ILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PNALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660
            IRNSLKLIFRSG            FSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKEL 720
            RVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKEL
Sbjct: 661  RVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKEL 720

Query: 721  SEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEE 780
            SEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKK             NRDTSTIQEE
Sbjct: 721  SEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQEE 780

Query: 781  ITKRNTAANENIYKKTRDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXX 840
            ITKRNTAANENIYKKTRDREK                   AIFNSQFNKA          
Sbjct: 781  ITKRNTAANENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNKALGSDDDEGGD 840

Query: 841  XXKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
              KPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  LGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVA 960
            ANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVA
Sbjct: 901  ANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVA 960

Query: 961  RSIKSRQSASSIATPTANRCGLTNEMLRKSRSXXXXXXXXXXXXXXXXXXXXXLDEAHQQ 1020
            RSIKSRQSASSIATPTANRCGLTNEMLRKSRS                     LDEAHQQ
Sbjct: 961  RSIKSRQSASSIATPTANRCGLTNEMLRKSRSNEEEEGRKIINIEEGKEGGNELDEAHQQ 1020

Query: 1021 LQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVS 1080
            LQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVS
Sbjct: 1021 LQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVS 1080

Query: 1081 NXXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYN 1140
            N          LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYN
Sbjct: 1081 NSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYN 1140

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1201 PKLKTILIEFCAAYQGKKK 1219
            PKLKTILIEFCAAYQGKKK
Sbjct: 1201 PKLKTILIEFCAAYQGKKK 1219

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score = 1867 bits (4837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1218 (76%), Positives = 999/1218 (82%)

Query: 1    MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60
            MR RLPS+S FTPPFRI IRAQLTALVSIVAL+SL+ILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120
            AAQLKSSQIDQTLN          SRDALQ+SLT +VAGNKS+DNWVDS+S+VQKFLSSS
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120

Query: 121  NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180
            NLF+VAKVYDSSFTTVLNATNNGTGDLIP+D+ D LFPLSTD  LPSSLETTGILTDP++
Sbjct: 121  NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180

Query: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240
            N+TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISA+
Sbjct: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240

Query: 241  YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA 300
            YNNQ KA  YHF+FPPYGT+S++T+++F IKNNTFISSAF+NGKGGSLK+TNSFGIKNLA
Sbjct: 241  YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            LGYSPCSFQLVNWVAVVSQPESVFLSP+TKLAKIITGTVIAIGVFVILLTLPLAHWAVQP
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELITEGRGLXXXXXXXXXXXXXFKRGFSSGFAVPSSLLQFNXXXXXXXXXXX 420
            IVRLQKATELITEGRGL             FKRGF SGF VPSSLLQFN           
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGESGSTISAS 420

Query: 421  XXXXXXRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLA 480
                   GS A  ST+SSMKSA+N+GNEKL P E+EK+ PN++ +AK+SMDGSLNHDLLA
Sbjct: 421  GHGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA 480

Query: 481  PNALXXXXXXXXXXXXXILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540
            PN+L             ILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660
            IRNSLKLIFRSG            FSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKEL 720
            RVRLSISLFPN IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTV+VRMKLLGEYDK+L
Sbjct: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDL 720

Query: 721  SEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEE 780
            SEKKQFKEVHV++GTEI E     NK D   S N +K             NRDTS IQEE
Sbjct: 721  SEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEE 780

Query: 781  ITKRNTAANENIYKKTRDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXX 840
            ITKRNTAANENIYK+  D EK                   AIFNSQFNKA          
Sbjct: 781  ITKRNTAANENIYKRMNDAEKLSSDDVSSIVSTTTSSYDDAIFNSQFNKAPGSDEDEGGN 840

Query: 841  XXKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
              KPIENPKTW ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  LGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVA 960
            ANMM+GTM+LESKVGVGSKFTFTLPL QTKEISFANM+FPFEDEFNPESR+NRRVKFNVA
Sbjct: 901  ANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVA 960

Query: 961  RSIKSRQSASSIATPTANRCGLTNEMLRKSRSXXXXXXXXXXXXXXXXXXXXXLDEAHQQ 1020
            +SIKSRQS SSIATP  NR  L N++L +  S                     +    Q+
Sbjct: 961  KSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQK 1020

Query: 1021 LQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVS 1080
            LQEKNVK  I FSSA+S+E+K+ P    SREES+GSVNLDRPFLQSTGTATS+RN+PT+ 
Sbjct: 1021 LQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQ 1080

Query: 1081 NXXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYN 1140
            +          LVVEDNHVNQEVIKRMLNLEGIENIELACDGQ+AFDKVKELTS+G +YN
Sbjct: 1081 DNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYN 1140

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            MIFMDVQMPKVDGLLSTKMIRRDLGY SPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1201 PKLKTILIEFCAAYQGKK 1218
            PKLKTIL EFCAAYQGKK
Sbjct: 1201 PKLKTILTEFCAAYQGKK 1218

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score = 1841 bits (4768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 916/1218 (75%), Positives = 988/1218 (81%)

Query: 1    MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60
            MRFRLPSRS F PPFRI IRAQLTALVSIVAL+SL ILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120
            AAQLKSSQ+DQTLN          SRDALQ+SLT YVAGNKS DNWVDS+S+VQKFLSSS
Sbjct: 61   AAQLKSSQVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120

Query: 121  NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180
            NLF+VA+VYDSSFTTVLNATNNGTGDLIP+D+ D LFPLSTD+ LPSSLETTGILTDPI+
Sbjct: 121  NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180

Query: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240
            N+TDYLMSMSLPIFANPSIILTDSRVYGYITI+MSAEGLKSVFNDTTALEKSNVAIISA 
Sbjct: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240

Query: 241  YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA 300
            YN Q +A  YHFVFPPYGT  SIT+ IFPI+NNTFISS F+NGKGGSLKKTN+FG KNLA
Sbjct: 241  YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            LGYSPCSFQLVNWVAVVSQPESVFLSP+TKL KII GTVIAIGVFVILLTLPL HWAV+P
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360

Query: 361  IVRLQKATELITEGRGLXXXXXXXXXXXXXFKRGFSSGFAVPSSLLQFNXXXXXXXXXXX 420
            IVRLQKATELITEGRGL             F+RGFSSGF  PSSLLQFN           
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSAN 420

Query: 421  XXXXXXRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLA 480
                   GS   +ST+SSMKSA+N+G+EKLSP EEE + PN+HN+ KISMDGSLNHDLLA
Sbjct: 421  GHGSSGHGSGVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLA 480

Query: 481  PNALXXXXXXXXXXXXXILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540
            PN+L             ILTTSANLTEARLPDY+RLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PNSLRNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660
            IRN+LKLIFRSG            FSKNVLQRTKLE+RDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNNLKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKEL 720
            RVRLSISLFPN IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTV+VRMKLLGEYDK+ 
Sbjct: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDS 720

Query: 721  SEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEE 780
            SEK+QFKEVHV+KGTEI + + +I+K D   S   +K              RD S IQEE
Sbjct: 721  SEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEE 780

Query: 781  ITKRNTAANENIYKKTRDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXX 840
            ITKRNTAANENIYKK  DREK                   AIFNSQFNKA          
Sbjct: 781  ITKRNTAANENIYKKANDREKSSNDDVSSIVSTTTSSYDDAIFNSQFNKALDSDSDESGN 840

Query: 841  XXKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
              +PIENPKTW ISIEVEDTGPGI+PSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  VGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVA 960
            ANMMHGTMKLES+VGVGSKFTFTLPLHQTKEISFAN+ FPFEDEFNPES++NRRVKF+VA
Sbjct: 901  ANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVA 960

Query: 961  RSIKSRQSASSIATPTANRCGLTNEMLRKSRSXXXXXXXXXXXXXXXXXXXXXLDEAHQQ 1020
            +SIKSRQS SS+ TP  N   L N++L ++RS                       +A QQ
Sbjct: 961  KSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQ 1020

Query: 1021 LQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVS 1080
             QEKN K+S+SFSSA+ + QK+  S R S+EE++GSVN+DRPFLQSTGTATS+RN+PTV 
Sbjct: 1021 PQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQ 1080

Query: 1081 NXXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYN 1140
                       LVVEDNHVNQEVI+RMLNLEGI+NIELACDGQ+AFDKVKELTS+GE+YN
Sbjct: 1081 GGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYN 1140

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            MIFMDVQMPKVDGLLSTKMIRRDLGY SPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1201 PKLKTILIEFCAAYQGKK 1218
            PKL TIL EFCAAYQGKK
Sbjct: 1201 PKLNTILSEFCAAYQGKK 1218

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score = 1831 bits (4743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 916/1218 (75%), Positives = 982/1218 (80%), Gaps = 1/1218 (0%)

Query: 1    MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60
            MRF LPS+   TPPFRI IR QLTALVSIVAL SL+ILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120
            AAQLKSSQIDQTLN          SRDALQ+SLT YVAGNKS+DNWVDS+S++QKFLSSS
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS 120

Query: 121  NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180
            NLF+VAKVYDSSF  VLNATNNGTGDLIP+D+ D LFPLSTD  LPSSLET GILTDP+L
Sbjct: 121  NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL 180

Query: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240
            NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALE S +AIISAV
Sbjct: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV 240

Query: 241  YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA 300
            YN+Q KA  YHFVFPPYG+ S + + +F IKN+TFISSAF+NGKGGSLK+TN    +N A
Sbjct: 241  YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
            LGYSPCSF LVNWVA+VSQPESVFLSP+TKLAKIITGTVIAIGVFVILLTLPLAHWAVQP
Sbjct: 301  LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELITEGRGLXXXXXXXXXXXXXFKRGFSSGFAVPSSLLQFNXXXXXXXXXXX 420
            IVRLQKATELITEGRGL             FKRGFSSGFAVPSSLLQFN           
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVS 420

Query: 421  XXXXXXRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLA 480
                   GS A  S +SSMKSA+N+GNEK+SP EEE + PN+H +AKISMDGSLNHDLL 
Sbjct: 421  GHGGSGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLG 480

Query: 481  PNALXXXXXXXXXXXXXILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540
            P++L             ILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLE+RVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660
            IRNSLKLIFRSG            FSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKEL 720
            RVRLSISLFPN IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTV+VRMKLLGEYDKEL
Sbjct: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKEL 720

Query: 721  SEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEE 780
            SEKKQ+KEV+++KGTE+ E++   +K+D     N +K             NRDTSTIQEE
Sbjct: 721  SEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE 780

Query: 781  ITKRNTAANENIYKKTRDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXX 840
            ITKRNT ANE+IYKK  DREK                   AIFNSQFNKA          
Sbjct: 781  ITKRNTVANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGN 840

Query: 841  XXKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
              +PIENPKTW ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  LGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVA 960
            ANMMHGTMKLESKVGVGSKFTFTLPL+QTKEISFA+M FPFEDEFNPESR+NRRVKF+VA
Sbjct: 901  ANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVA 960

Query: 961  RSIKSRQSASSIATPTANRCGLTNEMLRKSRSXXXXXXXXXXXXXXXXXXXXXLDEAHQQ 1020
            +SIKSRQS SS+ATP  NR  LTN++L + RS                      +   +Q
Sbjct: 961  KSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKND-NGGLEQ 1019

Query: 1021 LQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVS 1080
            LQEKN+K SI  + A+ NEQ S  S   SR E +GSVNLDRPFLQSTGTATS+RNIPTV 
Sbjct: 1020 LQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVK 1079

Query: 1081 NXXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYN 1140
            +          LVVEDNHVNQEVIKRMLNLEGIENIELACDGQ+AFDKVKELTS+GE+YN
Sbjct: 1080 DDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYN 1139

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1140 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1199

Query: 1201 PKLKTILIEFCAAYQGKK 1218
            PKLKTIL EFCAAYQGKK
Sbjct: 1200 PKLKTILTEFCAAYQGKK 1217

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1137 bits (2942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/1229 (51%), Positives = 786/1229 (63%), Gaps = 120/1229 (9%)

Query: 8    RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
            RS   PPF++ IR QL ALV +VAL+SLVILAVTTGVYFT+NYK+LR+DRL++AAQLKSS
Sbjct: 8    RSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSS 67

Query: 68   QIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAK 127
            QIDQ LN          +RD LQ+SL  Y AGN + +NW ++  +++KFL SS+LF VA+
Sbjct: 68   QIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVAR 127

Query: 128  VYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLM 187
            +YDS+F TVLNATNNG+G+L+P+ +   LFPLSTD  L SSL+T+GILTDP+LN T Y+M
Sbjct: 128  IYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVM 187

Query: 188  SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKA 247
            SMSLPIFA+PSI+LT+S + GYIT++MSAE LK VFNDTTAL+KS+VAI+SA Y+NQS  
Sbjct: 188  SMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLP 247

Query: 248  YAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCS 307
             +YHFVFPP+G  + I    F I+N +FI SAF + K GS+K+T+ F  K++A+GYSPC 
Sbjct: 248  VSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCL 307

Query: 308  FQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKA 367
            F+ V WVAV+SQPE+VFLSPST+L  II GT + I VF+ L+T PLAHWAV+PIVRLQKA
Sbjct: 308  FKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKA 367

Query: 368  TELITEGRGLXXXXXXX-XXXXXXFKRGFSSGFAVPSSLLQFNXXXXXXXXXXXXXXXXX 426
            TE+IT  RGL              F++  S+  ++ S                       
Sbjct: 368  TEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGHSNFELHH 427

Query: 427  RGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLAPNALXX 486
            R S +V S ++ M+  ++      +P      TP  + N +        H   + N    
Sbjct: 428  RTSNSVDSQEARMELEISGALPDTNPT-----TPTSYTNDQ--------HSYKSDN---- 470

Query: 487  XXXXXXXXXXXILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRV 546
                           S NL +AR+P Y RLFSDELS+LT+TFNTMTD LD+HYALLEDRV
Sbjct: 471  ------------FVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRV 518

Query: 547  RARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLK 606
            RARTKQL             KTVFIANISHELRTPLNGILGMTAISM E D+ K++NSLK
Sbjct: 519  RARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLK 578

Query: 607  LIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSI 666
            LIFRSG            FSKNVLQRTKLE+R+F I DVALQ+KSIFGK+AKDQ V LSI
Sbjct: 579  LIFRSGELLLHILTELLTFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSI 638

Query: 667  SLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQF 726
             L PN IRTM+LWGDSNRIIQIVMNLVSNALKF+PVDG V VR+KLLGEYD + S+   +
Sbjct: 639  ILSPNVIRTMILWGDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNY 698

Query: 727  KEVHVRKGTEIIE--------------DIGNINKHDAKKSENFKKXXXXXXXXXXXXXNR 772
             +V ++ GTEI +               +  I +  A KS + +K               
Sbjct: 699  NDVFIKPGTEIPDASASKSSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIA-------- 750

Query: 773  DTSTIQEEITKRNTAANENIYKKTRDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNK--A 830
             +S +     K  + A+ +    T  R                     AI ++Q  K  +
Sbjct: 751  -SSDVSSSDGKDESEADTDT--DTDKRSNSEISDSLSLVSSNNSSYDDAILHAQLRKVPS 807

Query: 831  XXXXXXXXXXXXKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGT 890
                        + +E  KTW I+IEVEDTGPGI+P+L ESVF PFVQGDQTLSRQYGGT
Sbjct: 808  CGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGT 867

Query: 891  GLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNP-ES 949
            GLGLSICRQLA MM GTMKLESKVGVGSKFTFT+PL QT+E+S       F+D  NP E 
Sbjct: 868  GLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREVS-------FDDVENPFED 920

Query: 950  RQNRRVKFNVARSIKSRQSASSIATPTANRCGLTNEMLRKSRSXXXXXXXXXXXXXXXXX 1009
              N   K N  R +K + + +S  +              KSR                  
Sbjct: 921  EFNAHSKKN--RKVKFKMNKNSGGS--------------KSR------------------ 946

Query: 1010 XXXXLDEAHQQLQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGT 1069
                           +V  S++ S  DS  +K A S     E SVGSV +DRPFLQSTGT
Sbjct: 947  --------------PSVNTSLN-SGTDSTAEKMALS---ESEVSVGSVRVDRPFLQSTGT 988

Query: 1070 ATSNRNIPTVSNXXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKV 1129
            ATS R+I TV +          LV EDN+VNQEV+KRMLNLEG+ +I+LACDGQ+AFDKV
Sbjct: 989  ATSTRSITTVKSLERPFKI---LVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKV 1045

Query: 1130 KELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESG 1189
            K L    + Y +IFMDVQMP+VDGLLSTKMIR++L Y+ PIVALTAFADDSNIK CL+SG
Sbjct: 1046 KALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSG 1105

Query: 1190 MNGFLSKPIKRPKLKTILIEFCAAYQGKK 1218
            MNGFLSKPIKRPKLK++L EFC  +  K+
Sbjct: 1106 MNGFLSKPIKRPKLKSVLSEFCPDFVEKR 1134

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1166

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/960 (56%), Positives = 645/960 (67%), Gaps = 62/960 (6%)

Query: 11  FTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70
           F  P R+ IRAQLTALVSIVAL+SL+ILAV+TGVYFT NYKNLRS+RLY+AAQLKS+QID
Sbjct: 11  FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQID 70

Query: 71  QTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAKVYD 130
           Q LN          SRD LQ +L  YVAGNK+  NWVDS +++QKFL+SS LF VA +YD
Sbjct: 71  QNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYD 130

Query: 131 SSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLMSMS 190
           ++FT VL+ATNNGTG+ IP+   D L PLS +  LPSSL++ GILT+P+LN T YLMSMS
Sbjct: 131 ATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMS 190

Query: 191 LPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKAYAY 250
           LPIFANPSIILT S VYGYITI+MSA+ LK+VF+DTTALEKSNVAI+SAVY+      +Y
Sbjct: 191 LPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSSY 250

Query: 251 HFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCSFQL 310
           +FVF P G  SSI     PIKN TF+SSA + GKGG+L++T     K +A+GYSPCS   
Sbjct: 251 NFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVF 310

Query: 311 VNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATEL 370
           VNW+AVV Q E+VF+ P+TKL KII+GTV+ IGVFV L+T PLAHWAV+PIVRLQKATEL
Sbjct: 311 VNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATEL 370

Query: 371 ITEGRGLXXXXXXXXXXXXXFKRGFSSGFAVPSSLLQFNXXXXXXXXXXXXXXXXXRGSA 430
           ITEGRGL              +  F   F  PS                           
Sbjct: 371 ITEGRGLRASSPGAGSSNVSRRSSF---FHRPS--------------------------- 400

Query: 431 AVMSTDSSMKSAM-NIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLAPNALXXXXX 489
              +  SS++S + +  NEK   L  E+       +   +M+GS+NH L A  ++     
Sbjct: 401 ---NCGSSIRSRVTDNHNEKGHDLHGEQI-----QHGFFAMNGSINHSLAA--SIASSGN 450

Query: 490 XXXXXXXXILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRAR 549
                    LTTSANL EAR+P YRR FSDELS+LT+TFNTMTDALDQHYALLEDRVRAR
Sbjct: 451 EALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRAR 510

Query: 550 TKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIF 609
           T+QL             KTVFIANISHELRTPLNGILGMTAISMEE D++KI+NSLKLIF
Sbjct: 511 TRQLEAAKIDAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIF 570

Query: 610 RSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLF 669
           RSG            FSKNVL+RTKLEKR+F +TDVALQIKSIFGKVAKDQRVRLSI+L+
Sbjct: 571 RSGELLLHILTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLY 630

Query: 670 PNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEV 729
           PN IRTMVL+GDSNRIIQIVMNLVSNALKFTPVDG V V M LLGEYD E SE +  K+V
Sbjct: 631 PNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKV 690

Query: 730 HVRKGTEII----EDIGNINKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEEITKRN 785
           +V  GTE      +D G I + +    EN                    S+ +   T+  
Sbjct: 691 YVIPGTEPKGNDEKDKGGIEEKERFSIENTPNDTSS------------NSSNKHSDTETT 738

Query: 786 TAANENIYKKTRD-----REKXXXXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXX 840
              N+   K+  D      E                     +F+SQF K           
Sbjct: 739 PGLNDTDEKQASDDMDGGEEDVEDADEVSSFSTSTSSYNDTVFHSQFKKTPKVCDDSSEE 798

Query: 841 XXKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900
               +++ K W ISI VEDTGPGID SL ESVF PFVQGDQ LSRQYGGTGLGLSICRQL
Sbjct: 799 LGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQL 858

Query: 901 ANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVA 960
           A MM+GTM L+SK+GVGS+FTFT+PL QT+EI+F ++   FEDEFNP+S++NR+VKF +A
Sbjct: 859 ATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFKIA 918

 Score =  236 bits (603), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 113/164 (68%), Positives = 131/164 (79%), Gaps = 6/164 (3%)

Query: 1056 SVNLDRPFLQSTGTATSNRNIPTVSNXXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGIEN 1115
            SV LDRPFLQSTGTA+SN N+ T S           LV EDN VNQEVIKRMLNLEG+ N
Sbjct: 955  SVRLDRPFLQSTGTASSNTNLGTTS------TINKILVAEDNDVNQEVIKRMLNLEGVHN 1008

Query: 1116 IELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTA 1175
            IEL CDGQ+A DKVK+L   GE YN+IFMDVQMPK+DGLLSTKMIRRDL YT PIVALTA
Sbjct: 1009 IELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTA 1068

Query: 1176 FADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFCAAYQGKKK 1219
            FADDSNI+ECL++GM+GFL+KPIKR +L+ I+ EFC   Q +++
Sbjct: 1069 FADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQ 1112

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/1226 (45%), Positives = 712/1226 (58%), Gaps = 152/1226 (12%)

Query: 1    MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60
            +R RL   +V  PPF+  +R QLT LV I+AL SL+ILA TTGVYFTSNY+ LR+DRL++
Sbjct: 6    LRKRL---AVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHV 62

Query: 61   AAQLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120
            AA+L SSQ+DQ+L           ++D +QN+L+ Y AGN+S++NW+++  I+  FL  S
Sbjct: 63   AARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERS 122

Query: 121  NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180
              F++A +YD  +  VL+  NN T   + ++    L PL  D    +      + T P  
Sbjct: 123  KTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-Y 181

Query: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240
            N T  LMSM+LP+ A  S I+    V G++TI+MSA+ + +V NDT+ L +S V+I++ +
Sbjct: 182  NKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGI 238

Query: 241  YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSF------ 294
             N++     Y FVFPP  T  S+T+T +PIKN +F+  AF N     +  T+SF      
Sbjct: 239  PNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGAL 298

Query: 295  --GIKNLALGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLP 352
                K +A+GYS C F+ ++WVAVVSQ ESVFLSP+ KL KII GTV+ + VF+ ++T  
Sbjct: 299  GHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFI 358

Query: 353  LAHWAVQPIVRLQKATELITEGRGLXXXXXXXXXXXXXFKRGFSSGFAVPSSLLQFNXXX 412
            LA WAV+PIVRLQKATE I  GRG                            L  +N   
Sbjct: 359  LASWAVKPIVRLQKATEFIAAGRG----------------------------LRTYNHSG 390

Query: 413  XXXXXXXXXXXXXXRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKIS-MD 471
                          RGS      D S+   +      +SP   E    N  + + +S  +
Sbjct: 391  RSSSQNTSIDRSNSRGS------DHSLPRELFEKKHHVSPFVTENHAANSGSCSSMSDHE 444

Query: 472  GSLNHDLLAPNALXXXXXXXXXXXXXILTTSANLTEARLPDYRRLFSDELSDLTETFNTM 531
              L+H  +A                   T++ N  + R+P YRRLF+DELS+LT+TFNTM
Sbjct: 445  RYLHH--IARYHDGETSTNILSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTM 502

Query: 532  TDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAI 591
            TD LD+ Y +LEDRVRARTKQL             KTVFIANI HELRTPLNGILGMTAI
Sbjct: 503  TDELDRQYVVLEDRVRARTKQLEAAKIQAEAANEAKTVFIANIFHELRTPLNGILGMTAI 562

Query: 592  SMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKS 651
            +M E D  KI+NSLKLIFRSG            FSKNVL+RTKLE+R F I D+ALQ+KS
Sbjct: 563  AMAEQDQEKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKS 622

Query: 652  IFGKVAKDQRVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMK 711
            IFGK+AKDQ V+LSI L PN IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDG V+VR+K
Sbjct: 623  IFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIK 682

Query: 712  LLGEYDKELSEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSE--NFKKXXXXXXXXXXXX 769
            L                               + ++D+ +SE  NF +            
Sbjct: 683  L-------------------------------VGEYDSARSEACNFSEVYILPGTEVTNS 711

Query: 770  XNRDTSTI---QEEITKRNTAANENIYKKTRDREKXXXXXXXXXXXXXXXXXXXAIFNSQ 826
               +  T+   +E+  +    A++   +K +D E                    A+ ++Q
Sbjct: 712  SVNNIPTVVEEEEKACEEEPTADDTPERKKKDSETVDDADAISISSSVATSYDDAVLHAQ 771

Query: 827  FNKAXX---XXXXXXXXXXKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTL 883
              K                  +E P++W I IEV+DTGPGI+PSL ESVF PFVQGDQTL
Sbjct: 772  LKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTL 831

Query: 884  SRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFED 943
            SRQYGGTGLGLSICRQLA MM GTMKLESKVG GSKFTFT+PL QT  + F + +  FED
Sbjct: 832  SRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFED 891

Query: 944  EFNPESRQNRRVKFNVARSIKSRQSASSIATPTANRCGLTNEMLRKSRSXXXXXXXXXXX 1003
            EFN  S++NR+VKF +                  NR G       KSR            
Sbjct: 892  EFNIFSKKNRKVKFQL------------------NRSG-------KSRKG---------- 916

Query: 1004 XXXXXXXXXXLDEAHQQLQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPF 1063
                            ++   N   SI+ S+ +S  +  +       E S GSV +DRPF
Sbjct: 917  ----------------KMNNSNGAGSIAESAIESFGKSES-------EASFGSVRVDRPF 953

Query: 1064 LQSTGTATSNRNIPTVSNXXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGIENIELACDGQ 1123
            LQSTGTATS R++PT+S+          LV EDN+VNQEVIKRML+LEG  NI+LACDG+
Sbjct: 954  LQSTGTATSTRSVPTLSSAESSLRI---LVAEDNNVNQEVIKRMLHLEGAHNIDLACDGE 1010

Query: 1124 DAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIK 1183
            DA+ KV  L  +GE Y++IFMDVQMP++DGLL+TK++R+ L Y  PIVALTAFADDSNIK
Sbjct: 1011 DAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIK 1070

Query: 1184 ECLESGMNGFLSKPIKRPKLKTILIE 1209
            ECLESGMN FL+KPIKRP LK IL+E
Sbjct: 1071 ECLESGMNSFLAKPIKRPMLKKILLE 1096

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1187

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/732 (59%), Positives = 531/732 (72%), Gaps = 32/732 (4%)

Query: 13  PPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQT 72
           PP+RISIR QL A+VS+VA++SL+ILAVTTGVYFTS+YKNLR++RLYIAAQLKSSQIDQT
Sbjct: 25  PPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQT 84

Query: 73  LNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAKVYDSS 132
           L           +RD LQ+SL  +VAGNKSS NW  + S+++KFLSSS+ F   KVYD +
Sbjct: 85  LTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDEN 144

Query: 133 FTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLMSMSLP 192
           F TVL+ TNNGTG+ I  D+ ++LFPLST++ L SSLETTGILTDP+LN T YLMSMSLP
Sbjct: 145 FDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSLP 204

Query: 193 IFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKAYAYHF 252
           +FANPSIIL+ SRVYGYITIIM+A+GL SVFNDTTA+EKSNVAI+SAVYNNQS+  AYH 
Sbjct: 205 VFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYHL 264

Query: 253 VFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCSFQLVN 312
             PPYG ++S+T   F +KN++F++ A K GKGGS+KKT+    K +A+GYSPCSF+L N
Sbjct: 265 ALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELAN 324

Query: 313 WVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELIT 372
           WV+VVSQ ESVF  PSTKL KII G V+ I VFV+L+TLPLA++AV+PIVRL+KATE+IT
Sbjct: 325 WVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEIIT 384

Query: 373 EGRGLXXXX--XXXXXXXXXFKRGFSSGFAVPSSLLQFNXXXXXXXXXXXXXXXXXRGSA 430
           EGRGL                +R  S   ++ SS                      R S 
Sbjct: 385 EGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSS----------------------RKST 422

Query: 431 AVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLL------APNAL 484
           A  +++S  +++ ++ +  +    E     N    ++I ++  +N +LL        N L
Sbjct: 423 ATGNSNSLNENSASLSSHPMVLTSENVLVTNHSGLSRIPVN--MNQELLDRASASTVNTL 480

Query: 485 XXXXXXXXXXXXXILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLED 544
                         L T  NLTEAR+P  R+LF DELSDLTETFNTMTDALD+HY LLED
Sbjct: 481 TIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLED 540

Query: 545 RVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNS 604
           RVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEE D+ KIR+S
Sbjct: 541 RVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSS 600

Query: 605 LKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRL 664
           LKLIFRSG            FSKNVLQRTKLEKR+FCITDVALQ+KSIFGKVAKDQ VRL
Sbjct: 601 LKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRL 660

Query: 665 SISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKK 724
           SI L PN +RTMVL+GDSNRIIQ+VMNLVSNALKFTPVDG V+V++KLLGEYD+E S+  
Sbjct: 661 SIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNS 720

Query: 725 QFKEVHVRKGTE 736
           +F++V+V+ GTE
Sbjct: 721 KFEKVYVKGGTE 732

 Score =  422 bits (1086), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/392 (58%), Positives = 264/392 (67%), Gaps = 45/392 (11%)

Query: 821  AIFNSQFNKAXXXXXXXXXXXXKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGD 880
            AIFNSQF K             + +   KTW   IEV DTGPGID SLQESVF PFVQGD
Sbjct: 818  AIFNSQFKKTPDLYEDEDGNLGEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGD 877

Query: 881  QTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFP 940
            QTLSRQYGGTGLGLSICRQLA MM+GTM LES VG GSKF FT+PL QT+ I       P
Sbjct: 878  QTLSRQYGGTGLGLSICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHP 937

Query: 941  FEDEFNPESRQNRRVKFNVARSIKSRQSASSIATPTANRCGLTNEMLR-KSRSXXXXXXX 999
            +EDEFNP+S+ NR+VKFNVARSI SR+S SS+ T  ++R     E  R ++RS       
Sbjct: 938  YEDEFNPKSKMNRKVKFNVARSINSRRSRSSLITSNSSRIATVREESRLETRS------- 990

Query: 1000 XXXXXXXXXXXXXXLDEAHQQLQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNL 1059
                                        N    S+++ NE  S       + ES  ++NL
Sbjct: 991  ----------------------------NHSDVSTSNKNESASP------QPESGSNLNL 1016

Query: 1060 DRPFLQSTGTATSNRNIPTVSNXXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGIENIELA 1119
            DRPFLQSTGTA S+ N+PTV+           LV EDNHVNQEVIKRML+LEG++NI+LA
Sbjct: 1017 DRPFLQSTGTAISSANVPTVATLGKTLNV---LVAEDNHVNQEVIKRMLSLEGVKNIDLA 1073

Query: 1120 CDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADD 1179
            CDGQDAFD VK L  RGE Y+MIFMDVQMPKVDGL +TKMIR DL Y  PIVALTAFADD
Sbjct: 1074 CDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADD 1133

Query: 1180 SNIKECLESGMNGFLSKPIKRPKLKTILIEFC 1211
            SNIKECL++GM+GFLSKPIKRP+LKTIL+E+C
Sbjct: 1134 SNIKECLDAGMDGFLSKPIKRPQLKTILLEYC 1165

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1183

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/724 (59%), Positives = 492/724 (67%), Gaps = 35/724 (4%)

Query: 499  LTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXX 558
            LTTSANL EAR+PDYRRLFSDELSDLT+TFN MTDALDQHYALLEDRVRARTKQL     
Sbjct: 480  LTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKI 539

Query: 559  XXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXX 618
                    KT+FIANISHELRTPLNGILGMTAISMEETD+ KIR+SLKLIFRSG      
Sbjct: 540  EAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHI 599

Query: 619  XXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVL 678
                  FSKNVL+RT LEKRDFCITDVALQIKSIFGKVAKDQRVRLSI L PN IRTM+L
Sbjct: 600  LTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMIL 659

Query: 679  WGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEII 738
            +GDSNRIIQIVMNLVSNALKFTPVDG V VR+KL+GEYD+ LS +  FK+V V+ GTE I
Sbjct: 660  FGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFI 719

Query: 739  ED-----IGNINKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEEITKRNTAANENIY 793
            E      +G   K D K S                  + D  +   +  K +   +E   
Sbjct: 720  ETKAKAILGAPKKDDPKTSTESVVQIKENLNSNTSSSSNDIISTTSDEKKYDEKEDEGEE 779

Query: 794  KKTRDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXXXXKPIENPKTWAI 853
              + +                      A+FN+QF K               + NPKTW I
Sbjct: 780  DNSDNDNDDTSMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVI 839

Query: 854  SIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESK 913
            +IEV+DTGPGIDPSLQ+SVF PFVQGDQTLSRQYGGTGLGLSICRQLANMM+GTM+L+S+
Sbjct: 840  AIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSE 899

Query: 914  VGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVARSIKSRQSASSIA 973
            VGVGS FTFT+PL QT+E+     + PFEDEFNP SR+NRRVKF +A+S++SR+S SS  
Sbjct: 900  VGVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKFKLAKSLRSRKSRSSTT 959

Query: 974  TPTANRCGLTNEMLRKSRSXXXXXXXXXXXXXXXXXXXXXLDEAHQQLQEKNVKNSISFS 1033
            T  +    L N    K                         ++AHQ+ +  + KN     
Sbjct: 960  T-FSTTNSLHNVQEEKEEDKLGDNEETKDGGKE--------EDAHQERRHSHDKN----- 1005

Query: 1034 SADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVSNXXXXXXXXXXLV 1093
                NE  +           +G+VN+DRPFLQSTGTATS R I TV +          LV
Sbjct: 1006 ----NEHNN---------HLLGTVNMDRPFLQSTGTATSTRTIQTVPD---AGKKFKILV 1049

Query: 1094 VEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDG 1153
             EDNHVNQEVIKRMLNLEG+ENIELA DGQDAF++VK +  +GE ++MIFMDVQMPKVDG
Sbjct: 1050 AEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDG 1109

Query: 1154 LLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFCAA 1213
            LLSTKMIR DL YT PIVALTAFADDSNIKECLE+GMNGFLSKPIKRPK+KTIL E+C  
Sbjct: 1110 LLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPN 1169

Query: 1214 YQGK 1217
            +Q K
Sbjct: 1170 WQMK 1173

 Score =  550 bits (1416), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 262/377 (69%), Positives = 309/377 (81%)

Query: 1   MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60
           M+  L    V  PPFR+ IR QLT LVS+VAL SLVILA+TTGVYFTSNYKNLRSDRLYI
Sbjct: 1   MKVNLSKWYVLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYI 60

Query: 61  AAQLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120
           AAQLKSSQIDQ LN          SRD LQ  LT YVAGNK+++NW DS  ++QKFL+S+
Sbjct: 61  AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN 120

Query: 121 NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180
           NLF  A++YDSSF  VL ATNNGTGDLIP+ +  +L+PL+T+  L SSLET GILTDP+L
Sbjct: 121 NLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVL 180

Query: 181 NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240
           N + Y+MSMSLPIFANPSIILTDS+VYGYITI+MSAEGLK+VFNDTTALE+SNVAI+S V
Sbjct: 181 NGSTYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGV 240

Query: 241 YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA 300
           YNN+S   AYHFVF PYG  S +  + F I NN+F+++A + GKGGS+KKT  F  KN+A
Sbjct: 241 YNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIA 300

Query: 301 LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
           +GYSPC+F  VNW+A+VSQ ESVFLSPSTKLAKII+GTV+AIGVFV L+T PLAHWAV+P
Sbjct: 301 VGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKP 360

Query: 361 IVRLQKATELITEGRGL 377
           IVRLQKATEL++EGRGL
Sbjct: 361 IVRLQKATELMSEGRGL 377

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/749 (57%), Positives = 489/749 (65%), Gaps = 72/749 (9%)

Query: 500  TTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXX 559
            TT+ NL +AR+P YR LF DELSDLTETFNTMTDALDQHYALLE+RVRARTKQL      
Sbjct: 476  TTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIE 535

Query: 560  XXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXX 619
                   KTVFIANISHELRTPLNGILGMTAISMEETD++KIRNSLKLIFRSG       
Sbjct: 536  AETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHIL 595

Query: 620  XXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLW 679
                 FSKNVL+RTKLEKR+FCITDVALQIKSIFGKVAKDQ VRLSI L PN IR+MVL+
Sbjct: 596  TELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLY 655

Query: 680  GDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIE 739
            GDSNRIIQIVMNLVSNALKFTPVDG V+VRMK+LG YD+ LSEK    +V+V+ GTEI +
Sbjct: 656  GDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITD 715

Query: 740  DIGNINKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEEITKR--NTAANENIYKKTR 797
               ++N     KSE   K             + DT+      T R    +  +N+Y+   
Sbjct: 716  STPSLN----VKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYE--- 768

Query: 798  DREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXXXXK-PIENPKTWAISIE 856
            D E                    AIFNSQF K                +E PKTW IS E
Sbjct: 769  DNE--------SMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFE 820

Query: 857  VEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGV 916
            VED+GPGID  LQESVF PFVQGDQTLSRQYGGTGLGLSICRQLA MM G M LESKVGV
Sbjct: 821  VEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGV 880

Query: 917  GSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVARSIKSRQSASSIATPT 976
            GSKFTFTLPL QT+EI+FAN+  PFEDEFN +S++NR+VKF +ARS+ SR+S SSI T  
Sbjct: 881  GSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAG 940

Query: 977  AN-------RCGLTNEMLRKSRSXXXXXXXXXXXXXXXXXXXXXLDEAHQQLQEKNVKNS 1029
            A+       R    +  L+  RS                      D       E+  +N 
Sbjct: 941  ASSHHSVHTRTPTKSPRLKCDRSVS--------------------DRVVINSPERTGEN- 979

Query: 1030 ISFSSADSNEQKSAPSTRHSREESVGSVN----LDRPFLQSTGTATSNRNIPTVSN---- 1081
            I+F S   +        R    E + + N    LDRPFLQSTGTATS R+IP +S+    
Sbjct: 980  ITFRSESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEE 1039

Query: 1082 ------------------XXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGIENIELACDGQ 1123
                                        LV EDNHVNQEVIKRML LEG+++I+LACDGQ
Sbjct: 1040 KPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQ 1099

Query: 1124 DAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIK 1183
            DAFDKVK+L  +G  YN+IFMDVQMPKVDGL STKMIR DL    PIVALTAFADDSNIK
Sbjct: 1100 DAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIK 1159

Query: 1184 ECLESGMNGFLSKPIKRPKLKTILIEFCA 1212
            ECL++GM+GFLSKPIKR KLKTIL EFC+
Sbjct: 1160 ECLDAGMDGFLSKPIKRTKLKTILKEFCS 1188

 Score =  542 bits (1396), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 268/379 (70%), Positives = 308/379 (81%), Gaps = 5/379 (1%)

Query: 1   MRFRLPSRSVFTP--PFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRL 58
           M FRL S   FTP  P+R+ IRAQLT LVSIVA+ISLVILAVTTGVYFTSNYKNLRSDRL
Sbjct: 1   MWFRLRS---FTPKPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRL 57

Query: 59  YIAAQLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLS 118
           YIAAQLKSSQIDQ LN          SRD LQ  L  YVAGNKS  NW+DS S+++KFL 
Sbjct: 58  YIAAQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLG 117

Query: 119 SSNLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDP 178
           SSNLF VA+VYDSSFTTVLN TNN TGDLIP+D+  +L PLST++ LPSSLET GI+T+P
Sbjct: 118 SSNLFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNP 177

Query: 179 ILNSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIIS 238
           + N + YLMSMSLPIFANPSIILTDSRVYGY+T++MSAEGL SVFNDTTALE+S VAI+S
Sbjct: 178 VKNGSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVS 237

Query: 239 AVYNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKN 298
           AVY N +K  AY FVFPP+G++SSI    FP+ NNTF+SSA + GKGG+LK T  F    
Sbjct: 238 AVYTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLK 297

Query: 299 LALGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAV 358
           LA+GYSP +  L NWVA+V+Q ESVF+SP+TKLAKII GTV+ IGVF +L+T PLAHWAV
Sbjct: 298 LAVGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAV 357

Query: 359 QPIVRLQKATELITEGRGL 377
           +PIVRLQKATELITE RGL
Sbjct: 358 KPIVRLQKATELITESRGL 376

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/791 (56%), Positives = 505/791 (63%), Gaps = 48/791 (6%)

Query: 439  MKSAMNIGN--EKLSPLEEEKRTPNDH-NNAKISMDGSLNHDLLAPNALXX-XXXXXXXX 494
            MK  +N  N   +LS  E+  R   D  +++  + DGSL+HDL    A            
Sbjct: 398  MKKDINDLNFISRLSLSEKNHRPAYDSASDSNYATDGSLSHDLQTSQASNRPSDNDRSSS 457

Query: 495  XXXILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLX 554
                LTTS NL EARLPDYRRLFSDELSDLT TFN MTDALDQHYALLEDRVRARTKQL 
Sbjct: 458  RSRFLTTSTNLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLE 517

Query: 555  XXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXX 614
                        KTVFIANISHELRTPLNGILGMTAISMEETD+ KIRNSLKLIFRSG  
Sbjct: 518  AAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGEL 577

Query: 615  XXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIR 674
                      FSKNVL+RT LEKR+FCITDVALQIKSIFGKVAKDQ VRLSISL PN IR
Sbjct: 578  LLHILTELLTFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIR 637

Query: 675  TMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKG 734
            TMVLWGDSNRIIQIVMNLVSNALKFTPVDG V VR+KLLGEYD+E ++   FK++H    
Sbjct: 638  TMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHT--- 694

Query: 735  TEIIEDIGNINKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEEITKRNTAANENIYK 794
               I D     +H    S N                +  TS+        +   NE  Y 
Sbjct: 695  ---IADSDAHQQHPVSSSPN-----------GVLVKHLSTSSDSNSNLSDSDKYNEKTYD 740

Query: 795  KTRDREKXXXXXXXXXXXXXXXXXXX-----AIFNSQFNKAXXXXXXXXXXXXKPIENPK 849
            +  D                           A+FN+QF K               + + K
Sbjct: 741  EDDDEHSITNISDHSDDLSSLVSSSTSSYDNALFNTQFKKTPDLYEDSNDGLGTELADQK 800

Query: 850  TWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMK 909
            TW  +IEVEDTGPGIDP L ESVF PFVQGDQTLSRQYGGTGLGLSICRQLA MMHGTMK
Sbjct: 801  TWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMK 860

Query: 910  LESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKF-NVARSIKSRQS 968
            LESKVGVGSKFTFT+PL QT+ I F      FEDEFNPES++NRRVKF +  RS+ SR+S
Sbjct: 861  LESKVGVGSKFTFTVPLKQTRVIKFDEEEDLFEDEFNPESKKNRRVKFKDSTRSLHSRRS 920

Query: 969  ASSIATPTANRCGLTNEMLRKSRSXXXXXXXXXXXXXXXXXXXXXLDEAHQQLQEKNVKN 1028
             +S+         +TN    K  S                      DE  +Q  E +  N
Sbjct: 921  RTSVDR-------ITNHSGDKQSSEGHSTSFKISEVK---------DEDIEQSPEPD--N 962

Query: 1029 SISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVSNXXXXXXX 1088
                   + ++  S+ S   + +E    V+LDRPFLQSTGTATS+RN+PT+++       
Sbjct: 963  LPKVGDENDSKASSSSSKSDNIKEKEEKVHLDRPFLQSTGTATSSRNVPTMAD---VTMR 1019

Query: 1089 XXXLVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQM 1148
               LV EDNHVNQEVIKRMLNLEGI NI+LACDGQDAFDKV+ L  + +SY+MIFMD+QM
Sbjct: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079

Query: 1149 PKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILI 1208
            PKVDGLLSTKMIRRDL Y   IVALTAFADDSNIKEC+E+GMNGFLSKPIKRPKLK IL 
Sbjct: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139

Query: 1209 EFCAAYQGKKK 1219
            E+C  +   KK
Sbjct: 1140 EYCPNWIEMKK 1150

 Score =  542 bits (1396), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 260/370 (70%), Positives = 302/370 (81%)

Query: 8   RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
           R    PPFRI IRAQLTALVSIVA +SL+ILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS
Sbjct: 11  RRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 70

Query: 68  QIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAK 127
           Q+DQ LN          SRD LQN+L  YVAGNK+ +NW +S +++QKFLSSSNLFF+++
Sbjct: 71  QLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSR 130

Query: 128 VYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLM 187
           VYD  F  VLN TNNGTGD +P+ I ++LFPLSTD+ LPSSL T G+LTDP+LN TDYLM
Sbjct: 131 VYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLM 190

Query: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKA 247
           SMSLPIFANPSII +D +VYGYIT++MSAEGL+SVFNDTTALEKSNVAI+SA Y+N +K 
Sbjct: 191 SMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKI 250

Query: 248 YAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCS 307
            +Y FVFPPYG S SI    F + +++F++ AFK  KGGS+KKT  F  K++A+GY PCS
Sbjct: 251 DSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCS 310

Query: 308 FQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKA 367
           F  VNWVAVVSQ ESVFLSPSTKL KII+GTV+ I VFV LLT PLA WAV+PIVRLQKA
Sbjct: 311 FNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKA 370

Query: 368 TELITEGRGL 377
           TELI EGRGL
Sbjct: 371 TELIAEGRGL 380

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/727 (54%), Positives = 499/727 (68%), Gaps = 43/727 (5%)

Query: 13  PPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQT 72
           PPF ISIR QLTALV +VAL+SL+ILAV TGVYFTS++K++R++RLY+A+QLK+SQIDQ 
Sbjct: 19  PPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKASQIDQN 78

Query: 73  LNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAKVYDSS 132
           L           +RD LQN+LT Y+AGN +++NW D+V+ + KFL SSNLF +A+VYDSS
Sbjct: 79  LYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYDSS 138

Query: 133 FTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLMSMSLP 192
           F  VLNA+NN +G+L+P+ +  +LFPLST+++LPSSLE  G+LTDP+LN T YLMSMSLP
Sbjct: 139 FQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSLP 198

Query: 193 IFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKAYAYHF 252
           IFANPSIIL+ S+VYGYIT+++SAEGLK+VFNDTTALE S+V ++S VY+N+  A  YH 
Sbjct: 199 IFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNRELA-GYHL 257

Query: 253 VFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCSFQLVN 312
           VFPPYG  S I    + I N++F+  AFK  KGGS+K T+    K +A+GYSPCS  LV 
Sbjct: 258 VFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLVQ 317

Query: 313 WVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELIT 372
           WVA+++QPES FL PST+LA+II GT +AI V    +T PL+HWAVQPIVRLQKATE+IT
Sbjct: 318 WVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATEIIT 377

Query: 373 EGRGLXXX--XXXXXXXXXXFKRGFSSGFAVPSSLLQFNXXXXXXXXXXXXXXXXXRGSA 430
            GRGL                   FSS    P+S+                     R S 
Sbjct: 378 AGRGLRSDNGSTLYSHKRSSTAESFSSALH-PASI---------------------RRSG 415

Query: 431 AVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHD------LLAPNAL 484
           +V  +             K  P E  K T N ++  +I  DG  N++      + +P   
Sbjct: 416 SVARS----------SKHKYIP-ESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPG 464

Query: 485 XXXXXXXXXXXXXILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLED 544
                         +T++ NL EAR+P Y RLFSDELS+LTETFNTMTD LD+HYALLED
Sbjct: 465 SLFSEQRSARSERYITST-NLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLED 523

Query: 545 RVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNS 604
           RVRART+QL             KTVFIANISHELRTPLNGILGMTAI+M E D+ K+++S
Sbjct: 524 RVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSS 583

Query: 605 LKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRL 664
           LKLIFRSG            FSKNVL+RTKLE+RDF + ++ALQ++SIFGK+AKDQ V L
Sbjct: 584 LKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNL 643

Query: 665 SISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKK 724
           +IS+ PN +RTMVLWGDSNRI+QIVMNLVSNALKFTPVDG V V+  LLGEYD+  +   
Sbjct: 644 TISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNG 703

Query: 725 QFKEVHV 731
            F    V
Sbjct: 704 CFDRAAV 710

 Score =  232 bits (591), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 110/172 (63%), Positives = 135/172 (78%), Gaps = 7/172 (4%)

Query: 1051 EESVGSVNLDRPFLQSTGTATSNRNIPTVSNXXXXXXXXXXLVVEDNHVNQEVIKRMLNL 1110
            E SVGSV +DRPFLQSTGTA S R++ T S           LV EDN+VNQEVIKRMLNL
Sbjct: 1003 EVSVGSVRVDRPFLQSTGTALSTRSVTTTS----VANKCKVLVAEDNNVNQEVIKRMLNL 1058

Query: 1111 EGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPI 1170
            EG+++++LACDGQDAFDKVK     G+ Y++IFMDVQMP+VDGL +T+MIR +L YT PI
Sbjct: 1059 EGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPI 1118

Query: 1171 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFCAAY---QGKKK 1219
            VALTA+ADD NIKEC+++GMNGFL+KPI+RPK+K IL E+C  Y    G+KK
Sbjct: 1119 VALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKK 1170

 Score =  198 bits (504), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 91/141 (64%), Positives = 113/141 (80%), Gaps = 4/141 (2%)

Query: 821 AIFNSQFNKAXXXXXXXXXXXXKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGD 880
           AIF+S+  K             +P+E+P+  AI++EV+DTGPGI+P+LQESVF PFVQGD
Sbjct: 840 AIFHSRLRKGNSGENEDG----RPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGD 895

Query: 881 QTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFP 940
           QTLSRQYGGTGLGLSICRQLA MM+G+M L+SKVGVGSKFTFT+PL QTKE+ F     P
Sbjct: 896 QTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELCFEEDENP 955

Query: 941 FEDEFNPESRQNRRVKFNVAR 961
           FEDEFNP+S++NR+VKF V++
Sbjct: 956 FEDEFNPDSKKNRKVKFKVSK 976

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/715 (54%), Positives = 456/715 (63%), Gaps = 70/715 (9%)

Query: 501  TSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXX 560
            T++NL +AR+P Y R   DELS+LT+TFN MT+ALDQHY LLEDRVRARTKQL       
Sbjct: 456  TTSNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEA 515

Query: 561  XXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXX 620
                  KTVFIANISHELRTPLNGILGMTAISMEE D +KI+ +LKLIFRSG        
Sbjct: 516  EAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILT 575

Query: 621  XXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWG 680
                FSKNVL+RT LEKRDFCIT++ALQIKSIFGKVA+DQ V+L I L PN IR+MVLWG
Sbjct: 576  ELLTFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWG 635

Query: 681  DSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIED 740
            DSNRIIQIVMNLVSNALKFTP+DG V+VR+KLLGEYD+E S    +KEV+++ GTE+   
Sbjct: 636  DSNRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTEL--P 693

Query: 741  IGNINKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEEITKRNTAANENIYKKTRDRE 800
            IGN  K D  + +  ++             +    +   +I K      +N +    D  
Sbjct: 694  IGNGKKTDMVRKK-IQELSEKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNEDTN 752

Query: 801  KXXXXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXXXXKPIENPKTWAISIEVEDT 860
                                A    QF K             + +  PKTW IS+EVEDT
Sbjct: 753  N--DIEILSMTTSSTRSYDDAALQRQFKKTPDLDDKEETLGVE-LSEPKTWVISVEVEDT 809

Query: 861  GPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKF 920
            GPGI+P LQE+VF PFVQGDQ LSRQYGGTGLGLSICRQLA MMHGTMKLES VGVGSKF
Sbjct: 810  GPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKF 869

Query: 921  TFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVARSIKSRQSASSIATPTANRC 980
             FT+PL QT+EI F +    FEDEFN ES++NRR+KF +  S KS  S            
Sbjct: 870  IFTVPLKQTREIHFDDEK--FEDEFNAESKKNRRIKFKIYDSSKSHDSN----------- 916

Query: 981  GLTNEMLRKSRSXXXXXXXXXXXXXXXXXXXXXLDEAHQQLQEKNVKNSISFSSADSNEQ 1040
                                              DE      E+ +K+S    S++ NE 
Sbjct: 917  ----------------------------------DE-----DEEGIKSSRDIDSSN-NEH 936

Query: 1041 KSAPST---RHSREESVGSVNLDRPFLQSTGTATSNRNIPTVSNXXXX--XXXXXXLVVE 1095
            K    T    HS+      V LDRPFLQSTGTATS++ IPT+ N            LV E
Sbjct: 937  KDENGTSPDNHSK------VRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAE 990

Query: 1096 DNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLL 1155
            DNHVNQEVIKRMLNLE I+NI+LACDGQDAFDKVK L    E Y++IFMDVQMPKVDGL+
Sbjct: 991  DNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLV 1050

Query: 1156 STKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            STKMIR+DL Y  PIVALTAFA+D NIKECL++GM+GFL KPIKRPKLK IL E+
Sbjct: 1051 STKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

 Score =  501 bits (1289), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 245/375 (65%), Positives = 297/375 (79%), Gaps = 1/375 (0%)

Query: 3   FRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAA 62
            R   R  F PP+RI+IRAQLTALVS+VA+ISL+ILAVTTGVYFT NYK LRS RL IAA
Sbjct: 1   MRQSWRKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAA 60

Query: 63  QLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNL 122
           +LKSSQIDQTLN          SRD LQN+L  Y AGNK+ +NW++S ++VQKFLSSS+L
Sbjct: 61  KLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDL 120

Query: 123 FFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNS 182
           F+VA++YD +F  V+NATNNGTGDLIP ++  ELFPLST+ +LPSSL   GILTDP+LN 
Sbjct: 121 FYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNG 180

Query: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYN 242
           + YLMSMSLPI  NPSIIL+ SRVYGYITI+MSA+GLK+V+ + TALE SNV +ISA+YN
Sbjct: 181 SIYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYN 240

Query: 243 NQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALG 302
           +Q K   +HFVF       S T   +PI+N T++SSA   GK GS+KKT     + LA+G
Sbjct: 241 DQGKVDGFHFVFEVENDDFS-TLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIG 299

Query: 303 YSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362
           YSPCSF L NWVA+V+QPE+VFLSPSTKL KII+GTV+AI VFV L+T PL+HWAV+PIV
Sbjct: 300 YSPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIV 359

Query: 363 RLQKATELITEGRGL 377
           RLQKATELI++GRGL
Sbjct: 360 RLQKATELISQGRGL 374

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/714 (53%), Positives = 463/714 (64%), Gaps = 70/714 (9%)

Query: 501  TSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXX 560
            TS NL EAR+P Y+RLFSDELS+LTETFNTMTD LD+HYALLEDRVRART+QL       
Sbjct: 480  TSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEA 539

Query: 561  XXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXX 620
                  KTVFIANISHELRTPLNGILGMTAI+M E D  K+++SLKLIFRSG        
Sbjct: 540  EGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMT 599

Query: 621  XXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWG 680
                FSKNVL+RTKLE+RDF I D+ALQ++SIFGK+AKDQ V L+IS+ PN +R+MVLWG
Sbjct: 600  ELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWG 659

Query: 681  DSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIED 740
            DSNRI+QIVMNLVSNALKFTPVDG V+V+ +LLGEYD+E S+  ++KEV V   TE    
Sbjct: 660  DSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTE--SR 717

Query: 741  IGNINKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEEITKRNTAA---NENIYKKTR 797
              +    D K +E+                + D   ++  I +R+ +    +E I     
Sbjct: 718  TSSTEAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVK--IGQRSESEAIDSEAIESSDE 775

Query: 798  DREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXXXXKPIENPKTWAISIEV 857
            D E                    AIF ++  K             + +E+PK W IS+EV
Sbjct: 776  DDENEDTKSIGSGNTSSYDD---AIFQTRLRK---DSSNEENEEGRALESPKKWVISMEV 829

Query: 858  EDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVG 917
             DTGPGIDP+L ESVF PFVQGDQTLSRQYGGTGLGLSICRQLA MMHGTMKL+S+VGVG
Sbjct: 830  HDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVG 889

Query: 918  SKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVARSIKSRQSASSIATPTA 977
            SKF+FT+PL QTKE+ F ++  PFEDEFNP+S++N        R +K R   S+  + + 
Sbjct: 890  SKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKN--------RKVKFRMGKSNKRSKSR 941

Query: 978  NRCGLTNEMLRKSRSXXXXXXXXXXXXXXXXXXXXXLDEAHQQLQEKNVKNSISFSSADS 1037
            +    T                                       E N  NS     +  
Sbjct: 942  SESSGT---------------------------------------EGNGGNSPGVEGSGG 962

Query: 1038 NEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVSNXXXXXXXXXXLVVEDN 1097
            N    +P T    E SVGSV +DRPFLQSTGTA S   + T S           LV EDN
Sbjct: 963  N----SPGT--GSEVSVGSVRVDRPFLQSTGTALSTTLVTTSS----LADRRKILVAEDN 1012

Query: 1098 HVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLST 1157
            +VNQEVIKRMLNLEG+E++ELACDGQDAFDKVK   + G+ Y++IFMDVQMP+VDGL +T
Sbjct: 1013 NVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTAT 1072

Query: 1158 KMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFC 1211
            +MIR++LGY+ PIVALTAFADDSNIKECL++GMNGFLSKPIKRPK+K IL E+C
Sbjct: 1073 RMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYC 1126

 Score =  478 bits (1231), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 225/364 (61%), Positives = 289/364 (79%), Gaps = 1/364 (0%)

Query: 14  PFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQTL 73
           P  +SIR QLTALV +VAL+SL+ILAV TGVYFTS++K+LR++RL++AAQLKSSQIDQ L
Sbjct: 20  PLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKSSQIDQNL 79

Query: 74  NXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAKVYDSSF 133
           N          +RD LQN+LT Y+AGN S++NW D+ + + KFL SSNLF +A+VYDSSF
Sbjct: 80  NYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVYDSSF 139

Query: 134 TTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLMSMSLPI 193
             VLN +NNG+G+LIP+++  +LFPLSTD+ALPSSLE TG+LTDP+LN + YLMSMSLPI
Sbjct: 140 QDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSMSLPI 199

Query: 194 FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKAYAYHFV 253
           FANPSIIL+ ++VYGYIT+++SAEGLKSV+NDTTAL+ S+V I+S VY++   A  YH V
Sbjct: 200 FANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDHELA-GYHLV 258

Query: 254 FPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCSFQLVNW 313
           FPPY     +    + I+N +F+  A K+GKGGS+K T  F  K +A+GYSPC+  L  W
Sbjct: 259 FPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNSTLAQW 318

Query: 314 VAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITE 373
           VA+++QPE++FLSPST+LAKII GT IAI V   ++T PL+HWAVQPIVRLQKATE+IT 
Sbjct: 319 VAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEIITA 378

Query: 374 GRGL 377
           GRGL
Sbjct: 379 GRGL 382

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/729 (52%), Positives = 470/729 (64%), Gaps = 73/729 (10%)

Query: 502  SANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXX 561
            S NL EA +P YRR F DELS+LT+TFNTMTD LD+HYALLE+RVRARTKQL        
Sbjct: 488  STNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAE 547

Query: 562  XXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXX 621
                 KTVFIANISHELRTPLNGILGMTAI+M ETD+ K++NSLKLIFRSG         
Sbjct: 548  SANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTE 607

Query: 622  XXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWGD 681
               FSKNVL+RTKLE+RDF + D+ALQIKSIFGK+AKDQ V+LSI+L PNFIRT+VLWGD
Sbjct: 608  LLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGD 667

Query: 682  SNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIEDI 741
            SNRIIQIVMNLVSNALKFTPVDG V+VR+KLLGEYD + SE   ++EV V  G+E  +D 
Sbjct: 668  SNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDF 727

Query: 742  G-NINKHDAKK----SENFKKXXXXXXXXXXXXXNRDTSTIQEEITKRNTAANEN----- 791
              N+      +    S +                     +IQ E ++ +T  N+N     
Sbjct: 728  EFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVE-SETSTEGNDNDESSI 786

Query: 792  IYKKTRDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXXXX-KPIENPKT 850
            + +   +  +                   AIF+SQF K              + ++ PKT
Sbjct: 787  VLESKHEENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKT 846

Query: 851  WAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKL 910
            W IS+EVEDTG GIDPSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQLA MM GTMKL
Sbjct: 847  WVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKL 906

Query: 911  ESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVARSIKSRQSAS 970
            +SKVGVGSKF FT+PL QTKEI F      FEDEFN  SR+NR+VKF +  S KS Q+  
Sbjct: 907  DSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQT-- 964

Query: 971  SIATPTANRCGLTNEMLRKSRSXXXXXXXXXXXXXXXXXXXXXLDEAHQQLQEKNVKNSI 1030
                             +KS+S                       + H         N++
Sbjct: 965  -----------------KKSKSSI---------------------DGHSD-------NNV 979

Query: 1031 SFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVSNXXXXXXXXX 1090
            S   A ++ + S  + R           +DRPFLQSTGTATS R+I +V++         
Sbjct: 980  SERKASNSTENSVGNVR-----------VDRPFLQSTGTATSTRSISSVAS---EVTRHR 1025

Query: 1091 XLVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPK 1150
             LV EDN+VNQEVIKRML LEG+ ++++ACDGQ+A++KV+E+   GESY+MIFMDVQMP+
Sbjct: 1026 VLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPR 1085

Query: 1151 VDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            VDGLL+TKMIR DL Y  PIVALTA+ADDSNIK CLESGM+GFL KPIKRP LK I+ ++
Sbjct: 1086 VDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKRPLLKKIIAQY 1145

Query: 1211 CAAYQGKKK 1219
            C+  + +++
Sbjct: 1146 CSKKEKQRE 1154

 Score =  457 bits (1175), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 221/370 (59%), Positives = 281/370 (75%)

Query: 8   RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
           R  FTPPF + +R QL  LV  + ++SL I+ VTTGVYFT+NYK++R++RL +AAQLKSS
Sbjct: 15  RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74

Query: 68  QIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAK 127
           Q+DQ LN          +RD LQ++L  + AGN S DNW  +   ++KFL SS LF  A+
Sbjct: 75  QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134

Query: 128 VYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLM 187
           VYD+SF TV+N+TNNG+GD IP+++  ELFPLS    L SSL TTGI+TDP+ N T+YL+
Sbjct: 135 VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194

Query: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKA 247
           SMSLP+  NPSIIL  + + GYIT+I SAE LK+V NDT AL+KS+V+I+SAV+++ S  
Sbjct: 195 SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254

Query: 248 YAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCS 307
             YHFVFPP+GTSS  +K  FPIKN TFI+ AF+NGK GS+ KTN    +N+A+GYSP +
Sbjct: 255 TGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPT 314

Query: 308 FQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKA 367
           F+LVNWVAVV+QPE VFLSP+ +L KII GTV AI VF+ LLT P+AHWAVQPIVRLQKA
Sbjct: 315 FKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKA 374

Query: 368 TELITEGRGL 377
           TE+IT GR L
Sbjct: 375 TEIITSGRDL 384

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/779 (50%), Positives = 464/779 (59%), Gaps = 115/779 (14%)

Query: 503  ANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXX 562
            + + E ++P YRRLF DELS+LT+TFNTM+DALDQHYALLE+RVRARTKQL         
Sbjct: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEA 531

Query: 563  XXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXX 622
                KTVFIANISHELRTPLNGILGMTAISMEE D++ I++SLKLIFRSG          
Sbjct: 532  ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTEL 591

Query: 623  XXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWGDS 682
              FSKNVLQRTKLE+RDFCITDVALQIKSIFGKVAKDQ V+LSI L PN IRT+VLWGDS
Sbjct: 592  LTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651

Query: 683  NRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIEDIG 742
            NRIIQIVMNLVSNALKFTP+DG V VRM LLGEYDKE S+   +KEV V+ GTE  E+  
Sbjct: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711

Query: 743  NINK----------HDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEEITKRNTAANENI 792
             I +            A+  +N ++             N   S+        NT  + +I
Sbjct: 712  KILQKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSS--------NTTFDISI 763

Query: 793  YKKTRDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXXXXKPIENPKTWA 852
            + +TRD                       +FN QF K               I+ PKTW 
Sbjct: 764  HNRTRDDTLSLLSTSTSSYDE-------TVFNDQFKKITGLQDHDEERLGVEIKEPKTWV 816

Query: 853  ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLES 912
            I IEVEDTGPGI P+LQESVF PFVQGDQ LSRQYGGTGLGLSICRQLA MM+GTM LES
Sbjct: 817  ICIEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLES 876

Query: 913  KVGVGSKFTFTLPLHQTKEISFA---NMNFPFEDEFNPESRQNRRVKFNVARSIKSRQSA 969
            KVG GSKFTFT+PL QT+EI      ++N  F+DEFN  S++NR+VKF            
Sbjct: 877  KVGSGSKFTFTVPLTQTREIVIGEDEDINEFFDDEFNIYSKKNRKVKF------------ 924

Query: 970  SSIATPTANRCGLTNEMLRKSRSXXXXXXXXXXXXXXXXXXXXXLDEAHQQLQEKNVKNS 1029
               A P++    L N  L+  +S                           ++Q  N    
Sbjct: 925  ---AIPSSPGTTLANSSLKSRKSKGSLNSSFVG-----------------EIQNVNEAEE 964

Query: 1030 ISFSSADSNEQKSAP----STRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVSNXXXX 1085
             +++S D N          ST  S   S+ S  LDRPFLQSTGTATS   IP + +    
Sbjct: 965  DAYNSKDINSSGELKIRHISTSTSNNNSIPS--LDRPFLQSTGTATSTMKIPVLKDFSNS 1022

Query: 1086 XXX--------------------------------------------XXXLVVEDNHVNQ 1101
                                                              LV EDNHVNQ
Sbjct: 1023 ATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSIIIDEEEEDEGIRILVTEDNHVNQ 1082

Query: 1102 EVIKRMLNLEGIENIELACDGQDAFDKVKELTS-----RGESYNMIFMDVQMPKVDGLLS 1156
            EVIKRML LE + NI+LACDG++A+ KVKE+TS     +   Y++IFMDVQMP++DGL S
Sbjct: 1083 EVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLES 1142

Query: 1157 TKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFCAAYQ 1215
            TK+IR +L YT PIVALTAFAD+SNIKECL+ GM+GFLSKPIKRPKLK IL EFC  Y 
Sbjct: 1143 TKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGYH 1201

 Score =  483 bits (1244), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 232/371 (62%), Positives = 287/371 (77%), Gaps = 1/371 (0%)

Query: 8   RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
           RS+  PP  I IR QLTALV  VA +SL+ILAV TG+YFT NYK++R DRL IAA+LKSS
Sbjct: 8   RSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSS 67

Query: 68  QIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAK 127
           Q+DQTLN           RD LQ ++  Y AGNKSS  W DS  +V+KFLSSS++F +++
Sbjct: 68  QVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISR 127

Query: 128 VYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLM 187
           +YD++F  V+NATNNGTG+++P D+  +L PLS+   LP+SL ++G+LTDP+LNST YLM
Sbjct: 128 LYDANFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTTYLM 187

Query: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKA 247
           SMSLPI ANPSIILTDS+VYGYITIIMSAE L SV+NDTTALEKSNVAI+S  Y++ S +
Sbjct: 188 SMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSAS 247

Query: 248 YA-YHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPC 306
              YHFVFPPYG +  I    +P++N +F+  A  N K GS+ KT  F   ++A+GYSPC
Sbjct: 248 LTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPC 307

Query: 307 SFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366
           SF LV+WVA+VSQPESVFLSPSTKL +II GTV+AI VFV  +T PL+HWAV+PIVRLQK
Sbjct: 308 SFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQK 367

Query: 367 ATELITEGRGL 377
           ATELI EGRGL
Sbjct: 368 ATELIAEGRGL 378

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  561 bits (1447), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 273/375 (72%), Positives = 312/375 (83%)

Query: 3   FRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAA 62
            ++P + V  PPFRI IRAQLTALVSIVA +SL+ILA+TTGVYFT+NYKNLRSDRLYIAA
Sbjct: 1   MKIPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAA 60

Query: 63  QLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNL 122
           QLKSSQIDQTLN          SRD LQ +LT YVAGNKS++NW DS SI+QKFLSSSNL
Sbjct: 61  QLKSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNL 120

Query: 123 FFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNS 182
           F VAKVYD+SFTTVLN TNNGTGD IP  I  +L PLST++ L SSLETTGILTDP+LNS
Sbjct: 121 FSVAKVYDASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNS 180

Query: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYN 242
           + YLMSMSLPIFANPS+IL +SRVYGY+T++MSAEGL++VFNDTTALEKSNVAI+SAVYN
Sbjct: 181 STYLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYN 240

Query: 243 NQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALG 302
           N S   AY FVF P G  S I  + + + N +F+SSA + GKGGSLK T  F  KN+A+G
Sbjct: 241 NVSALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIG 300

Query: 303 YSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362
           YSPC+F  VNWVAVVSQ ESVFLSPSTKLAKII GTV+AIGVFV ++T PLAHWAV+PIV
Sbjct: 301 YSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIV 360

Query: 363 RLQKATELITEGRGL 377
           RLQKATELI+EGRGL
Sbjct: 361 RLQKATELISEGRGL 375

 Score =  252 bits (643), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 118/162 (72%), Positives = 135/162 (83%), Gaps = 3/162 (1%)

Query: 1057 VNLDRPFLQSTGTATSNRNIPTVSNXXXX---XXXXXXLVVEDNHVNQEVIKRMLNLEGI 1113
            V+LDRPFLQSTGTATS+RN+P +S              LV EDNHVNQEVIKRMLNLEG+
Sbjct: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153

Query: 1114 ENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVAL 1173
              I+LACDGQ+AFDKVK L+ + +SYN+IFMDVQMPKVDGLLSTKMIR+DL Y  PIVAL
Sbjct: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213

Query: 1174 TAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFCAAYQ 1215
            TAFADDSNIKECLESGMNGFLSKPIKRPKL+TI+ E+C  ++
Sbjct: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWK 1255

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1095

 Score =  539 bits (1389), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 292/495 (58%), Positives = 334/495 (67%), Gaps = 18/495 (3%)

Query: 466 AKISMDGSLNHDLLAPNALXXXXXXXXXXXXXILTTSANLTEARLPDYRRLFSDELSDLT 525
            + S +GS N+D   P+               +  TS+NL EAR+P YR  FSDE S+LT
Sbjct: 417 GRASTEGSFNYDQAVPSLNSNAEISSDRTRKYM--TSSNLVEARVPVYRIFFSDEFSELT 474

Query: 526 ETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGI 585
           +TFNTMT+ALDQHYALLEDRVRARTKQL             KTVFIANISHELRTPLNGI
Sbjct: 475 DTFNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANISHELRTPLNGI 534

Query: 586 LGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEKRDFCITDV 645
           LGMTAISMEE D++KI++SLKLIFRSG            FSKNVLQRTKLEKRDF ITDV
Sbjct: 535 LGMTAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFSITDV 594

Query: 646 ALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGT 705
           A+QIKSIFGKVAKDQRV+ SI+LFPN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDG 
Sbjct: 595 AVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGK 654

Query: 706 VEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKKXXXXXXXX 765
           V VRM+LLGEYDK+ SE + FK V+V  GTE  ED G I        + F+K        
Sbjct: 655 VSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPRED-GLI----PPPVKQFEKQEDLEKEK 709

Query: 766 XXXXXNRDTSTIQEEITKRNTAANENIYKKTRDREKXXXXXXXXXXXXXXXXXXXAIFNS 825
                N       EE    + +   N+  KT D ++                    IF++
Sbjct: 710 ISEKHN-------EEEASTSDSEKTNLDDKTPDSKRSDADDQVSLISISTSSYDDTIFHT 762

Query: 826 QFNKAXXXXXXXXXXXXKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSR 885
           QF K               +E+PK WAIS+EVEDTGPGIDPSL ESVF PFVQGDQ LSR
Sbjct: 763 QFKKHTSSSGDENGHL---LEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSR 819

Query: 886 QYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEF 945
           QYGGTGLGLSICRQLA MM+GTMKL+SK+GVGSKFTFTLPL QT+EI F + N  FEDEF
Sbjct: 820 QYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTREIEFEDEN-AFEDEF 878

Query: 946 NPESRQNRRVKFNVA 960
           NP S++NR+VKF VA
Sbjct: 879 NPLSKKNRKVKFKVA 893

 Score =  496 bits (1278), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 244/377 (64%), Positives = 300/377 (79%)

Query: 1   MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60
           MR    ++  F+PPFRISIR QLTALVS+VAL+SL+ILAVTTGVYFTSNYK+LRS+RLY+
Sbjct: 1   MRLGTIAKEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYV 60

Query: 61  AAQLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120
           AAQLKSSQIDQ LN          S+  LQ SL  YV+GNK+  NWVDS S++QKFLSSS
Sbjct: 61  AAQLKSSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSS 120

Query: 121 NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180
            LF VA+VYD+ F TVLNATNNGTGD++  D+  +L PLS++MALP+SLE+ G+LTDP+L
Sbjct: 121 ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL 180

Query: 181 NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240
           N T YLMSMSLPI+ANPSIILT+SRVYGY+TIIMSA+ LKSV++D TALEKS+V I+SA+
Sbjct: 181 NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI 240

Query: 241 YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA 300
           Y       +Y FVF PYGT+  I    +PI NN+F+S+A + GK GS ++T+ F  +  A
Sbjct: 241 YKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSA 300

Query: 301 LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360
           +GYSPCSF+ VNWVA++SQ E+VF+ PST+L KII G V+ IG FV + T PLAHWAVQP
Sbjct: 301 VGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQP 360

Query: 361 IVRLQKATELITEGRGL 377
           IVRLQKATE+ITEGRGL
Sbjct: 361 IVRLQKATEIITEGRGL 377

 Score =  246 bits (627), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 117/161 (72%), Positives = 134/161 (83%), Gaps = 3/161 (1%)

Query: 1051 EESVGSVNLDRPFLQSTGTATSNRNIPTVSNXXXXXXXXXXLVVEDNHVNQEVIKRMLNL 1110
            E SVG+V+LDRPFLQSTGTA+S++N+  VSN          LV EDNHVNQEVIKRML L
Sbjct: 928  EFSVGNVSLDRPFLQSTGTASSSKNVTVVSNVNKSYRI---LVAEDNHVNQEVIKRMLTL 984

Query: 1111 EGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPI 1170
            EGI+ I+LA DGQDAFDKVK L  +GE Y +IFMDVQMPKVDGLL+TKMIR+DL Y  PI
Sbjct: 985  EGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPI 1044

Query: 1171 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFC 1211
            VALTAFADDSNI+ CLE+GMNGFLSKPIKRPKLKTI+ ++C
Sbjct: 1045 VALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1127

 Score =  503 bits (1296), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 271/482 (56%), Positives = 324/482 (67%), Gaps = 29/482 (6%)

Query: 501 TSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXX 560
           TSANL EAR+P Y RL  DELS+LT+TFNTMTDALDQHY LLE+RVRARTKQL       
Sbjct: 468 TSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQA 527

Query: 561 XXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXX 620
                 KTVFIANISHELRTPLNGILGMTAISMEE DV+KIR +LKLIFRSG        
Sbjct: 528 ESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILT 587

Query: 621 XXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWG 680
               FSKNVLQRTKLEKRDFCIT+VALQIKSIFGK+AKDQ V+LSI L PN +R+ VLWG
Sbjct: 588 ELLTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWG 647

Query: 681 DSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIED 740
           DSNRIIQ+VMNLVSNALKFTPVDG V+VR+ LLGEYD+E S+ + +K+V+V++GTE+  +
Sbjct: 648 DSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLN 707

Query: 741 IGNI----NKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEEITKRNT--AANENIYK 794
           I ++    N   ++KSE                   +T TI ++ T  ++    NE++  
Sbjct: 708 ISHLKTEENNDISRKSE-----------TELNNDENETHTISKDDTADSSIKIGNEDVEI 756

Query: 795 KTRDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXXXXKPIENPKTWAIS 854
              D+                      +  S                   ++  KTW IS
Sbjct: 757 SEVDKMGMASLVTTSSKSYDDTALMKQLIKS------TDLDDDENKLGVELKEQKTWVIS 810

Query: 855 IEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKV 914
           +EV+DTG GIDP LQESVF PFVQGDQ LSRQYGGTGLGLSIC+QL+ MM+GTM+LES+V
Sbjct: 811 VEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEV 870

Query: 915 GVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNV-----ARSIKSRQSA 969
           GVGSKF FTLPL QT+EIS  +    F DEFN  S++NR+VKF       A+SIK+R S 
Sbjct: 871 GVGSKFIFTLPLKQTREISIPDDEL-FNDEFNAVSKKNRKVKFKFSGSSSAKSIKTRNSI 929

Query: 970 SS 971
            S
Sbjct: 930 GS 931

 Score =  443 bits (1139), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 221/376 (58%), Positives = 289/376 (76%), Gaps = 1/376 (0%)

Query: 3   FRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAA 62
            +L  +  + PP+RISIRAQLTALVS+VA+ISL+ILAVT GVYFT+NYKNL++ RLYIAA
Sbjct: 1   MQLIPKKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAA 60

Query: 63  QLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNL 122
           QLK+SQIDQTLN          S + LQNSL  Y AGN SS NW +S  +++KFL+SS+L
Sbjct: 61  QLKASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDL 120

Query: 123 FFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNS 182
           F VA++YD++F  ++NATNN +G+ +P+ + D+LF LS +++LPSSLET GI TDP+LN 
Sbjct: 121 FSVARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNG 180

Query: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYN 242
           +++LMSMSLPIFANPSIIL+DSR+YGY+++IMSAEGLKSVFNDTTALE S V +ISA Y+
Sbjct: 181 SNFLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYS 240

Query: 243 NQSKAYAYHFVFP-PYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLAL 301
             +    ++F+F   Y  +       + I N+TF+ +   NGKGG++KKTN F     A+
Sbjct: 241 ITTNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAV 300

Query: 302 GYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPI 361
           GYS CSF LVNW+A+V+QPE+ F   +TKL +II+G V+A+ VFV LLT PL+HWAVQP+
Sbjct: 301 GYSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPL 360

Query: 362 VRLQKATELITEGRGL 377
           +RLQKATE I EGRGL
Sbjct: 361 IRLQKATERIAEGRGL 376

 Score =  205 bits (521), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 101/169 (59%), Positives = 122/169 (72%), Gaps = 9/169 (5%)

Query: 1056 SVNLDRPFLQSTGTATSNRNIPTVSNXXXXXXXXXXL---------VVEDNHVNQEVIKR 1106
            SV L+RPFLQSTGTATS +N+PT++           L         V EDNHVNQEVIKR
Sbjct: 959  SVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKR 1018

Query: 1107 MLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGY 1166
            ML LEGI NI+LA DGQDAFDK K L+    +Y++IFMDVQMP++DGL +TKMIR +L Y
Sbjct: 1019 MLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNY 1078

Query: 1167 TSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFCAAYQ 1215
            T PIVAL+AF  + N+KECL+ GMN FLSKPIKRP LK IL ++   +Q
Sbjct: 1079 TQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ 1127

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
           similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  493 bits (1269), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 267/476 (56%), Positives = 315/476 (66%), Gaps = 29/476 (6%)

Query: 499 LTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXX 558
            TTSAN  E R+P YRRLFSDELS+LT+TFN+MTD LD+HYALLEDRVRARTKQL     
Sbjct: 475 FTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKI 534

Query: 559 XXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXX 618
                   KT+FIANISHELRTPLNGILGMTAI+M E D+ K++NSLKLIFRSG      
Sbjct: 535 QAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHI 594

Query: 619 XXXXXXFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVL 678
                 FSKN+L+R KLE+R+F + DVALQ+KSIFGK+AKDQ V+ SI L PN IR MVL
Sbjct: 595 LTELLTFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVL 654

Query: 679 WGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEII 738
           WGDSNRIIQIVMNLVSNALKFTPVDG V +R+KLLGEYD+E SEK    EV +++GTEI 
Sbjct: 655 WGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEIS 714

Query: 739 EDIGNINKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEEITKRNTAANENIYKKTRD 798
           ++  N+                            DT T ++ ++    + ++ I      
Sbjct: 715 DETKNV---------------------------FDTITEEKYVSCSGESTDDTIETGQEG 747

Query: 799 REKXXXXXXXXXXXXXXXXXXXAIFNSQFNK--AXXXXXXXXXXXXKPIENPKTWAISIE 856
            +K                   AIF+S+F K  A               E  K W ISIE
Sbjct: 748 AQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIE 807

Query: 857 VEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGV 916
           VEDTGPGIDPSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQL+ MM GTMKL S+VGV
Sbjct: 808 VEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGV 867

Query: 917 GSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVARSIKSRQSASSI 972
           GSKF FT+PL QT  +   +    FEDEFN +S+ NRRVKF + +  KSRQS+ S+
Sbjct: 868 GSKFIFTVPLRQTGTVEDLDDEDLFEDEFNAQSKINRRVKFKLNKGGKSRQSSLSV 923

 Score =  343 bits (879), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 185/371 (49%), Positives = 256/371 (69%), Gaps = 1/371 (0%)

Query: 8   RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
           + +F PP++  +  QLT LV I+AL SL+ILAVTTGVYFT+NYK+LR+DRL +AAQL S+
Sbjct: 20  KHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLTSA 79

Query: 68  QIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAK 127
           QI+QTLN          SRD++QN+L  Y  GN SS N  ++  ++ KFL SSN  F   
Sbjct: 80  QINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTH 139

Query: 128 VYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLM 187
           +YDS+F  VL+ + N TG++I  D+  +L PLS++  LPSS+   G+L++P+ N + + M
Sbjct: 140 LYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSFFM 199

Query: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKA 247
           SMSLP+ A  SI+   S   GYIT++MSA+ + SV     AL  S V++++ VY+  +  
Sbjct: 200 SMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNIL 259

Query: 248 YAYHFVFPPYGTS-SSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPC 306
            +Y  +FPP       + + +FPI NN+F+ +AF N   GS+ KTN+F   N+A+GY+ C
Sbjct: 260 NSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAAC 319

Query: 307 SFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366
           SF+LVNWVAVV+Q E+VFLSPSTKL KII GTVI I  F+ ++T  +A+WAV+PIVRLQK
Sbjct: 320 SFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQK 379

Query: 367 ATELITEGRGL 377
           ATELI  GRGL
Sbjct: 380 ATELIAAGRGL 390

 Score =  219 bits (559), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 104/153 (67%), Positives = 127/153 (83%), Gaps = 3/153 (1%)

Query: 1059 LDRPFLQSTGTATSNRNIPTVSNXXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGIENIEL 1118
            +DRPFLQSTGTATS R+IPTV +          LV EDN+VNQEVIKRML LEGI +IEL
Sbjct: 951  VDRPFLQSTGTATSTRSIPTVGSLESNFKV---LVAEDNNVNQEVIKRMLQLEGIYDIEL 1007

Query: 1119 ACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFAD 1178
            ACDG++A +KV  LT++ + YN++FMDVQMPK+DGL++T+ IR++L YT PIVALTAFAD
Sbjct: 1008 ACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFAD 1067

Query: 1179 DSNIKECLESGMNGFLSKPIKRPKLKTILIEFC 1211
            DSNIK CLESGM+GFLSKPIKR KL+ IL+E+C
Sbjct: 1068 DSNIKVCLESGMDGFLSKPIKREKLRKILLEYC 1100

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  456 bits (1172), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 235/454 (51%), Positives = 300/454 (66%), Gaps = 45/454 (9%)

Query: 504 NLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXXX 563
           NL + ++P  RR   DELS+LTET+  MTDALD+H  LLE RV+ RTKQL          
Sbjct: 450 NLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESA 509

Query: 564 XXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXXX 623
              KTVFIAN++HELRTPLNGILGMTAI+MEETD+ +I++SLKLI+RSG           
Sbjct: 510 NEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGELLLHILTELL 569

Query: 624 XFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWGDSN 683
            FSKNVL++TKLEK  FC+ D+ALQI+SIFGK++KDQ V+LSI + PN +R+MVLWGD N
Sbjct: 570 TFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQN 629

Query: 684 RIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIEDIGN 743
           RI+Q++MNLVSNALKFTPVDG + V +KLLGEYDK+ S  + +K+V+++       +I N
Sbjct: 630 RILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK-------EIRN 682

Query: 744 INKHDAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEEITKRNTAANENIYKKTRDREKXX 803
            N    K                    ++DT ++ + I+ ++ A+         D E+  
Sbjct: 683 SNGDKIKP-------------LMTLISSKDTMSVADNISNKSVAS---------DTER-- 718

Query: 804 XXXXXXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXXXXKPIENPKTWAISIEVEDTGPG 863
                             I++++F K              P++  + W IS+EVEDTGPG
Sbjct: 719 -------------STNNTIYSNKF-KNGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPG 764

Query: 864 IDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFT 923
           I+PSLQ+SVF PFVQGDQTLSRQYGGTGLGLSICRQLAN+MHGTMKLES+VGVGSKF FT
Sbjct: 765 IEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFT 824

Query: 924 LPLHQTKEISFANMNFPFEDEFNPESRQNRRVKF 957
           +PL QT+EI F      FEDEFN  S++NR VKF
Sbjct: 825 VPLLQTREIEFNGNELVFEDEFNINSKKNREVKF 858

 Score =  434 bits (1117), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 205/374 (54%), Positives = 271/374 (72%)

Query: 3   FRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAA 62
            R  + S++  P+++ +R QLT LV  VA+ISL+ILA++TGVYFT NY++LR  +LYIAA
Sbjct: 2   LRACNVSIWKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAA 61

Query: 63  QLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNL 122
           +LKSSQIDQT+N           RD ++++LT Y AGN+S++NW  +  ++  FL SS +
Sbjct: 62  RLKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVV 121

Query: 123 FFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNS 182
           F    +YDS F  +LN TNN T D IP D+   L PLS   +LPS L TTG+LTDP+LN 
Sbjct: 122 FLTTTLYDSQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLND 181

Query: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYN 242
           + YLMSMSLPI ANPS+ L+DSRV+GY+T++MSAE +++V NDTTALEKS VA+IS+   
Sbjct: 182 STYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNT 241

Query: 243 NQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALG 302
           N +    YHFVFPP+G S  I  T +P++N+TF+S AF + +GGS+ K+ S   K +A+G
Sbjct: 242 NGTSGQEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIG 301

Query: 303 YSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362
           Y PCSF L NWV  VSQPE VF+S S KL KII GTVIAI VFV ++T PL+ W+VQPIV
Sbjct: 302 YWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIV 361

Query: 363 RLQKATELITEGRG 376
           RLQKATE+I++  G
Sbjct: 362 RLQKATEVISKRDG 375

 Score =  182 bits (462), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 80/120 (66%), Positives = 100/120 (83%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN VNQ V+ RML LEGIEN  +ACDGQ+A +K+KE+ SRGE Y ++ MD+QMPKV
Sbjct: 920  LIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKV 979

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFC 1211
            DG+ +TK+IR++L Y  PIVALTAFADDSNI+ C +SGM+GFL+KPIKR +LK IL EFC
Sbjct: 980  DGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTEFC 1039

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  434 bits (1115), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/465 (50%), Positives = 295/465 (63%), Gaps = 36/465 (7%)

Query: 508 ARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXK 567
            R+P +    +DEL++L ETFN M D+LD+H  LLE+RV+ARTK+L             K
Sbjct: 468 VRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAK 527

Query: 568 TVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFSK 627
           TVFIANISHELRTPLNGILGMTAI++EE D  K++ SLKLI+RSG            FSK
Sbjct: 528 TVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSK 587

Query: 628 NVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWGDSNRIIQ 687
           NVLQ+TKLEK  FCI D+ALQIKSIFGK+AKDQ V  SI + PN IRTMV +GDSNRIIQ
Sbjct: 588 NVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQ 647

Query: 688 IVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIEDIGNINKH 747
           ++MNLVSNALKFTP+DG V+VR+KLLGEYD+E S    + +V++++GT    D      +
Sbjct: 648 VIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGD------N 701

Query: 748 DAKKSENFKKXXXXXXXXXXXXXNRDTSTIQEEITKRNTAANENIYKKTRDREKXXXXXX 807
           DA  +E                    +S+I +  +K  T  N+NI  + +  +       
Sbjct: 702 DAIPTEPISDKISFAG---------GSSSIHDYCSK--TDENDNIKTEIKSDDSTISDYS 750

Query: 808 XXXXXXXXXXXXXAIFNSQFNKAXXXXXXXXXXXXKPIENPKTWAISIEVEDTGPGIDPS 867
                         I  S +               KP    K W IS++VEDTGPGI P+
Sbjct: 751 EEN-----------IMGSYYENKNPGQELLGVPIPKP----KKWVISVDVEDTGPGISPT 795

Query: 868 LQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLH 927
           LQ+SVF PFVQGDQTLSRQYGGTGLGLSICRQLA++MHGTM+L+S  G+GSKFTFT+PL 
Sbjct: 796 LQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLL 855

Query: 928 QTKEISFANMNFPFEDEFNPESRQNRRVKFN----VARSIKSRQS 968
           Q ++I F+     FEDEFN  S++NR+V F      +R I S+ +
Sbjct: 856 QERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTSRGIPSKAA 900

 Score =  399 bits (1026), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 201/372 (54%), Positives = 274/372 (73%), Gaps = 3/372 (0%)

Query: 8   RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
           R   +PP+ +++RAQL  L  IV++ISL+IL+++TGVYFT+NYK+LR+++L+IAAQLKSS
Sbjct: 7   RLATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKSS 66

Query: 68  QIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAK 127
           Q+DQ+LN            D L ++L  Y +GNK+++NWV+S+S V  FL+SS++F  A 
Sbjct: 67  QLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRAT 126

Query: 128 VYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLM 187
           +YD++F  + N +NNGTG  IP DI  +L PLS+D  LP+S+ T G LTDP+LN+++YLM
Sbjct: 127 IYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLM 186

Query: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKA 247
           S+SLPIF NPSIIL+DSRVYGY+TII  A  + +VFNDTTALE SNVAIISA Y N S  
Sbjct: 187 SLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRN-STT 245

Query: 248 YA--YHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSP 305
           YA  YHFVFPPYG+ +S+    +P+ NN+F+  AF     GS+  T  F    +A+GYS 
Sbjct: 246 YADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYST 305

Query: 306 CSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQ 365
           C+F L NWVAVVSQPESVF S + KL KII+GTV+ I   V  +T  ++++ V+PI++L+
Sbjct: 306 CTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLK 365

Query: 366 KATELITEGRGL 377
           +ATELI+ GRGL
Sbjct: 366 QATELISRGRGL 377

 Score =  155 bits (393), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN VNQEVIKR+L LE I+ IE A DGQ+A D VK+  S  + +++IFMD+QMP V
Sbjct: 943  LIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNV 1002

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T++IR +L Y  PIVALTAFADDSN KEC  SGMN FL+KPIKR +LK I+ EF
Sbjct: 1003 DGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  360 bits (923), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/387 (49%), Positives = 251/387 (64%), Gaps = 12/387 (3%)

Query: 3   FRLPS--------RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLR 54
            RLPS        +    PP+R S+RAQLT LV IVA+ISL  LA+ TGVYFT++YK+L 
Sbjct: 1   MRLPSWKIKLKMNKQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLN 60

Query: 55  SDRLYIAAQLKSSQIDQTLNXXXXXXXXXXSRDALQNSLTGYVAGNKSSDNWVDSVSIVQ 114
            +RLYIA+QLKSSQIDQTLN          SR+ +Q  +     G  ++   ++S S++ 
Sbjct: 61  VNRLYIASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLD 120

Query: 115 KFLSSSNLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLS-TDMALPSSLETTG 173
           KF+ +S+LF+   +YD +  +++N+TNN +G  +   I   L PLS T+  +P  +  TG
Sbjct: 121 KFVGTSDLFYYTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTG 180

Query: 174 ILTDPILNSTDYLMSMSLPI---FANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALE 230
           ILTDPILNST YLMSMSLPI   ++  + I   S +YGY+T++MSAE LKSVFNDT  L 
Sbjct: 181 ILTDPILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLS 240

Query: 231 KSNVAIISAVYNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKK 290
            S  A++SA+Y N +    +HFVFPP+    SI      IKN TF   AF   K GS KK
Sbjct: 241 DSTTALLSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKK 300

Query: 291 TNSFGIKNLALGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLT 350
                 KN A+GY+P +F L  WVAVV+ P+  F S S KL KII GTV+ I VFV L++
Sbjct: 301 VKLVNKKNYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLIS 360

Query: 351 LPLAHWAVQPIVRLQKATELITEGRGL 377
           LPL++WAVQPIVRLQ+A+ELIT+ RGL
Sbjct: 361 LPLSYWAVQPIVRLQRASELITKRRGL 387

 Score =  262 bits (669), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 130/242 (53%), Positives = 175/242 (72%), Gaps = 2/242 (0%)

Query: 507 EARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXX 566
           E ++P YR+LF DEL++LT+TFN M++ALD+HYALLE RV  RTKQL             
Sbjct: 482 EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAEAANEA 541

Query: 567 KTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGXXXXXXXXXXXXFS 626
           KTVFIANISHELRTPLNGILGMT+ S+EE D+ KI++ LKLIFRSG            FS
Sbjct: 542 KTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTELLTFS 601

Query: 627 KNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFP-NFIRTMVLWGDSNRI 685
           KNVL +TKLE R+F I ++  QIK+IF K+ + Q V+L I L P  F+++++ +GDSNRI
Sbjct: 602 KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYGDSNRI 661

Query: 686 IQIVMNLVSNALKFTP-VDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIEDIGNI 744
           +Q++MNL+SNA+KFTP V+G VEV M LLGEYD+E S+ + + +V ++  T+I+ + G +
Sbjct: 662 LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGEL 721

Query: 745 NK 746
            K
Sbjct: 722 IK 723

 Score =  154 bits (388), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 76/119 (63%), Positives = 93/119 (78%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            LV EDN VNQEVIKRML LE I +IELA DG +AF+KVK+     + Y++IFMD+QMPK+
Sbjct: 1018 LVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKM 1077

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DGL ST  IR++L Y   IVALTAFAD+SNIKEC ++GM+GF+ KPIKR  L T+L EF
Sbjct: 1078 DGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136

 Score =  131 bits (330), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (79%)

Query: 845 IENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMM 904
           IE  K W I  EV D GPGID +L +SVF PFVQGDQTLSRQYGGTGLGLSIC+QL  MM
Sbjct: 824 IEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMM 883

Query: 905 HGTMKLESKVGVGSKFTFTLPLHQ 928
            GT++LES++G GSKF +T+PL Q
Sbjct: 884 KGTLELESELGKGSKFIYTIPLLQ 907

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 67/119 (56%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V  ++  + L   G  ++E+  DG  A + V++       Y+++ MD+ MP +
Sbjct: 332  LLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVMPNL 385

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T +IR      +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++LI +
Sbjct: 386  DGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 67/119 (56%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V  ++  + L   G  ++E+  DG  A + V++       Y+++ MD+ MP +
Sbjct: 321  LLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVMPNL 374

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T +IR      +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L+ +
Sbjct: 375  DGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRY 432

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 66/119 (55%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ ++ ++  + L   G   +E+  DG  A   +++       Y+++ MD+ MP +
Sbjct: 356  LLVEDDAISIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPNL 409

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T +IR      +PI+A+T   +D ++   L+ GMN  L+KP  R  L ++LI +
Sbjct: 410  DGATATSIIRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLIRY 467

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 64/119 (53%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ ++ ++  + L   G   +++  DG  A       T     Y+++ MD+ MP +
Sbjct: 406  LLVEDDAISIQLCSKFLRKYGC-TVQVVTDGLSAI-----TTLENSRYDLVLMDIVMPNL 459

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T +IR      +PI+A+T   DD ++   L+ GMN  L+KP  R  L ++LI +
Sbjct: 460  DGATATSIIR-SFDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSMLIRY 517

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 66/119 (55%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V+  +  + L   G   +E+  DG  A   +++       Y+++ MD+ MP +
Sbjct: 384  LLVEDDAVSIRLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPNL 437

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T +IR +    +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++LI +
Sbjct: 438  DGATATSIIR-NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 495

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 66/119 (55%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V  ++  + L   G  ++E+  DG  A   +++       Y+++ MD+ MP +
Sbjct: 310  LLVEDDSVCIQLCSKFLLKYGC-SVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPNL 363

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T ++R      +PI+A+T   +D ++   LE GMN  L+KP  +  L ++LI +
Sbjct: 364  DGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLIRY 421

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 65/117 (55%), Gaps = 7/117 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ MP +
Sbjct: 408  LLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAISNLEKF-----RYDLVLMDIVMPNL 461

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILI 1208
            DG  +T ++R      +PI+A+T   +D ++   L+ GMN  L+KP  R  L +ILI
Sbjct: 462  DGATATSIVRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSILI 517

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 66/119 (55%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V  ++  + L   G   +E+  DG  A   +++       Y+++ MD+ MP +
Sbjct: 337  LLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPNL 390

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T ++R    +T PI+A+T   +D ++   L+ GMN  L+KP  +  L ++LI +
Sbjct: 391  DGATATSIVRSFDNHT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 448

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 65.1 bits (157), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 83/171 (48%), Gaps = 9/171 (5%)

Query: 1042 SAPSTRHSREESVGSVNLDRPFLQSTGTATSNRN--IPTVSNXXXXXXXXXXLVVEDNHV 1099
            SA  + H+   +   + L  P +    T T+++   +P   +          L+VED+ V
Sbjct: 327  SASLSNHNAVNAAAELQLPLPNMNHGPTITTDKGDKLPETYDSFVLREGFHVLLVEDDAV 386

Query: 1100 NQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKM 1159
              ++  + L   G   +E+  DG  A   +++       Y+++ MD+ MP +DG  +T +
Sbjct: 387  CIQLCSKFLRKYGC-TVEVVTDGLAAISTLEKF-----RYDLVLMDIVMPNLDGATATSI 440

Query: 1160 IRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            +R      +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++LI +
Sbjct: 441  VRS-FDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 490

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 67/119 (56%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V  ++  + L   G  ++E+  DG  A   +++     + ++++ MD+ MP +
Sbjct: 332  LLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAISTLEK-----QRFDLVLMDIVMPNL 385

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T ++R      +PI+A+T   DD ++   L+ GMN  L+KP  +  L ++LI +
Sbjct: 386  DGATATSIVRS-FDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ +  ++  + L   G   +E+  DG  A   +++       Y+++ MD+ MP +
Sbjct: 308  LLVEDDSICIQLCSKFLMKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPNL 361

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T ++R      +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++LI +
Sbjct: 362  DGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 419

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ MP +
Sbjct: 382  LLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYDLVLMDIVMPNL 435

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T ++R      +PI+A+T    + ++   L+ GMN  L+KP  R  L +ILI +
Sbjct: 436  DGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ MP +
Sbjct: 380  LLVEDDAVSIQLCSKFLRKYGCT-VQVVSDGLSAISTLEKY-----RYDLVLMDIVMPNL 433

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T ++R      +PI+A+T    + ++   L+ GMN  L+KP  R  L +ILI +
Sbjct: 434  DGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 491

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ MP +
Sbjct: 381  LLVEDDAVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKF-----RYDLVLMDIVMPNL 434

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T ++R      +PI+A+T    + ++   L+ GMN  L+KP  R  L +ILI +
Sbjct: 435  DGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 492

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ MP +
Sbjct: 382  LLVEDDVVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYDLVLMDIVMPNL 435

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T ++R      +PI+A+T    + ++   L+ GMN  L+KP  R  L +ILI +
Sbjct: 436  DGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 64/117 (54%), Gaps = 7/117 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V+ ++  + L   G   +E+  DG  A   ++        Y+++ MD+ MP +
Sbjct: 427  LLVEDDAVSIQLCSKFLRKSGC-TVEVVTDGLAAISILEAF-----RYDLVLMDIVMPNL 480

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILI 1208
            DG  +T +IR +    +PI+A+T   +D ++   L+ GM   L+KP  R  L ++LI
Sbjct: 481  DGATATSIIR-NFDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSMLI 536

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 66/119 (55%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V+ ++  + L   G   +++  DG  A   +++       ++++ MD+ MP +
Sbjct: 385  LLVEDDDVSIQLCSKFLRKYGC-TVQVVTDGLAAISILEKF-----RFDLVLMDIVMPNL 438

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T +IR +    +PI+A+T   +  ++   L+ GMN  L+KP  R  L +ILI +
Sbjct: 439  DGATATSIIR-NFDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLYSILIRY 496

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 66/119 (55%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ +  ++  + L ++    +E+  DG  A   +++       ++++ MD+ MP +
Sbjct: 305  LLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKF-----RFDLVLMDIVMPNL 358

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T ++R      +PI+A+T   +D ++   L+ GMN  L+KP  +  L ++LI +
Sbjct: 359  DGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 416

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 64/119 (53%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V  ++  + L   G   + +  DG  A   ++        ++++ MD+ MP +
Sbjct: 419  LLVEDDEVCIQLCSKFLRKYGC-TVRVVTDGLTAISVLEN-----HRFDLVLMDIVMPNL 472

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T ++R    YT PI+A+T   +D ++   L+ GMN  L+KP  +  L ++L+ +
Sbjct: 473  DGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLVRY 530

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 73/147 (49%), Gaps = 34/147 (23%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I + E+A +G +A +K      R    ++I MD+Q+P +
Sbjct: 552  LIVEDNIINQAILVSFLKRHRI-SYEIAKNGAEAVEKW-----RQGGIHLILMDLQLPLL 605

Query: 1152 DGLLSTKMIR-------------------RDLG-------YTSP--IVALTAFADDSNIK 1183
             GL +TK IR                   RD         + SP  IVALTAF+  ++ +
Sbjct: 606  SGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSHADRR 665

Query: 1184 ECLESGMNGFLSKPIKRPKLKTILIEF 1210
            E L +G N +L+KP+    L + + E+
Sbjct: 666  EALVAGCNDYLTKPVNLDWLSSKITEW 692

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (53%), Gaps = 13/126 (10%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I + ++A +G++A D  KE        ++IFMD+Q+P +
Sbjct: 520  LIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQLPVL 573

Query: 1152 DGLLSTKMIR-----RDLGYTSP--IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLK 1204
             G+ + K IR     R     +P  IVALTA     + ++ L SG N +L+KP+    L 
Sbjct: 574  SGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPVNLHWLS 633

Query: 1205 TILIEF 1210
              + E+
Sbjct: 634  KKITEW 639

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 78/168 (46%), Gaps = 45/168 (26%)

Query: 1060 DRPFLQS------TGTATSNRNIPTVSNXXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGI 1113
            D PFL+S      T + T ++  P +S           LVVEDN +NQ ++   L    I
Sbjct: 394  DSPFLRSAMETFTTESITRDKVFPKIS----------VLVVEDNMINQTILSSFLRKHKI 443

Query: 1114 ENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRR-----DLGYTS 1168
             + ++A +G +A D+ KE        ++I MD++MP + G+ + K IRR      +G   
Sbjct: 444  -SYKVAKNGIEAVDRWKE-----GGMHLILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGK 497

Query: 1169 P------------------IVALTAFADDSNIKECLESGMNGFLSKPI 1198
            P                  IVALTA    S+  E L +G N +L+KP+
Sbjct: 498  PSTGEHAPAKRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPV 545

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VED+ V+ ++  + L   G   +++  DG  A   +++       ++++ MD+ MP +
Sbjct: 353  LLVEDDEVSIQLCSKFLIKYGC-TVQVVTDGLAAISTLEKY-----RFDLVLMDIVMPNL 406

Query: 1152 DGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210
            DG  +T +IR +    +PI+A+T   +  ++   L+ GMN  L+KP  R  L ++L  +
Sbjct: 407  DGATATSIIR-NFDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSMLTRY 464

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 66/128 (51%), Gaps = 28/128 (21%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ +++  L    I + ++A +GQ+A D+ KE        ++IFMD+Q+P  
Sbjct: 504  LIVEDNVINQAILRSFLKKHKI-SYKVAKNGQEAVDRWKE-----GGIDLIFMDLQLPVF 557

Query: 1152 DGLLSTKMIRRDL------GYTSP---------------IVALTAFADDSNIKECLESGM 1190
             G+ + K IR DL        T P               IVA TA    ++ +E L SG 
Sbjct: 558  SGMDAAKKIR-DLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALLSGC 616

Query: 1191 NGFLSKPI 1198
            N +L+KP+
Sbjct: 617  NDYLTKPV 624

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 74/142 (52%), Gaps = 20/142 (14%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I + ++A +G++A     E+   G   ++IFMD+Q+P +
Sbjct: 478  LIVEDNVINQAILGGFLRKHKI-SYKVAKNGKEAV----EMWKNG-GLHLIFMDLQLPVL 531

Query: 1152 DGLLSTKMIR---RDLGYTSP--IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLK-- 1204
             G+ + K IR   ++    +P  IVALTA     + +  L SG N +L+KP+    L   
Sbjct: 532  SGIDAAKQIRDFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHWLSKK 591

Query: 1205 -------TILIEFCAAYQGKKK 1219
                     LI+F +  QG+ K
Sbjct: 592  ITEWGCMQALIDFDSWKQGQSK 613

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 72/146 (49%), Gaps = 33/146 (22%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I + ++A +G++A DK KE      + ++IFMD+Q+P +
Sbjct: 466  LIVEDNVINQAILGSFLRKNKI-SYKIAKNGKEAVDKWKE-----GNLHLIFMDLQLPVL 519

Query: 1152 DGLLSTKMIR---RDLGYT----------------------SP--IVALTAFADDSNIKE 1184
             G+ + K IR   ++ G                        SP  IVALTA     + +E
Sbjct: 520  SGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQEDKRE 579

Query: 1185 CLESGMNGFLSKPIKRPKLKTILIEF 1210
             L SG N +L+KP+    L   + E+
Sbjct: 580  ALISGCNDYLTKPVNLLWLSKKITEW 605

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 55.5 bits (132), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 82/182 (45%), Gaps = 52/182 (28%)

Query: 1043 APSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVSNXXXXXXXXXXLVVEDNHVNQE 1102
            AP    SRE         +PF     +ATS++  P ++           L+VEDN +NQ 
Sbjct: 539  APKNGSSRE---------KPF-PGEWSATSDKVFPKIN----------VLIVEDNVINQT 578

Query: 1103 VIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIR- 1161
            ++   L    I   ++A +GQ+A D  +E        ++IFMD+Q+P + G+ + K IR 
Sbjct: 579  ILSSFLRKHKI-FYKVAKNGQEAIDVWRE-----GGIHLIFMDLQLPVLSGIDAAKKIRE 632

Query: 1162 --RDLGY---------------------TSP--IVALTAFADDSNIKECLESGMNGFLSK 1196
              R+ G                       +P  IVA TA    S+ KE L SG N +L+K
Sbjct: 633  LEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSDKKEALISGCNDYLTK 692

Query: 1197 PI 1198
            P+
Sbjct: 693  PV 694

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 90/208 (43%), Gaps = 55/208 (26%)

Query: 1030 ISFSSADSNEQKSAPSTRHSR---EESVGSVNLDRPFLQSTGTA--------------TS 1072
            +S  +A S  Q+ +P    S    EE +G V    P +Q  G+               T 
Sbjct: 340  VSPGAAISPTQRVSPVLMTSAPLVEEEIGLVPPRDPIVQREGSPFILSAMESVTTESITR 399

Query: 1073 NRNIPTVSNXXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKEL 1132
            ++  P +S           LVVEDN +NQ ++   L    I + ++A +G +A D+ KE 
Sbjct: 400  DKVFPKIS----------VLVVEDNMINQAILSSFLRKHKI-HYKVAKNGVEAVDRWKE- 447

Query: 1133 TSRGESYNMIFMDVQMPKVDGLLSTKMIRR-----DLGYTSP-----------------I 1170
                   ++I MD++MP + G+ + K IR+      +G   P                 I
Sbjct: 448  ----GGMHLILMDLEMPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVII 503

Query: 1171 VALTAFADDSNIKECLESGMNGFLSKPI 1198
            VALTA    ++  E L +G N +L+KP+
Sbjct: 504  VALTASNSQTDKTEALLAGCNDYLTKPV 531

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 70/147 (47%), Gaps = 34/147 (23%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I + E+A +G +A +K      R    ++I MD+Q+P +
Sbjct: 512  LIVEDNIINQAILSSFLRKHKI-SYEIAKNGVEAVEKW-----RKGGIHLILMDLQLPLL 565

Query: 1152 DGLLSTKMIR---RDLG-----------------------YTSP--IVALTAFADDSNIK 1183
             G+ + K IR   R  G                       + +P  IVALTAF+  ++  
Sbjct: 566  SGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSHADRN 625

Query: 1184 ECLESGMNGFLSKPIKRPKLKTILIEF 1210
            E L +G N +L+KP+    L   + E+
Sbjct: 626  EALVAGCNDYLTKPVNLDWLSNKITEW 652

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 65/134 (48%), Gaps = 33/134 (24%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I + +LA +GQ+A +  KE        ++IFMD+Q+P +
Sbjct: 489  LIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQLPVL 542

Query: 1152 DGLLSTKMIR-----------RDLGYTSP----------------IVALTAFADDSNIKE 1184
             G+ + K IR           + L  + P                IVALTA     + ++
Sbjct: 543  SGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMDKRK 602

Query: 1185 CLESGMNGFLSKPI 1198
             L SG N +L+KP+
Sbjct: 603  ALVSGCNDYLTKPV 616

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 69/155 (44%), Gaps = 37/155 (23%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I + ++A +G++A DK KE        ++IFMD+Q+P +
Sbjct: 514  LIVEDNVINQTILASFLRKHKI-SYKVAKNGREAVDKWKE-----GGLHLIFMDLQLPVL 567

Query: 1152 DGLLSTKMIRR------------------------------DLGYTSPIVALTAFADDSN 1181
             G+ + K IR                                 G    IVA TA    ++
Sbjct: 568  SGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNSLTD 627

Query: 1182 IKECLESGMNGFLSKPIKRPKLKTILIEFCAAYQG 1216
             +E L SG N +L+KP+    L   + E+    QG
Sbjct: 628  KREALISGCNDYLTKPVNLHWLSKKITEW-GCMQG 661

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 78/165 (47%), Gaps = 43/165 (26%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I +  +A +G++A +K KE        ++IFMD+Q+P +
Sbjct: 474  LIVEDNVINQTILASFLRKHKI-SYRIAKNGREAVEKWKE-----GGIHLIFMDLQLPVM 527

Query: 1152 DGLLSTKMIR-----RDLGYTSPI-----------------------VALTAFADDSNIK 1183
             G+ + K IR     + +G  +P+                       VA TA    ++ +
Sbjct: 528  SGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLTDKR 587

Query: 1184 ECLESGMNGFLSKPIKRPKL-KTI--------LIEFCAAYQGKKK 1219
            E L SG N +L+KP+    L K I        LI+F    QG+++
Sbjct: 588  EALVSGCNDYLTKPVNLHWLSKKITEWGCMQALIDFDNWKQGQRR 632

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 88/190 (46%), Gaps = 44/190 (23%)

Query: 1058 NLDRPFLQSTGTATSNRNIPTVSNXXXXXXXXXXLVVEDNHVNQEVIKRMLNLEGIENIE 1117
            NL    L S  T TS +  P ++           L+VEDN +NQ ++   L    I + +
Sbjct: 524  NLSHDALLSGITTTSEKVFPKIN----------VLIVEDNVINQAILGSFLRKHKI-SYK 572

Query: 1118 LACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIR---RDLGY-------- 1166
            +A +G++A D  KE        ++IFMD+Q+P + G+ + + IR   ++ G         
Sbjct: 573  VAKNGKEAVDIWKE-----GGLHLIFMDLQLPVLSGIEAARQIRAFEKENGIGIQEHSNS 627

Query: 1167 ------TSP--IVALTAFADDSNIKECLESGMNGFLSKPIKRPKL-KTI--------LIE 1209
                   +P  IVALTA     + +  L SG N +L+KP+    L K I        LI+
Sbjct: 628  LKKNKTKAPVIIVALTASNSQDDKRNALISGCNDYLTKPVNLHWLSKKITEWGCMQALID 687

Query: 1210 FCAAYQGKKK 1219
            F +  QG+ +
Sbjct: 688  FDSWKQGQSR 697

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L   GI + ++A DG +A +K KE    G+S+ +I MD+Q+P +
Sbjct: 397  LIVEDNAINQAILALFLRKNGI-SYKVAKDGVEAIEKWKE----GDSH-LILMDLQLPLL 450

Query: 1152 DGLLSTKMIR 1161
             GL +TK IR
Sbjct: 451  SGLEATKKIR 460

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 70/146 (47%), Gaps = 33/146 (22%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I + +LA +GQ+A +  KE        ++IFMD+Q+P +
Sbjct: 496  LIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQLPVL 549

Query: 1152 DGLLSTKMIRR--------------------DLGYT-----SP--IVALTAFADDSNIKE 1184
             G+ + K IR                     D G +     +P  IVALTA     + ++
Sbjct: 550  SGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMDKRK 609

Query: 1185 CLESGMNGFLSKPIKRPKLKTILIEF 1210
             L SG N +L+KP+    L   + E+
Sbjct: 610  ALLSGCNDYLTKPVNLHWLSKKITEW 635

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 69/146 (47%), Gaps = 33/146 (22%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I + +LA +GQ+A +  KE        ++IFMD+Q+P +
Sbjct: 507  LIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQLPVL 560

Query: 1152 DGLLSTKMIR-----RDLGY--------------------TSP--IVALTAFADDSNIKE 1184
             G+ + K IR       +G                      +P  IVALTA     + ++
Sbjct: 561  SGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMDKRK 620

Query: 1185 CLESGMNGFLSKPIKRPKLKTILIEF 1210
             L SG N +L+KP+    L   + E+
Sbjct: 621  ALLSGCNDYLTKPVNLHWLSKKITEW 646

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 65/134 (48%), Gaps = 33/134 (24%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I + +LA +GQ+A +  KE        ++IFMD+Q+P +
Sbjct: 506  LIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQLPVL 559

Query: 1152 DGLLSTKMIR-----RDLGY--------------------TSP--IVALTAFADDSNIKE 1184
             G+ + K IR       +G                      +P  IVALTA     + ++
Sbjct: 560  SGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMDKRK 619

Query: 1185 CLESGMNGFLSKPI 1198
             L SG N +L+KP+
Sbjct: 620  ALLSGCNDYLTKPV 633

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 70/142 (49%), Gaps = 29/142 (20%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I + ++A +G++A D  KE        ++IFMD+Q+P +
Sbjct: 673  LIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQLPVL 726

Query: 1152 DGLLSTKMIR-----RDLGYT----------------SP--IVALTAFADDSNIKECLES 1188
             G+ + + IR     + +G                  +P  IVALTA     + ++ L S
Sbjct: 727  SGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRKALLS 786

Query: 1189 GMNGFLSKPIKRPKLKTILIEF 1210
            G N +L+KP+    L   + E+
Sbjct: 787  GCNDYLTKPVNLHWLSKKITEW 808

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 70/155 (45%), Gaps = 37/155 (23%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I   ++A +G++A DK KE        ++IFMD+Q+P +
Sbjct: 568  LIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWKE-----GGIHLIFMDLQLPVL 621

Query: 1152 DGLLSTKMIR---RDLGY-------------------------TSP--IVALTAFADDSN 1181
             G  + K IR   + +G                           +P  IVA TA    ++
Sbjct: 622  SGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASNSLAD 681

Query: 1182 IKECLESGMNGFLSKPIKRPKLKTILIEFCAAYQG 1216
             +  L +G N +L+KP+    L   + E+    QG
Sbjct: 682  KRAALIAGCNDYLTKPVNLHWLSKKITEW-GCMQG 715

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 43/70 (61%), Gaps = 6/70 (8%)

Query: 1092 LVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKV 1151
            L+VEDN +NQ ++   L    I + ++A +G++A DK K+        ++I +D+Q+P +
Sbjct: 465  LIVEDNVINQAILGSFLRKHKI-SYKVAKNGREAVDKWKQ-----GGIHLILLDLQLPIL 518

Query: 1152 DGLLSTKMIR 1161
             G+ +TK IR
Sbjct: 519  SGIEATKEIR 528

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 15/81 (18%)

Query: 853 ISIEVEDTGPGIDPSLQESVF-HPFV-----QGDQTLS---------RQYGGTGLGLSIC 897
           + I + D G GIDP +++ VF + F      + D  +S         +   G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 898 RQLANMMHGTMKLESKVGVGS 918
           +    + +GT+ ++S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 57/111 (51%), Gaps = 8/111 (7%)

Query: 1104 IKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRD 1163
            I R    + +EN+        A D++    + G S+++I   +++PK+  +   +++R+ 
Sbjct: 1633 IHRYRVAKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLRQT 1692

Query: 1164 LGY--TSPIVALTAFADDSNIKECLESGM-NGFLSKPIKRPKLKTILIEFC 1211
             G   T+PIVA+T +      +E + S + +  L KP+   +LK ++ ++ 
Sbjct: 1693 NGANSTTPIVAITNY-----FQEAITSKVFDDVLEKPVNLDELKKLVAKYA 1738

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 55/110 (50%), Gaps = 6/110 (5%)

Query: 1104 IKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRD 1163
            I R    + +EN+        A D++    + G S+++I   +++PK+  +   +++++ 
Sbjct: 1645 IHRYRVTKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1704

Query: 1164 LGY--TSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFC 1211
             G   T+PIVA+T +  ++      +      L KP+K  +LK ++ ++ 
Sbjct: 1705 NGANSTTPIVAITNYFQEAATSRVFDD----VLEKPVKLDELKKLVAKYA 1750

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 35.4 bits (80), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 15/81 (18%)

Query: 853 ISIEVEDTGPGIDPSLQESVFH-------------PFVQGDQTLSR--QYGGTGLGLSIC 897
           +SI V D G GI P  +  +               P  Q +Q  +   +  G G GL +C
Sbjct: 301 LSIRVRDHGGGIPPEREPFILDYAYTSEVNKHEGDPATQVNQVNADVPRVAGLGFGLPLC 360

Query: 898 RQLANMMHGTMKLESKVGVGS 918
           R  A +  G++ ++S  G+G+
Sbjct: 361 RMYAELFGGSLSIQSLWGLGT 381

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 35.4 bits (80), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 12/101 (11%)

Query: 1113 IENIELACDGQDAFDKVKELTSRGESYNMIFMDVQM-----PKVDGLLSTKMIRRDLGYT 1167
            +E   +  D    + K KE     + Y+++ +D  +     P ++ +LS+      + Y 
Sbjct: 511  LEQYRITVDIMQDWPKTKEKI-LNKCYDLVIIDAHVKFLNVPILESMLSS------IQYH 563

Query: 1168 SPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILI 1208
             PI+ +T+  +D  +   L+ G+N  L KP    KL   L+
Sbjct: 564  PPIILMTSSLNDQQLIFYLQHGINSILEKPFHSHKLLKFLV 604

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 53/110 (48%), Gaps = 6/110 (5%)

Query: 1104 IKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRR- 1162
            I R    E +E+I  +       +++    + G  +++I   +++PK+  +   K+IR  
Sbjct: 1449 IHRYRVAEDLESIGCSVVSAGNGEELVRRATTGVKFDLIITAMKLPKLGAIDIAKLIRHT 1508

Query: 1163 -DLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFC 1211
              +  T+PIVALT +  D+   +  +      L KP+   +L+ ++ ++ 
Sbjct: 1509 NSVNCTTPIVALTVYYHDAKESKVFDD----VLEKPVSVEQLRKLVSKYA 1554

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
            YFL033C (REAL)
          Length = 1760

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 57/111 (51%), Gaps = 8/111 (7%)

Query: 1104 IKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRD 1163
            I R    + +EN+        A D++    + G S+++I   +++PK+  +   +++++ 
Sbjct: 1635 IHRYRVTKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1694

Query: 1164 LGY--TSPIVALTAFADDSNIKECLESGM-NGFLSKPIKRPKLKTILIEFC 1211
             G   T+PIVA+T +      +E + S + +  L KP+   +LK ++ ++ 
Sbjct: 1695 NGANSTTPIVAITNY-----FQEAITSKVFDDVLEKPVNLDELKKLVAKYA 1740

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 35/87 (40%), Gaps = 15/87 (17%)

Query: 853 ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYG---------------GTGLGLSIC 897
           + I + D G GI P +++ +F       Q  ++  G               G G GL +C
Sbjct: 317 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 376

Query: 898 RQLANMMHGTMKLESKVGVGSKFTFTL 924
           +    M  G++ ++S  G G+     L
Sbjct: 377 KAYLEMFDGSLDIQSLYGWGTDVYIKL 403

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 853 ISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYG---------------GTGLGLSIC 897
           + I + D G GI P +++ +F        T ++  G               G G GL +C
Sbjct: 319 LKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMC 378

Query: 898 RQLANMMHGTMKLESKVGVGS 918
           +    M +GT+ ++S  G G+
Sbjct: 379 KAYMEMFNGTLDIQSLWGWGT 399

>Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON}
            YFL033C (REAL)
          Length = 1753

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 56/111 (50%), Gaps = 8/111 (7%)

Query: 1104 IKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRD 1163
            I R    + +EN+        A D++    + G S+++I   +++PK+  +   +++++ 
Sbjct: 1628 IHRYRVAKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1687

Query: 1164 LGY--TSPIVALTAFADDSNIKECLES-GMNGFLSKPIKRPKLKTILIEFC 1211
             G   T+PIV++T +      +E + S   +  L KP+   +LK ++ ++ 
Sbjct: 1688 NGVNSTTPIVSITNY-----FQEAIASKAFDDVLEKPVNLDELKRLVAKYA 1733

>Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556)
            [4554 bp, 1517 aa] {ON}
            (101912..102910,102960..102968,103011..106556) [4554 nt,
            1518 aa]
          Length = 1517

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 53/113 (46%), Gaps = 12/113 (10%)

Query: 1104 IKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRD 1163
            I R     G+E++        A D++    + G  +++I   +++PK+  +   K+++  
Sbjct: 1394 IHRYCTTSGLESLGCTVVAVGAGDELVRRATSGVKFDLIITALRIPKLGAVDIVKLLKHT 1453

Query: 1164 LGY--TSPIVALTAFADDSNIKECLESGMNGF---LSKPIKRPKLKTILIEFC 1211
             G   T+PIVA T + +++       S  N F   L KPI    L+ ++ ++ 
Sbjct: 1454 NGINSTTPIVAATCYFEEA-------SNTNVFSDVLEKPISIQTLRKLISKYA 1499

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 106,835,799
Number of extensions: 4188384
Number of successful extensions: 14304
Number of sequences better than 10.0: 88
Number of HSP's gapped: 14523
Number of HSP's successfully gapped: 138
Length of query: 1219
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1098
Effective length of database: 39,606,813
Effective search space: 43488280674
Effective search space used: 43488280674
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)