Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.395.702ON1682168281290.0
Skud_9.195.702ON1680168051870.0
YIL149C (MLP2)5.702ON1679168249510.0
Smik_9.205.702ON1682168548590.0
TDEL0B021905.702ON1810122511761e-132
SAKL0E14916g5.702ON1779139211191e-125
ZYRO0G06600g5.702ON1820186411041e-123
Suva_11.3315.702ON1898137010141e-111
Ecym_40185.702ON1769139310041e-110
Smik_11.3585.702ON187813589981e-109
Skud_11.3345.702ON188513039961e-109
KLTH0E01056g5.702ON177113769541e-104
YKR095W (MLP1)5.702ON187512699221e-100
Kwal_55.196975.702ON176013898892e-96
AFR286W5.702ON175812648271e-88
CAGL0G02497g5.702ON178014128091e-86
KLLA0A00594g5.702ON174814127797e-83
NCAS0A032005.702ON178813797663e-81
TBLA0E017305.702ON182013767242e-76
NDAI0E050405.702ON197312305957e-61
NDAI0F002905.702ON15545715266e-53
KAFR0D022205.702ON16744484622e-45
KAFR0H002105.702ON145410234416e-43
NCAS0G002305.702ON17354524176e-40
KNAG0L021405.702ON160811244113e-39
Kpol_1043.705.702ON13214592789e-24
KNAG0C065905.702ON16514612752e-23
TPHA0D046105.702ON11833641865e-13
TPHA0E002305.702ON12842531652e-10
Kpol_2001.755.702ON10062851347e-07
Ecym_45043.243ON66344930.048
Kpol_529.202.16ON957190820.84
ZYRO0G01584g7.101ON1088145811.3
Kpol_1073.82.639ON42874782.3
Smik_15.4858.778ON1122143782.4
SAKL0C13750g3.6ON495106773.0
YOR304W (ISW2)8.778ON112081773.3
TDEL0F042108.294ON35989754.9
NCAS0C051602.639ON40831755.3
KNAG0A061052.422ON33758745.9
TDEL0C032607.462ON106488756.9
TBLA0I029004.238ON179474749.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.39
         (1682 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...  3135   0.0  
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...  2002   0.0  
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...  1911   0.0  
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...  1876   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   457   e-132
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   435   e-125
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   429   e-123
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   395   e-111
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   391   e-110
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   389   e-109
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   388   e-109
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   372   e-104
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   359   e-100
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   347   2e-96
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   323   1e-88
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   316   1e-86
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   304   7e-83
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   299   3e-81
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   283   2e-76
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   233   7e-61
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   207   6e-53
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   182   2e-45
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   174   6e-43
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   165   6e-40
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   162   3e-39
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   111   9e-24
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   110   2e-23
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    76   5e-13
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    68   2e-10
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    56   7e-07
Ecym_4504 Chr4 (1009783..1011774) [1992 bp, 663 aa] {ON} similar...    40   0.048
Kpol_529.20 s529 (59125..61998) [2874 bp, 957 aa] {ON} (59125..6...    36   0.84 
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    36   1.3  
Kpol_1073.8 s1073 complement(10633..11919) [1287 bp, 428 aa] {ON...    35   2.3  
Smik_15.485 Chr15 (834349..837717) [3369 bp, 1122 aa] {ON} YOR30...    35   2.4  
SAKL0C13750g Chr3 complement(1210007..1211494) [1488 bp, 495 aa]...    34   3.0  
YOR304W Chr15 (884514..887876) [3363 bp, 1120 aa] {ON}  ISW2ATP-...    34   3.3  
TDEL0F04210 Chr6 complement(776529..777608) [1080 bp, 359 aa] {O...    33   4.9  
NCAS0C05160 Chr3 complement(1050360..1051586) [1227 bp, 408 aa] ...    33   5.3  
KNAG0A06105 Chr1 complement(927040..928053) [1014 bp, 337 aa] {ON}     33   5.9  
TDEL0C03260 Chr3 complement(577094..580288) [3195 bp, 1064 aa] {...    33   6.9  
TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {...    33   9.2  

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 3135 bits (8129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1589/1682 (94%), Positives = 1589/1682 (94%)

Query: 1    MEDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRIS 60
            MEDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRIS
Sbjct: 1    MEDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRIS 60

Query: 61   KLNELLGXXXXXXXXXXXXXXRLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERG 120
            KLNELLG              RLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERG
Sbjct: 61   KLNELLGESSEEKNVSKKELSRLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERG 120

Query: 121  VKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQE 180
            VKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQE
Sbjct: 121  VKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQE 180

Query: 181  KELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQ 240
            KELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQ
Sbjct: 181  KELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQ 240

Query: 241  NKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSARE 300
            NKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSARE
Sbjct: 241  NKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSARE 300

Query: 301  KDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPS 360
            KDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPS
Sbjct: 301  KDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPS 360

Query: 361  VNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNS 420
            VNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNS
Sbjct: 361  VNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNS 420

Query: 421  TDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKA 480
            TDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKA
Sbjct: 421  TDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKA 480

Query: 481  SPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADK 540
            SPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADK
Sbjct: 481  SPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADK 540

Query: 541  LENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGN 600
            LENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGN
Sbjct: 541  LENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGN 600

Query: 601  KIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEF 660
            KIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEF
Sbjct: 601  KIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEF 660

Query: 661  SNFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCE 720
            SNFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCE
Sbjct: 661  SNFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCE 720

Query: 721  ISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTX 780
            ISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNT 
Sbjct: 721  ISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTK 780

Query: 781  XXXXXXXXXXXXXXXHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTT 840
                           HSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTT
Sbjct: 781  IKNLEKNCEELNNRLHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTT 840

Query: 841  IRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYE 900
            IRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYE
Sbjct: 841  IRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYE 900

Query: 901  EIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLK 960
            EIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLK
Sbjct: 901  EIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLK 960

Query: 961  EGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVL 1020
            EGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVL
Sbjct: 961  EGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVL 1020

Query: 1021 RLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENS 1080
            RLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENS
Sbjct: 1021 RLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENS 1080

Query: 1081 ALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKS 1140
            ALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKS
Sbjct: 1081 ALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKS 1140

Query: 1141 VNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIY 1200
            VNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIY
Sbjct: 1141 VNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIY 1200

Query: 1201 KEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDET 1260
            KEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDET
Sbjct: 1201 KEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDET 1260

Query: 1261 EKLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320
            EKLFNEIS                   FNRLKKQAHEKLDASKKQQTALTNEVDELKDMK
Sbjct: 1261 EKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320

Query: 1321 NXXXXXXXXXXXXXXXXXAKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQVFKET 1380
            N                 AKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQVFKET
Sbjct: 1321 NELEESLHSEESKVLELEAKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQVFKET 1380

Query: 1381 SDSSDXXXXXXXXXXXXXXXXXXXXXXXXXXXLEEATGKNTGATIENGENMEELKKQWLK 1440
            SDSSD                           LEEATGKNTGATIENGENMEELKKQWLK
Sbjct: 1381 SDSSDTIEKMKEIMEAEKNKIIEEKTTEFERKLEEATGKNTGATIENGENMEELKKQWLK 1440

Query: 1441 QYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLSSD 1500
            QYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLSSD
Sbjct: 1441 QYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLSSD 1500

Query: 1501 KKENEVNAEDDLWNSPSKGNSEKPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRPTSSN 1560
            KKENEVNAEDDLWNSPSKGNSEKPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRPTSSN
Sbjct: 1501 KKENEVNAEDDLWNSPSKGNSEKPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRPTSSN 1560

Query: 1561 KENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFTPAATSFNTGVSPVFNIKPA 1620
            KENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFTPAATSFNTGVSPVFNIKPA
Sbjct: 1561 KENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFTPAATSFNTGVSPVFNIKPA 1620

Query: 1621 LAVDATVDTFKTPGLNDAGTNEAKIIEIGNNSLKRPIENEVSFDTDSKKVKENSDNDQVS 1680
            LAVDATVDTFKTPGLNDAGTNEAKIIEIGNNSLKRPIENEVSFDTDSKKVKENSDNDQVS
Sbjct: 1621 LAVDATVDTFKTPGLNDAGTNEAKIIEIGNNSLKRPIENEVSFDTDSKKVKENSDNDQVS 1680

Query: 1681 EN 1682
            EN
Sbjct: 1681 EN 1682

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 2002 bits (5187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1069/1680 (63%), Positives = 1294/1680 (77%), Gaps = 8/1680 (0%)

Query: 1    MEDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRIS 60
            MEDKISE+LHVPS+SL+G+ +S L+ L K+I +FERSE+EVT+LNV +DEIKSQYYTRIS
Sbjct: 1    MEDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRIS 60

Query: 61   KLNELLGXXXXXXXXXXXXXXRLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERG 120
            KL +LL               RL + LK ERS+  RKIDALNKQLNAS  TI KL DE G
Sbjct: 61   KLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEEG 120

Query: 121  VKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQE 180
             KEEA   +   +N+D  +  L  ENKLL+RKLLEMENILQ CKSN +SL+ KYDT  QE
Sbjct: 121  AKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQE 180

Query: 181  KELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQ 240
            KEL L+NKKW EE+LS  ++K LVD+VT+TS++QNLEE+LN+TQ + ESVST N+FLL Q
Sbjct: 181  KELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQ 240

Query: 241  NKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSARE 300
            NK+LSH +E+K+LEIKNLKDT N EK++FSKEMTLQK MNDLLRSQLTSFE+ +SL  +E
Sbjct: 241  NKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKE 300

Query: 301  KDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPS 360
            K +D  CKN +H +V ++LID KL+LEKSK+ECQ L+NIV+DCIEE+     NT+   P+
Sbjct: 301  KGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENGTTV-NTNTAAPT 359

Query: 361  VNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNS 420
            V K+FS+IK LKRQL+KER+QKFQ+QNQ++ F+ ELE KTP L+SFKERTE LE ELK S
Sbjct: 360  VGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCS 419

Query: 421  TDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKA 480
            T+LLET+SLAKRKDEK+LTSL QKIN+ EANIHSLV+QRLDLARQVK+LL NISA+Q   
Sbjct: 420  TELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTT 479

Query: 481  SPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADK 540
            SPLSNDEL+SL+KLLES +  NE+DSQIIITE+LVEF N +ELQEKNMELL+C+R+LADK
Sbjct: 480  SPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADK 539

Query: 541  LENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGN 600
            LE +EG+ DK++AK+ENQTIKEAK+AIIE+E +NS L  R++IL+RERDSYKLLASAN N
Sbjct: 540  LETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLALRVNILTRERDSYKLLASANDN 599

Query: 601  KIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEF 660
            K +AD    TEA   KKI+EL+S+LS T+VE+SA++Q LN +LLT KKSQ++G+IALQEF
Sbjct: 600  KTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEF 659

Query: 661  SNFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCE 720
             NFKVL  EKE +LQ RI+ LKT+LEKQR SA   +     S  T+LS  +NK  SL  E
Sbjct: 660  ENFKVLVAEKEAMLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYE 719

Query: 721  ISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTX 780
            ISNL K+NT L  MKESLTRDLERCCKEKMQL +KL+ESETSHNEQ L   SK++QY+T 
Sbjct: 720  ISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTR 779

Query: 781  XXXXXXXXXXXXXXXHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTT 840
                            SK QEI+TLQ+SKNSQLKWAQNTIDDTEKN+KS+S +LS K+TT
Sbjct: 780  IKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETT 839

Query: 841  IRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYE 900
            I +LSLE+++L  EL+ TKLQYK L+N+SD NTLE  L+KEL+++QI+LKDAHSQI+AYE
Sbjct: 840  IGRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYE 899

Query: 901  EIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLK 960
            EIIST+EN LKELN +L K KE+ + K Q  ++E  AKEEE+S LR+ELDEIR LQPKL+
Sbjct: 900  EIISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLR 959

Query: 961  EGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVL 1020
            EGA  LV QSEK+G+Q QRIQ M  KIDKM  I+E +Q+ E+SQYQ++LK NKDLS  V+
Sbjct: 960  EGASYLVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVM 1019

Query: 1021 RLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENS 1080
            RLE E  DYQTELKKTK SL+STQELLD+HE+KWMEEKADYERELISNIEQTESLRVENS
Sbjct: 1020 RLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENS 1079

Query: 1081 ALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKS 1140
             L+EKID  T  +N +++YL+LVSLFS+LRHER++LETKLTTCKRDLAL +QKNA+LEKS
Sbjct: 1080 VLIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKS 1139

Query: 1141 VNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIY 1200
            + D+Q+ + V R  VQC   IIDE+E I+KEIAQVNIL+ENN IL KSLK VTEKNEAIY
Sbjct: 1140 IGDLQRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIY 1199

Query: 1201 KEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDET 1260
            KE  ++Q EIS+LQG L QTKEQVS+NANKVL YESEIEQ KQRY +LSQQQK THK+ET
Sbjct: 1200 KELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNET 1259

Query: 1261 EKLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320
            EKL N I                    FNRLKKQAHEKLDASKKQQTALTNE++ELK+ K
Sbjct: 1260 EKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETK 1319

Query: 1321 NXXXXXXXXXXXXXXXXXAKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQVFKET 1380
            +                  KLK+H +Q   VSKD +    KP +EEIE LK+ELQVF+  
Sbjct: 1320 DKLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRNA 1379

Query: 1381 SDSSDXXXXXXXXXXXXXXXXXXXXXXXXXXXLEEATGKNTG--ATIENGENMEELKKQW 1438
            +D+SD                           L++A  K+    + +EN E++E LKK+W
Sbjct: 1380 NDASDAFEKIKNNMEEEKNKIIDEKTKDFEKKLQDAVNKSKSNESEVENSEHIEALKKEW 1439

Query: 1439 LKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLS 1498
            LK+YEEET++RIKEAEENLKKRIRLPSEERIQKIISKRK ELEQEF+RKLK N+ S   S
Sbjct: 1440 LKEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFS 1499

Query: 1499 SDKKENEVNAEDDLWNSPSKGNSEKPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRPTS 1558
                 NE  AED+LWNSPSKG+SEKPSVVT+LI+QKN+ LQEQLKN K  +  ND RP S
Sbjct: 1500 GS---NEEEAEDELWNSPSKGSSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKS 1556

Query: 1559 SNKENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFTPAATSFNT-GVSPVFNI 1617
             NKEN+IP S  A+N+ P AF+FGKPLF SNTSSFQSF NPFTP+A +F+T G  P FNI
Sbjct: 1557 ENKENNIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLPTFNI 1616

Query: 1618 KPALAVDATVDTFKTPGLNDAGTNEAKIIEIGNNSLKRPIENEVSFDTDSKKVKENSDND 1677
            K A A     +T KT    + G NEAK++EIGN S KRPI+++ S D DSKK KE+ +ND
Sbjct: 1617 KSAFAAGTAGNTLKTSDPANVGINEAKVMEIGNTS-KRPIQSDTSSDPDSKKFKESPEND 1675

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score = 1911 bits (4951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1038/1682 (61%), Positives = 1265/1682 (75%), Gaps = 7/1682 (0%)

Query: 1    MEDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRIS 60
            MEDKISE+L+VP +SLQGV Y +LR L K+I KFERSEEEVT+LNVL+DEIKSQYY+RIS
Sbjct: 1    MEDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRIS 60

Query: 61   KLNELLGXXXXXXXXXXXXXXRLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERG 120
            KL +LL                L + L  ERS+  R+IDAL KQL+ S   + ++NDE+ 
Sbjct: 61   KLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKR 120

Query: 121  VKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQE 180
            VKEE ++ ++  Q ND     L  ENKLLRRKL+EMENILQ CKSN +SL+LKYDT VQE
Sbjct: 121  VKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQLKYDTSVQE 180

Query: 181  KELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQ 240
            KEL+L++KK +EE+LS   +KTL ++VT++SHV+NLEE+L + Q++YESV T N+FLL Q
Sbjct: 181  KELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQ 240

Query: 241  NKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSARE 300
            NKQLS S+E+K+LE+KNLKDT ++EKA+FSKEMTLQKNMNDLLRSQLTS EK+ SL A E
Sbjct: 241  NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE 300

Query: 301  KDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPS 360
            K++D+ C+N +H +V+D+LIDTKL+LEKSK+ECQRLQNIV DC +E+EA    T  V P+
Sbjct: 301  KNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATM-TTSAVSPT 359

Query: 361  VNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNS 420
            V K+FSDIK LKRQLIKERNQKFQLQNQ+E FI ELE KTPELISFKERT+SLE ELK S
Sbjct: 360  VGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRS 419

Query: 421  TDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKA 480
            T+LLET+SL KRK E+E+TSLRQKIN CEANIHSLVKQRLDLARQVKLLLLN SA+Q+ A
Sbjct: 420  TELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETA 479

Query: 481  SPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADK 540
            SPLS DELISL+K+LES ++ NE DSQ IITERLVEF+N NELQEKN+ELLNC+R+LADK
Sbjct: 480  SPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADK 539

Query: 541  LENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGN 600
            LEN+EGKQDK+L K+ENQTIKEAKDAIIELE++N+ +E+RI+IL RERDSYKLLAS   N
Sbjct: 540  LENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEEN 599

Query: 601  KIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEF 660
            K   ++    EAA  KKI+ELE+ELS TKVENSA++Q L KELL  KKSQ   +  L++F
Sbjct: 600  KANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDF 659

Query: 661  SNFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCE 720
             NFK LA EKE +L+  ID LK +LEKQ+S  PS IH       TELSQ + K KSL  E
Sbjct: 660  ENFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYE 719

Query: 721  ISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTX 780
            IS L K+       KESLTRD E+CCKEK +LQM+L ESE SHNE K+   SK+ QY   
Sbjct: 720  ISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAK 779

Query: 781  XXXXXXXXXXXXXXXHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTT 840
                            SK+QEIE++++ K+SQLKWAQNTIDDTE  MKSL T+LS K+TT
Sbjct: 780  IKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETT 839

Query: 841  IRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYE 900
            I KLS E+++L+ EL+KTK QYK L+ +SDA+TLE  L+KELE+ Q+ LKDA+SQI+AYE
Sbjct: 840  IEKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYE 899

Query: 901  EIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLK 960
            EIIS++EN L EL ++L KTKE    K +   +E  A+EE++S LR EL EIR LQPKLK
Sbjct: 900  EIISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLK 959

Query: 961  EGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVL 1020
            EGAL  VQQSEKL N+ +RIQ M EKI+KM+TIV+L ++ E SQYQ+ +K NKDLS LV+
Sbjct: 960  EGALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVI 1019

Query: 1021 RLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENS 1080
            RLE +  D Q EL KTKSSL+S Q+LLDKHERKWMEEKADYERELISNIEQTESLRVENS
Sbjct: 1020 RLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENS 1079

Query: 1081 ALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKS 1140
             L+EK+DD T  NNGDK++LKLVSLFS+LRHERN+LETKLTTCKR+LA  KQKN +LEK+
Sbjct: 1080 VLIEKVDD-TAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKT 1138

Query: 1141 VNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIY 1200
            +ND+Q+T  +S K+ QCS  IIDEF+DI KE+ QVNILKENN ILQKSLK VTEKN  IY
Sbjct: 1139 INDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIY 1198

Query: 1201 KEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDET 1260
            K+    Q EIS+LQ DL QTKEQVS+N+NK+LVYESE+EQ KQRY +LSQQQK+  K + 
Sbjct: 1199 KQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDI 1258

Query: 1261 EKLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320
            EKL NEIS                   FNRLKKQAHEKLDASKKQQ ALTNE++ELK +K
Sbjct: 1259 EKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIK 1318

Query: 1321 NXXXXXXXXXXXXXXXXXAKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQVFKET 1380
            +                  KLK H +Q+E VS+D E+DT + LMEEIE LK+ELQ+FK  
Sbjct: 1319 DKLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTA 1378

Query: 1381 SDSSDXXXXXXXXXXXXXXXXXXXXXXXXXXXLEEATGKNTGATIENGENMEELKKQWLK 1440
            + SSD                           L+E   K+T +  E  +++E LKK+WLK
Sbjct: 1379 NSSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLK 1438

Query: 1441 QYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLSSD 1500
            +YE+ET+RRIKEAEENLKKRIRLPSEERIQKIISKRKEELE+EF++KLK N+GS T   +
Sbjct: 1439 EYEDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLTFLDN 1498

Query: 1501 KKENEVNAEDDLWNSPSKGNSEKPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRPTSSN 1560
            K   E +AE++LWNSPSKGNSE+PS V   I QKNL  QEQLKN K  +  NDS+   +N
Sbjct: 1499 KGSGE-DAEEELWNSPSKGNSERPSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVTN 1557

Query: 1561 KENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFTPAATSFNTGVSPV--FNIK 1618
            KEN+I  S+ A NKA   F+FGKP F SNTSS QSFQNPFT + ++ NT  +P+   NI+
Sbjct: 1558 KENNIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTN-APLRTLNIQ 1616

Query: 1619 PALAVDATVDTFKTPGLNDAGTNEAKIIEIGNNSLKRPIENEVSFDTDSKKVKENSDNDQ 1678
            P +AV A ++      L +  T+ AKI EIG+ S KRPIE+  S D D+KKVKE+  NDQ
Sbjct: 1617 PEVAVKAAINFSNVTDLTNNSTDGAKITEIGSTS-KRPIESGTSSDPDTKKVKESPANDQ 1675

Query: 1679 VS 1680
             S
Sbjct: 1676 AS 1677

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 1876 bits (4859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1011/1685 (60%), Positives = 1269/1685 (75%), Gaps = 6/1685 (0%)

Query: 1    MEDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRIS 60
            MEDKISE+LHVP +SLQG+NYS+LR L K+ID FE  EEEVTRLNVL+DEIKSQYY+RIS
Sbjct: 1    MEDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIS 60

Query: 61   KLNELLGXXXXXXXXXXXXXXRLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERG 120
            KL++LL                L + L  +R +C RKIDALNKQL++S++ I +LNDE+ 
Sbjct: 61   KLSKLLNESSEQKNIASKELSHLQDQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEKD 120

Query: 121  VKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQE 180
             KEE+ + +++HQN +  ++ L  ENKLLRRKL+EMENILQ CKSN++SL+LKYDT+VQE
Sbjct: 121  AKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQE 180

Query: 181  KELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQ 240
            KEL+L+NKKW EE+LS  + KTL D+ T+ S ++NLEE+L + Q D ES  + +Q LL Q
Sbjct: 181  KELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQ 240

Query: 241  NKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSARE 300
            NKQLSHS+E+KILEIKNLKDT  IEK +FSKEMTLQK+MNDLL SQL SFE+++S     
Sbjct: 241  NKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIG 300

Query: 301  KDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPS 360
            KD+D+ CK+  H NV D+L++TK+Q +KS+DECQRLQNI++D ++ED+A  D T+    +
Sbjct: 301  KDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVD-TNGASHT 359

Query: 361  VNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNS 420
            V K+FSDIK L++QLIKER+QKFQLQNQME FI ELE KTPEL+SFKERT+SLE ELK S
Sbjct: 360  VGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRS 419

Query: 421  TDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKA 480
            T+LLETIS+AKRKDE+ELTSLRQKIN+CEANIH LVKQRLDLARQVK+LLLN SA+QK  
Sbjct: 420  TELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTT 479

Query: 481  SPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADK 540
             PLS D+LISL+K+LESG   NE D+Q II+ERLVEFNN NELQEKN+ELL C+R LADK
Sbjct: 480  LPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADK 539

Query: 541  LENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGN 600
            LE HEGK+D +LA++E QTIKEAKDAIIELE+ N  +ESRI+IL RERDSYKLLAS+  N
Sbjct: 540  LEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKEN 599

Query: 601  KIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEF 660
             +  +A N TE ++ KKIKELE+ELS TKVE+SAV+Q L KEL T KK   + +IA Q+F
Sbjct: 600  NVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDF 659

Query: 661  SNFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCE 720
             NFK+LA EKE++L+TR+++LKT LEKQ+ S PS +  +   + TEL Q + KT+ LM E
Sbjct: 660  ENFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFVQDNKVRDSTELLQSRTKTEILMHE 719

Query: 721  ISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTX 780
            IS+L K+  +   +KESLTRDLERCCKEK+QLQMKL ESE S NEQK+  DSK ++Y+  
Sbjct: 720  ISSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDAR 779

Query: 781  XXXXXXXXXXXXXXXHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTT 840
                            SK QEI++LQ+SK+SQLKWAQNTIDDTE+ +KS+ T+LS K+ T
Sbjct: 780  IKQLEESLERLRIELKSKAQEIKSLQSSKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKT 839

Query: 841  IRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYE 900
            +  LS ++++L+ EL++ KL+Y+ LNN+SDA+TL+ AL+KELE++Q++LKDAHSQ+  YE
Sbjct: 840  VVTLSSKIENLDNELRENKLKYEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYE 899

Query: 901  EIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLK 960
            EIIST+E  LKELN QL   KE+   + +   +E  A EEE+S LRRELDEIR LQPKLK
Sbjct: 900  EIISTNEKALKELNSQLASMKEDYDARIELECKEKLANEEELSLLRRELDEIRSLQPKLK 959

Query: 961  EGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVL 1020
            EG + LV+QSEKL NQ ++IQ M  KIDKM   V+++++ +TSQ+Q+ +KANK+LS LV 
Sbjct: 960  EGTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVT 1019

Query: 1021 RLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENS 1080
            RLE E  D Q ELKK KSSLH TQ+LLD HE+KWMEEKADYERELISNIEQTESLRVENS
Sbjct: 1020 RLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENS 1079

Query: 1081 ALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKS 1140
             L+EKI   T  ++G+++YLKLVS FS+LRHERN+LETKLTTCKRDLAL KQKNA+LEK+
Sbjct: 1080 VLIEKIGSVTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKN 1139

Query: 1141 VNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIY 1200
            +ND+Q     S+ ++QCS  IIDEF DI KEIAQVN+LKENN ILQKSLK VTEKN  IY
Sbjct: 1140 INDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIY 1199

Query: 1201 KEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDET 1260
            +E T  Q E+SQL+ DL +TKEQVSVNANK+L+YESE++Q KQRY +LS QQ+E  K   
Sbjct: 1200 EELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTI 1259

Query: 1261 EKLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320
            EKL +EIS                   FNRLKKQAHEKLDASKKQQTALTNE+ ELK ++
Sbjct: 1260 EKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVR 1319

Query: 1321 NXXXXXXXXXXXXXXXXXAKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQVFKET 1380
            +                  + K+H VQ+  + +DQE+  S PL+EEIE LKRELQVFK  
Sbjct: 1320 DKLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIESLKRELQVFKNA 1379

Query: 1381 SDSSDXXXXXXXXXXXXXXXXXXXXXXXXXXXLEE--ATGKNTGATIENGENMEELKKQW 1438
            ++SSD                           LEE  +  K+TG   +N EN+E LKK+W
Sbjct: 1380 NNSSDAFEKLRDNMEEEKNKIINERTKEFEKKLEEIVSKSKSTGKVADNSENIETLKKEW 1439

Query: 1439 LKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLS 1498
            LK+YEEET+RRI+EAEENLKKRIRLPSEERIQKIISKRKEELE+EFQRKLK N+ S T S
Sbjct: 1440 LKEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFS 1499

Query: 1499 SDKKENEVNAEDDLWNSPSKGNSEKPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRPTS 1558
             D+KE   + ++DLWNSPSKGNSE+PSV+T+ ++QKN+ +QEQLK  K G+   DSR +S
Sbjct: 1500 CDRKETNDDPDEDLWNSPSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSS 1559

Query: 1559 SNKENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFTPAATSFNTGVS-PVFNI 1617
             NKEN        ++KA   F+FGKPLFPS T+SFQSFQNPFT +    NTGVS P FNI
Sbjct: 1560 MNKENSALVKVN-DDKAASTFSFGKPLFPSTTTSFQSFQNPFTQSTIDSNTGVSLPTFNI 1618

Query: 1618 KPALAVDATVDTFKTPGLNDAGTNEAKIIEIGNNSLKRPIENEVSFDTDSKKVKENSDND 1677
            +  L      DT KT GL +   +E +I EIG ++LKRP E + S D ++KKVKE+ +++
Sbjct: 1619 RTDLLAGVATDTSKTDGLANNSPDEEEITEIG-STLKRPNEEDASSDPNTKKVKESPEDE 1677

Query: 1678 QVSEN 1682
              S++
Sbjct: 1678 PASKD 1682

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  457 bits (1176), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 383/1225 (31%), Positives = 662/1225 (54%), Gaps = 56/1225 (4%)

Query: 137  LERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQLS 196
            +E   L ++NK LR++L+E +N +QT K N L  K + + V Q+  ++ ++ +W+E++++
Sbjct: 158  VESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVT 217

Query: 197  FRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIK 256
             + E+ +       + +Q   +++ R +NDY+   ++ +FLL +N+++S  ++ K+ EIK
Sbjct: 218  SKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIK 277

Query: 257  NLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSAREKDND---DPCKNSQHA 313
             L D +N EK +FS+EM+L++ + DL   QL SF++   L+  EK N    D  +++Q A
Sbjct: 278  KLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEELRLT-EEKHNSTEADNLQSTQQA 336

Query: 314  NVVDKLIDTKLQLEKSKDECQRLQNIVADCI-EEDEAAFDNTHNVDPSVNKVFSDIKALK 372
              +D L   + QLE+S  E  RLQ +V + + + +E   D+T NV  S+ K++ DI  LK
Sbjct: 337  RFMDDLAQVRQQLEESNHERLRLQAVVNEVMGDSEEFDLDSTANV--SIPKLYGDIGVLK 394

Query: 373  RQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKR 432
            +QLIKER+QK  LQ Q+ESF+ ELE K P + S KER+ +LE+EL +   LLE  S  K 
Sbjct: 395  KQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKE 454

Query: 433  KDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLK 492
            +  +EL S   KI   E N H+L++QR DLARQV+ LL N +       PL+ DE+  +K
Sbjct: 455  RKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIK 514

Query: 493  KLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSL 552
            K++E+ +  NE DSQ IITERLVEF +   LQE+N ELL   R LAD+LE  E   +  +
Sbjct: 515  KIIENENPSNESDSQSIITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRI 574

Query: 553  AKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKI--YADAAN-K 609
              LE +TI EAK+AII L+  NS +ES++  + +ERD+YK + S          DA   K
Sbjct: 575  DSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMK 634

Query: 610  TEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIE 669
                N + IK LE +LS    E S   + LN+E+    +S++   I+ ++  + + LA +
Sbjct: 635  DSQENQELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAED 694

Query: 670  KENLLQT--------------RIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTK 715
            +  LLQ+              R  +L++ L KQ +    +++  I  +        +K  
Sbjct: 695  RLKLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQ--------SKLS 746

Query: 716  SLMCEISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQV 775
             L    +NL  + + L+   +SL R++++   E+  L + +T+ +T  +E++      Q 
Sbjct: 747  VLEARAANLDAEKSLLQSSSDSLRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQA 806

Query: 776  QYNTXXXXXXXXXXXXXXXXHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLS 835
             +                   SK  EI+  + +K +Q KW Q  ID+   +   +  +L+
Sbjct: 807  SHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELA 866

Query: 836  EKKTTIRKLSLEMKDL--EIELQKTKL-QYKLLNNSSDANTLETALKKELERSQIDLKDA 892
             K  T+ +L LE+ DL  +IE   +++  YK LN++ +  T +  L+K+LE++ I+LK A
Sbjct: 867  TKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNGETTQGQLRKDLEKTMIELKHA 926

Query: 893  HSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEI 952
            +SQ E +++I ST E TLK L+++  +  E LK  ++    E    E+ +S L++ +D +
Sbjct: 927  YSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFL 986

Query: 953  R---GLQPKLKE-------GALRLVQQSEKLGNQT-----QRIQAMNEKIDKMTTIVELH 997
                 LQ    E         L  ++ SE    Q      Q++  + + +++ T    + 
Sbjct: 987  NNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIA 1046

Query: 998  QEVETSQYQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEE 1057
            Q+     Y+ +L+ + ++S ++ +L +EV   ++E+++ K+S    +E+L+  E+ W  +
Sbjct: 1047 QK----NYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKASEQQAKEVLENGEKSWYNQ 1102

Query: 1058 KADYERELISNIEQTESLRVENSALVEKID-DGTGENNGDKEYLKLVS-LFSSLRHERNT 1115
            K + +  +     Q +++  +N  L  +++     E   + + L   S L  SLR ER+ 
Sbjct: 1103 KTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPGSSELLISLRRERDI 1162

Query: 1116 LETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQV 1175
            LETKLT  KR+  L  QK   LE  + + ++     +++    +DI  + EDIM+++ Q+
Sbjct: 1163 LETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHSDIAKQHEDIMEQLNQM 1222

Query: 1176 NILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYE 1235
            N+L+E+N  L+ ++    EKN  +  E   LQ +I  L  +L++ ++ +     ++++  
Sbjct: 1223 NLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEKDQRIILLI 1282

Query: 1236 SEIEQWKQRYDNLSQQQKETHKDETEKLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQA 1295
             E ++WK+R  ++ ++ ++   +E  KL  EIS                   F RLKKQA
Sbjct: 1283 DEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDRFTRLKKQA 1342

Query: 1296 HEKLDASKKQQTALTNEVDELKDMK 1320
            HEKL+ASK  Q  L+ EV+EL+  K
Sbjct: 1343 HEKLNASKIAQANLSAEVNELQGTK 1367

 Score =  102 bits (253), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 121/237 (51%), Gaps = 36/237 (15%)

Query: 1434 LKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSG 1493
            LKKQW ++YE  + +RI+EAEENLKKRIR+P+EERI+K++ KRK ELE+EFQR+LK N+ 
Sbjct: 1518 LKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNL 1577

Query: 1494 SFTLSSDKKEN-----------EVNAEDDLWNSPSKG---NSEKPSVVTNLIRQKNLILQ 1539
                  D KE            E   ++ L ++  K      ++ ++ + L+ +K   L+
Sbjct: 1578 QPE-GGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLE 1636

Query: 1540 EQLKN-----PKKGIISNDSRPTSSNKENDIPGSTTAENKAPLAFNFG-KPLFPSNTSSF 1593
             QL +     P+K   ++   PT       I  S T EN A     FG K L  S+  +F
Sbjct: 1637 SQLNSSNNPTPEKAAATSVGLPTK------IDESRT-ENMATGTPAFGEKVLKLSDKPAF 1689

Query: 1594 QSFQ-----NPFTPAATSFNT--GVSPVFNIKPALAVDATVDTFKTPGLNDAGTNEA 1643
             SFQ     NPFT A    N   G+ P F+  P  +   +  TF + G N     E+
Sbjct: 1690 -SFQPSSKSNPFTSALPGNNNVFGMKPTFSFTPGSSQPESRPTFGSTGFNTTAEPES 1745

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  435 bits (1119), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 405/1392 (29%), Positives = 734/1392 (52%), Gaps = 113/1392 (8%)

Query: 5    ISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISKLNE 64
            IS +L + +  +  ++ +++R L  + ++F + + +  + +V +DE+KS    R    +E
Sbjct: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERR----SE 76

Query: 65   LLGXXXXXXXXXXXXXXRLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERGVKEE 124
                             +  +  ++E+ K   +    +K++N  K+ +T+L      K++
Sbjct: 77   AFKLQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQLTEL------KQQ 130

Query: 125  AEVLKAEHQN---------NDLERSA-----LGHENKLLRRKLLEMENILQTCKSNTLSL 170
             E+ ++  Q+          DLE S      L    K LR+++LE+EN +QT KSN L  
Sbjct: 131  NEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRG 190

Query: 171  KLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESV 230
            K +   + QE  L+  N +W+E++L+ + E+         S +Q    +LN  +++ E  
Sbjct: 191  KAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSELEIE 250

Query: 231  STNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSF 290
             +++Q L ++   LS  ++ K+ E+K+L+D+ +IEK +F++EMTL++ + DLL  Q+ SF
Sbjct: 251  RSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESF 310

Query: 291  EKNYSLSAREKDNDDPCKNSQHAN-----VVDKLIDTKLQLEKSKDECQRLQNIVADCIE 345
            +     SAR K       NS H +     ++++LI+TK +LE S+ +  +L+  V + + 
Sbjct: 311  KTELE-SARNKS----VSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETVDELLS 365

Query: 346  ED-EAAFDNTHNV-----DPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERK 399
             D E    NT  V     +  V K+  DI  LK++LI+ER QK QLQ Q+E+F+ ELE K
Sbjct: 366  TDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHK 425

Query: 400  TPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQR 459
             P L SFKERTE LE+EL +   +LE  S  K + E ELTS++ KI + E  IHSLV+QR
Sbjct: 426  VPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQR 485

Query: 460  LDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNN 519
             DLA QV+ LL+ +S       PL+ +E   +KK++ S + P E+D+Q II+ERLV F +
Sbjct: 486  SDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFES 545

Query: 520  TNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLES 579
              ELQEKNMELLN +R LADKLE  E +      ++E++T+KEAK+AI+ L+  N +LES
Sbjct: 546  MVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKSLES 605

Query: 580  RIDILSRERDSYKLLASANGNKIYADAANKTEAANL----KKIKELESELSLTKVENSAV 635
            +++I+++ERD++K+LAS  G        N +E  +L    +KIKELE+ LS    E++  
Sbjct: 606  QLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEESAKN 665

Query: 636  VQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENL--------------LQTRIDDL 681
            ++ LN+E+ +  ++Q++  + L++  + ++LA ++  L              L+ R   L
Sbjct: 666  IKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSL 725

Query: 682  KTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESLTRD 741
            +  + KQ S    +I   I          K++  +L  +++N   +   LR ++E+L ++
Sbjct: 726  QENILKQDSKTQQTIESLISC--------KSQLSALQSQLNNSQSERDLLRSIQENLKKE 777

Query: 742  LERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTXXXXXXXXXXXXXXXXHSKVQE 801
             E   +E+  +++ +T+ +T   E++   +  Q  +                   +K +E
Sbjct: 778  NESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKE 837

Query: 802  IETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQ 861
            I    ++K+SQ KW Q   D   + + +    LS K T I+ L L+++ L  +L++++ +
Sbjct: 838  ISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEAR 897

Query: 862  ---YKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLT 918
               +  LN S    +    L++ELE+++I L DA+SQ+E Y+ +  + E +   + D L 
Sbjct: 898  IQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALE 957

Query: 919  KTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLKEGALRLVQQSEKLGNQTQ 978
            ++K E   K ++L +E +  ++++  L+   D+I  L  +L     +   Q        +
Sbjct: 958  QSKAEYTEKIETLTKERDMFKDQVPILK---DQISNLNNELNHQKSQFESQISDYTRNLE 1014

Query: 979  RIQAMNEKIDKMTTIVE---------LHQEVE---TSQ--YQAKLKANKDLSALVLRLEN 1024
             ++A   ++D M    E         L+Q+     T+Q  Y+ +L+ + D+S  +  L  
Sbjct: 1015 DLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRA 1074

Query: 1025 EVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSALVE 1084
            E   Y++E +  +++  + ++ L++ E  W ++ +DYE EL    ++ E L  ++  L +
Sbjct: 1075 EAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYD 1134

Query: 1085 KIDDGTGENNGDKEYLKLVS-----LFSSLRHERNTLETKLTTCKRDLALAKQK----NA 1135
            +ID  +       E L  +S     L +SLR E++ LETKL    R+  + +QK     +
Sbjct: 1135 QIDFLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIES 1194

Query: 1136 NLEKSVNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEK 1195
            +LE S  ++ +   + R     S  + D+ E+IM ++ Q+N+L+E+N  L+   +K  E+
Sbjct: 1195 DLEGSRIELSK---LQRAASGNSATLKDQ-EEIMTQLNQLNLLRESNITLRNEAQKNGER 1250

Query: 1196 N-------EAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNL 1248
            +       +A+Y +   L+ +++ LQ  + +   Q+S+          E E+WKQR  ++
Sbjct: 1251 SRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLK-------NEEAERWKQRSQDI 1303

Query: 1249 SQQQKETHKDETEKLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTA 1308
              + +    +E +KL +++S                   F RLK+QAHEKL+A+K  Q+ 
Sbjct: 1304 LHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQST 1363

Query: 1309 LTNEVDELKDMK 1320
            LT+++++LK  K
Sbjct: 1364 LTSQLNDLKATK 1375

 Score = 79.7 bits (195), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 109/227 (48%), Gaps = 48/227 (21%)

Query: 1430 NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLK 1489
            N++E+KK+W ++YE++T +RI+E+ E LKKRIRLP+EE+I KI+ K++ ELE EF+  ++
Sbjct: 1540 NIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQ 1599

Query: 1490 ANSGSFT--------------------LSSDKKENEVNAEDDLWNSPSKGNSE---KPSV 1526
              +                        L + K+E +   ++D+     +   E   + S+
Sbjct: 1600 KKAEEIAKSKSASNSNSTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASM 1659

Query: 1527 VTNLIRQKNLILQEQLKNPKKGIISND--------SRPTS----------SNKENDIPGS 1568
             +  + +K   L+ Q+K     I  ND        S PT+          +N+   +PG 
Sbjct: 1660 KSTFLEKKIAKLETQIKAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGK 1719

Query: 1569 TTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFT--PAATSFNTGVSP 1613
                N  P  F FG P F   TS+  SFQNPF   P   + N+   P
Sbjct: 1720 PLPFN--PAHFAFGMP-FGQTTSN--SFQNPFNSQPPEQTPNSPKRP 1761

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  429 bits (1104), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 497/1864 (26%), Positives = 901/1864 (48%), Gaps = 261/1864 (14%)

Query: 4    KISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTR----- 58
            K+S +  VP   L  ++  IL  L  ++  F   + +  RLNV IDEIK+    R     
Sbjct: 25   KLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLK 84

Query: 59   -----ISKLNELLGXXXXXXXXXXXXXXRLHNLLKNERSKCARKIDALNKQ---LNASKN 110
                 + K N+ +               R    ++NE      K+  L+++   L   K 
Sbjct: 85   NEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDKR 144

Query: 111  TITKLNDERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSL 170
             +  + +E+ +KE  E  + E       R +L  ++K LR+++LE+E  +Q  KS  L  
Sbjct: 145  EVVAVLEEK-IKE-LESFRTES------RKSLD-DSKRLRQQVLELETTVQNLKSKELRD 195

Query: 171  KLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESV 230
            + +  T+ Q   ++ +N +W+EE+++ + E+ +         +  L  +    +N+ +  
Sbjct: 196  QSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLE 255

Query: 231  STNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSF 290
             + NQ +  +N++L+ S+++K++E+K+L D++  EK +F+ EM++++ + DLL +Q+ S 
Sbjct: 256  KSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSL 315

Query: 291  --EKNYSLSAREKDNDDPC----KNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCI 344
              E N SL   +KDN +      +N+++  ++ +LI  K   E+S+ E  RL+ +V + I
Sbjct: 316  QGELNASL---DKDNVELLASGERNTENEKLIQELITLKENFEESERERLRLEALVQELI 372

Query: 345  EEDEAAFD--NTHNVDPSVNKVFS--DIKALKRQLIKERNQKFQLQNQMESFIKELERKT 400
              D++  D  NT +     NK  S  D+  LK++LIKER+QK +LQ Q+ESFI ELE K 
Sbjct: 373  PGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKI 432

Query: 401  PELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRL 460
            P + SFKERT  LE+EL +   LL+  S  K K E+E  +L +K+ + E++IH+L +QR 
Sbjct: 433  PVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRT 492

Query: 461  DLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNT 520
            DLA QV+ LL+NIS        LS +E+  +K+++ + D  +E DSQ +I+ERLVEFNN 
Sbjct: 493  DLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNI 552

Query: 521  NELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESR 580
              LQEKNMELL  VR LA+KLE+ E   +K +   EN TIKEAK+AI+ L+  N+ LES+
Sbjct: 553  ATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESK 612

Query: 581  IDILSRERDSYKLLASANG----NKIYADA--ANKTEAANLKKIKELESELSLTKVENSA 634
            ++IL++E D++K + S NG      + A+    N+  +++ +K++ LE+ L+   VE+S 
Sbjct: 613  VEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQ 672

Query: 635  VVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQ--------------TRIDD 680
              + LN E+    +S++   I L++  + K L  E+  L+Q               R  +
Sbjct: 673  NNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQN 732

Query: 681  LKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESLTR 740
            L++  ++Q S    +++        EL    +K   L  +++NL  +   L+  + +   
Sbjct: 733  LQSIFDRQDSRTAETVN--------ELIACNSKLAVLETKVANLETEKELLQSSERTSRE 784

Query: 741  DLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTXXXXXXXXXXXXXXXXHSKVQ 800
            +  +  +E+  L++ +++ +T  +E++      Q  Y                   +K +
Sbjct: 785  NYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTK 844

Query: 801  EIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLE--IELQKT 858
            E E ++ SK +Q++W Q+ +D      + L  +L  K   +  L  E++ LE  +E  + 
Sbjct: 845  EAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEA 904

Query: 859  KLQ-YKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQL 917
            ++Q Y++L+ S    + E++L+KELE+++I+L D +++I+ Y+ ++ST E +L +L    
Sbjct: 905  RIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDY 964

Query: 918  TKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIR-GLQP--KLKEGALRLVQQS-EKL 973
               K+EL+++ ++L  E +  ++ ++ L   + ++   LQ   K  E     +Q+    L
Sbjct: 965  ASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATL 1024

Query: 974  GNQTQRIQAMNEKIDKMTTIVELHQEVETS---------QYQAKLKANKDLSALVLRLEN 1024
              +++    + E+ D    I++L +++E            Y+ +L+ + ++S  +  L  
Sbjct: 1025 ETESKGSHQLKEEYD--AQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELRE 1082

Query: 1025 EVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSALVE 1084
            +    +  + + K+S    +++L+++E+ W  +K +YER+L ++ +  E L  +NS L +
Sbjct: 1083 QSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYD 1142

Query: 1085 KID----DGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKS 1140
            +I+    D +   NG  E  ++  + ++LR ER+ L TKLT  +R+    +   A++E  
Sbjct: 1143 QIELFSKDNSDGVNG--ETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENE 1200

Query: 1141 VNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIY 1200
            ++  ++     +K++   +++I + E I++++ Q+N+L+E+N  L+ + ++  +KN  + 
Sbjct: 1201 LDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQ 1260

Query: 1201 KEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDET 1260
            +E   L+  I  L+ +L      V     ++ +Y+ E  +WK+R   +  +      ++ 
Sbjct: 1261 EELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDH 1320

Query: 1261 EKLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320
            ++L  ++S                   FNRLKKQAHEKL++SK  QT L+N+++EL++ K
Sbjct: 1321 KELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAK 1380

Query: 1321 NXXXXXXXXXXXXXXXXXAKLKKHLVQAEGVSK-----------------------DQEE 1357
            +                  +L  H    E V                          Q E
Sbjct: 1381 SELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNE 1440

Query: 1358 DTSKPLMEEIELLKRELQVFKETSDSSDXXXXXXXXXXXXXXXXXXXXXXXXXXXLEEAT 1417
            + +K L +EI+ LK EL   KE S                                  AT
Sbjct: 1441 EITKKLNDEIDSLKLELHSLKEQS---------------------------------AAT 1467

Query: 1418 GKNTGATIENGENMEELKKQWLKQYEEETM------------------------------ 1447
             K      E  E++  + +   + +EEE +                              
Sbjct: 1468 AKG-----EISEDLSNVVESMRRSFEEEKINFLKEKTEELKKLEEEKHTLQVNGNEPQQQ 1522

Query: 1448 --------------------RRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRK 1487
                                +RI EAEENLKKRIRLP+EERI++++ K+K  LE+ +++K
Sbjct: 1523 PVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKK 1582

Query: 1488 LK----------ANSGSF--TLSSD---KKENEVNAEDDLWNSPSKGNSEKPSVVTNLIR 1532
            L+           N+      L  D   K E EV A   +     +   ++ ++ + L+ 
Sbjct: 1583 LEESKSSLESSDGNNSDLKKQLEKDLQEKFEAEVQA---VKKKAFEEGKQQAAMKSTLLE 1639

Query: 1533 QKNLILQEQLKN----PKKGIISNDSRPTSSNKENDIPG-----STTAENKAP------- 1576
            +K   L+ QL      P K      S  TSS  + ++P      S T     P       
Sbjct: 1640 RKISKLESQLHGKVDSPDKS-----SSETSSVPKPNLPSKIDEKSVTTNQSVPNPLVSGE 1694

Query: 1577 --LAFNFGKPLFPSNTSSFQSFQNPFTPAATSFNTGVSPVFNIKPALAVDATVDTFKTPG 1634
              L  +  KP F  N SSF S  NPFT +  + +T  +  F  KP   +  + ++ K+ G
Sbjct: 1695 KVLKLDPSKPTF--NFSSF-SGGNPFTSSPQNNDTMGTSAFGFKPTFTL--SNNSNKSSG 1749

Query: 1635 LN-DAGTNEAK-------IIEIGNNSLKR--------PIENEVSFDTDSKKVKENSDNDQ 1678
               D+ + E K         E G +S +R        P   E +  T SK+  E+ DN+ 
Sbjct: 1750 TKIDSSSTENKPANPFSSFTETGASSPERESSNTAMTPTPGEGA-STPSKRAAEDDDNEV 1808

Query: 1679 VSEN 1682
             SE+
Sbjct: 1809 GSES 1812

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  395 bits (1014), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 395/1370 (28%), Positives = 700/1370 (51%), Gaps = 85/1370 (6%)

Query: 5    ISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISKL-- 62
            I+ +     + ++ ++  I+  L  ++ +F   + E  ++ V +DE+K+    +I+ L  
Sbjct: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83

Query: 63   --------NELLGXXXXXXXXXXXXXXRLHNLLKNERSKCARKIDALN---KQLNASKNT 111
                    N+ +               R    L NE     RK+  L+   K++ +S+  
Sbjct: 84   EMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEEKKEIQSSQQR 143

Query: 112  ITKLNDERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLK 171
              K+ DER   +E E++KA   ++D        E K LR  +LE+E   QT  SN L+ K
Sbjct: 144  TLKILDERL--KELEMVKAASNHSD-------SECKKLRSTILELETKQQTYISNDLNSK 194

Query: 172  LKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVS 231
             + +   QE  L+  NK W+E++LS ++++ L       + +  +   LNR +ND++   
Sbjct: 195  SQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEK 254

Query: 232  TNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSF- 290
            TNN  L  +N +LS  +++K+L+IK L D+ N EK DFS E+TL++ + DLL SQL +  
Sbjct: 255  TNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVK 314

Query: 291  -------EKNYSLSAREKDNDDPCKN--SQHANVVDKLIDTKLQLEKSKDECQRLQNIVA 341
                   E NYS       N D  K   S++  ++  L  TK +L + ++EC RL +I  
Sbjct: 315  EELNNTRESNYS-----DVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITE 369

Query: 342  DCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTP 401
            +  +ED              +K   D   LK+QLIKE+  K  LQNQ+ESFI ELE K P
Sbjct: 370  EAGKEDGIL----------TSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVP 419

Query: 402  ELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLD 461
             + SFKERT++LE EL N+  LLE  S  K    KEL    +K+   +  IH L KQRLD
Sbjct: 420  IINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLD 479

Query: 462  LARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGD-VPNEKDSQIIITERLVEFNNT 520
            L RQ++ LL+  S       PL  +E+  ++ +L++ D    E DSQ I+TERLVEF + 
Sbjct: 480  LCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDI 539

Query: 521  NELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESR 580
             +LQEKN ELL   R LADKLE++E K    L  +EN+TI EAK+AI+ L+     LES+
Sbjct: 540  IQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESK 599

Query: 581  IDILSRERDSYKLL-----ASANGNKIYADAANKTEAANLKKIKELESELSLTKVENSAV 635
            I  L +ER+ +K        S N + I      K E  +  + ++L++ +S    E++  
Sbjct: 600  IHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELES--QTQDLQARISQVTRESTEN 657

Query: 636  VQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQTRIDDLKT---KLEKQRSSA 692
            +  LNKEL     S+S+  I L    + ++LA E+  LL   +D  K    +L K+  + 
Sbjct: 658  MSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINL 717

Query: 693  PSSIHGSIGSEETELSQY---KNKTKSLMCEISNLSKKNTDLRCMKESLTRDLERCCKEK 749
             ++I       +  L+ Y   K+K  ++  E+SNL  + T    ++++L ++L     EK
Sbjct: 718  QNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEK 777

Query: 750  MQLQMKLTESETSHNEQKLKSDSKQVQYNTXXXXXXXXXXXXXXXXHSKVQEIETLQTSK 809
              L + +T+ +T   E++   D  +                       K Q I+ L+   
Sbjct: 778  TSLHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDN 837

Query: 810  NSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQ---YKLLN 866
            +S+++W QN I+   K+ +S+ + L+EK+  + +   E+K LE E+++ K++   Y +L+
Sbjct: 838  DSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLD 897

Query: 867  NSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKV 926
             S +    + +L++ELE+S+I+L DA+SQI+ Y+++  T + +L+E++ QL ++ +    
Sbjct: 898  ESIN----DDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSN 953

Query: 927  KSQSLDEENNAKEEEISFLRRELDEIRGLQPKLKEGALRLVQQSEK-----LGNQTQRIQ 981
            + Q+L +E  + E+++S LR ++  +   +  L+  A+   +   K     L N  + I+
Sbjct: 954  QIQNLTDEKTSLEDKVSLLREQMSNLNN-ELDLQNQAMEKEKAEFKKKISILQNNNKEIE 1012

Query: 982  AMN-------EKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQTELK 1034
            A+         KI K      ++     + Y+ +L+ + D+S  +  L  ++  Y+ +++
Sbjct: 1013 AVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVE 1072

Query: 1035 KTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSALVEKID--DGTGE 1092
                +    ++ L ++E  W  +K     +L  +  + E L  +N  L ++I+    TG 
Sbjct: 1073 TLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGN 1132

Query: 1093 NNGDKEYLKLVS--LFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLV 1150
               D +   +++  +  +LR ER+ L+TK+   +RD  + +QK + ++  + + +     
Sbjct: 1133 KPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCN 1192

Query: 1151 SRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEI 1210
            S+ + +  + II + +++M+++ Q+N+L+E+NT L+  L     KN+ +  E   L+  I
Sbjct: 1193 SKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNI 1252

Query: 1211 SQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISXX 1270
            + ++ +LA  K  +     ++ + + E+ +WK+R  ++ ++ ++    + EKL  EI   
Sbjct: 1253 APIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESL 1312

Query: 1271 XXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320
                             FNRL++QA EKL ASK  Q +   +++ELKD K
Sbjct: 1313 KAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAK 1362

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 58/118 (49%), Gaps = 44/118 (37%)

Query: 1430 NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEF----- 1484
            N++E+KKQW  ++ EE  ++I+EAEE LKKRIRLP+EE+I KII ++KE+LE+EF     
Sbjct: 1508 NIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVE 1567

Query: 1485 ---------------------------------------QRKLKANSGSFTLSSDKKE 1503
                                                   Q KL+    S  +SSD K+
Sbjct: 1568 ERLKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSSDIISSDDKD 1625

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  391 bits (1004), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 405/1393 (29%), Positives = 697/1393 (50%), Gaps = 126/1393 (9%)

Query: 4    KISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISKLN 63
            K++ +L V    +Q ++ S++     + ++F + + +  RL++ ID +K  +  +I+   
Sbjct: 17   KVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFK 76

Query: 64   E----LLGXXXXXXXXXXXXXXRLHNLLKNERSKCARKIDALNKQ----------LNASK 109
            E    LL                   L+ NE+++ + ++  L  Q          + ++K
Sbjct: 77   EQVEKLLSDVASRQQEKQQTEDEKLKLM-NEKAQLSMEVLKLRSQVEEAKQGMEIIASAK 135

Query: 110  NTITKLNDER-----GVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCK 164
              +TKL +E+       KEE++ L A               NK LR+  +++E I+Q  K
Sbjct: 136  QDVTKLLEEKISDLAASKEESDRLLAA--------------NKELRKSSIDLEFIIQGYK 181

Query: 165  SNTLSLKLKYDTVVQEKELILENKKWMEEQL--------SFRDEKTLVDDVTRTSHVQNL 216
            S  L  K +   + QE  L+  N  W+ ++L        SFR EKT        S +QN 
Sbjct: 182  SQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFR-EKT-------NSELQNG 233

Query: 217  EEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQ 276
             EQ+N  ++  E    NN  L A+  +LS+ +++K++E K L D +N EK +F++EM+L+
Sbjct: 234  YEQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLK 293

Query: 277  KNMNDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRL 336
            + + DLL SQ++S + +   +A +  N +     +   ++D+LIDTK  LE ++ E  +L
Sbjct: 294  QRLIDLLESQVSSMKSDLE-NAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKL 352

Query: 337  QNIVADCIE---EDEAAFDNTHNVDPS-------VNKVFSDIKALKRQLIKERNQKFQLQ 386
            +  V + +    ++  A  N++  D S       V K+  DI  LK+QL++ER QK +LQ
Sbjct: 353  EATVNELLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQ 412

Query: 387  NQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEK--ELTSLRQK 444
            NQ+ESF+ ELE K P L SFKERT+ LE+EL + T LLE  S AK++D+K  EL   + K
Sbjct: 413  NQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLLE--STAKQRDQKTIELNQYKNK 470

Query: 445  INNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEK 504
            INN E+ + SL+ QR DLA QV+ LL+ +S       PL+  E+  +K+++ S D   + 
Sbjct: 471  INNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKS 530

Query: 505  DSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAK 564
            D+Q II+ERLV+F +  ELQ KN ELLN +R LADKLE+ E K    L  +E QT+KEAK
Sbjct: 531  DTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAK 590

Query: 565  DAIIEL-EHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKTEAANLKKIKELES 623
            +AI+ L EHV   LE ++ I+S+ERD++KL  SAN     A ++        + I ELE 
Sbjct: 591  EAILSLQEHVQR-LEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELEK 649

Query: 624  ELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQT------- 676
             L     ++   ++ LN E+    K++S   + L++  + KVLA E+  L+Q+       
Sbjct: 650  RLKNLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKE 709

Query: 677  -------RIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNT 729
                   R DDL+  L KQ     S+I   I + +++LS   +K   L  E   L K   
Sbjct: 710  ENLELHKRSDDLQRVLLKQDEKTQSTIDEIIAT-KSQLSNLTSKLAILTSERDFLRKIEA 768

Query: 730  DLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTXXXXXXXXXX 789
            +L+   E+LT       KE    ++ +++ +T   E+ +  +  Q  Y            
Sbjct: 769  ELKNENEALT-------KENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLH 821

Query: 790  XXXXXXHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMK 849
                    + +E E  + S  SQ KW Q  +D   + + +    L EK  +I  L L  K
Sbjct: 822  ETREHLVRRTREYEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAK 881

Query: 850  DLEIELQKTKLQ---YKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTD 906
             L  +L++ +L+   Y +L N+ D       L+K LE++ I+L DA+SQIE Y+ +    
Sbjct: 882  SLTAKLEEAELRTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVS 941

Query: 907  ENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLKEGALRL 966
            E +  E++  L +++   +     L++E  +  ++I+ L    D+I+ L  +L     + 
Sbjct: 942  EQSAVEISKALEESQANYRKNIALLEQERKSLTDQIALLN---DQIKDLNSELDHQKSQ- 997

Query: 967  VQQSEK--LGNQTQRIQAMNEKIDKMTT-----IVELHQEVETSQ----------YQAKL 1009
              QSEK  L  +   +Q     +D++ +     I +L +++ T Q          Y+ +L
Sbjct: 998  -NQSEKSELIKKLSILQGSQRSLDELKSEYEEKISKLQEDL-TQQASYANQAQKNYEQEL 1055

Query: 1010 KANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNI 1069
            + + D++  +  L  E   Y++E++  K S    +  L+++E+ W ++ AD E +L    
Sbjct: 1056 QKHADVTKTISLLREESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQ 1115

Query: 1070 EQTESLRVENSALVEKIDDGTGENNGDKEYLKLVS-----LFSSLRHERNTLETKLTTCK 1124
            ++TE L  +N  L ++++  +   + D E    +S     L  +LR ER+ LETKL    
Sbjct: 1116 QRTEELNTQNRLLYDQVELLSKATSSDSEAAASMSAESRELIMTLRRERDILETKLDVSI 1175

Query: 1125 RDLALAKQKNANLEKSVNDMQQTHLVSRKDVQCSTDII---DEFEDIMKEIAQVNILKEN 1181
            R+  + +Q+   L  +  +++   L   K    + D I   +  E IM+++ Q+N+L+E+
Sbjct: 1176 REEKILRQR---LGLAKTELENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRES 1232

Query: 1182 NTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQW 1241
            N  L+   KK  E+++    E   LQ ++  L+  L      +S    ++ + + E  +W
Sbjct: 1233 NVTLRNESKKYLEQSQHFQNEIAKLQEQLQPLESQLKSLTITISERDQQISLLKEESSRW 1292

Query: 1242 KQRYDNLSQQQKETHKDETEKLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDA 1301
            KQR  ++  + +     E +KL +E++                   F +L+KQA+E+LD 
Sbjct: 1293 KQRSQDILHKYERIDPVEHQKLADEVTELKNELEKKSLENLESQERFRKLRKQANERLDE 1352

Query: 1302 SKKQQTALTNEVD 1314
             K  +  + +E +
Sbjct: 1353 FKAAKAKVESEFE 1365

 Score = 70.9 bits (172), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 113/247 (45%), Gaps = 39/247 (15%)

Query: 1432 EELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKA- 1490
            E LK +   +YE++T+ RI+EAEE LKKRIRLPSEERI ++I +R+  L+QEF+ +++A 
Sbjct: 1537 ETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRAR 1596

Query: 1491 -------NSGSFTLSSDKKENEVNAEDDLWNSPSKGNSEKPSVVTNLIRQK-------NL 1536
                   N  SF   + K   E   E D   +       K      L+R+K        L
Sbjct: 1597 ALELFKENPESFVGDTAKLIKEHQEEMDKLEA-------KFDEQLALVRKKAFEEGKQQL 1649

Query: 1537 ILQEQLKNPKKGIISNDSRPTSSNKENDIPGSTTAENKAPLAFNFGKPLF--PSNTSSFQ 1594
            +++ +L   K  I   + +P   N  N +P     +N    +    +P+   PS      
Sbjct: 1650 VMKVKLLESK--IAKLEGQPNKINLNNSVPSKIPIDNNNNSSPQGAQPIAIKPS------ 1701

Query: 1595 SFQNPFTPAA--TSFNTGVSPVFNIKPALAVDATVDTFKTPGLNDAGTNEAKII---EIG 1649
             FQ  F  A   TSF +    + + K  +A   T DT  +    + GTN  K     E+ 
Sbjct: 1702 PFQVAFGKAMENTSFGSFKGSLLDSKQFIA--NTADTSTSTLTGNVGTNTNKRQSEDELA 1759

Query: 1650 NNSLKRP 1656
             +  KRP
Sbjct: 1760 QSPEKRP 1766

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  389 bits (998), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 395/1358 (29%), Positives = 724/1358 (53%), Gaps = 66/1358 (4%)

Query: 5    ISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISKLNE 64
            I+ +     + ++ +N  +++ L  ++ +F   + E  ++ V  DE+K+    +I  L +
Sbjct: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83

Query: 65   ----LLGXXXXXXXXXXXXXXRLHNLLKNERSKCA-------RKIDAL---NKQLNASKN 110
                L+               +L +  KNE++K +       R+ D L    K+L  ++ 
Sbjct: 84   EMENLIKQNDGIRKERDDTCDKLESE-KNEKTKISNELESIKRRADDLIEEKKELQCNQQ 142

Query: 111  TITKLNDERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSL 170
               K+ DER   +E E+ ++++  +D       +E K LR  ++++E   Q   ++ L+ 
Sbjct: 143  RTLKILDERL--KELEIARSDNNRSD-------NECKRLRSTIIDLETKQQDLITSDLNS 193

Query: 171  KLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESV 230
            + + +   QE  ++     W+E++L  ++E+ L         +  +  +LN  ++D++  
Sbjct: 194  RAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVE 253

Query: 231  STNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSF 290
             T N  L  +N +LS S+++K+LEIK+L D ++ EK +FS E+ L++ + DLL SQL + 
Sbjct: 254  KTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAV 313

Query: 291  EKNY-SLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEA 349
            ++   S    E  ND     S+  ++V +L  TK +L + K EC RL +I+ +  EE  +
Sbjct: 314  KEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGETDEESGS 373

Query: 350  AFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKER 409
            +           ++  SD   LK+QLIKE+  K  LQNQ+ESFI ELE K P + SFKER
Sbjct: 374  S----------TSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKER 423

Query: 410  TESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLL 469
            T++LE EL N+  LLE  S  K    +EL++  +K+  CE +I +L+KQRLDL RQV+ L
Sbjct: 424  TDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYL 483

Query: 470  LLNISAVQKKASPLSNDELISLKKLLES-GDVPNEKDSQIIITERLVEFNNTNELQEKNM 528
            L+  S  +    PL  +E++ ++ +L++  D   E DSQ I+TERLVEF +  ELQEKN 
Sbjct: 484  LITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNT 543

Query: 529  ELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRE- 587
            ELL  VR LAD+LE++E +  +SL K+E++TI EAK+AI+ L+     LES+++ L +E 
Sbjct: 544  ELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKEC 603

Query: 588  RDSYKLLASANGNKIYADAANKTEAA-NLK-KIKELESELSLTKVENSAVVQRLNKELLT 645
             +S  LL++   + + +      E   NL+ +I++L+S +S    E++  +  LNKE+  
Sbjct: 604  ENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQD 663

Query: 646  CKKSQSNGQIALQEFSNFKVLAIEKENLLQTRIDDLKT---KLEKQRSSAPSSIHGSIGS 702
               S+S+  I L +  + ++LA E+  LL   +D  K    +L K+     S+I      
Sbjct: 664  LYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSK 723

Query: 703  EETELSQYKN-KTKSLMC--EISNLSKKNTDLRCMKE-SLTRDLERCCKEKMQLQMKLTE 758
             +  L++Y + K+K  +C  E+ NL K+   L+   E +L +++++   EK  L++ +T+
Sbjct: 724  TQETLNEYISCKSKLNICETELYNL-KEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQ 782

Query: 759  SETSHNEQKLKSDSKQVQYNTXXXXXXXXXXXXXXXXHSKVQEIETLQTSKNSQLKWAQN 818
             +T   E++   D  +  Y                    K Q I+ L+   NS ++W QN
Sbjct: 783  LQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQN 842

Query: 819  TIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETAL 878
             I+  +K+ +S+   +++K+  I KL  ++K LE E+ + K++     N  D    + +L
Sbjct: 843  KIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTY-NVIDGTINDDSL 901

Query: 879  KKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAK 938
            +KELE+S+I L DA+SQI+ Y+E+  T+  +LK+++ +  ++ ++   + ++L  E ++ 
Sbjct: 902  RKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSL 961

Query: 939  EEEISFLRRELDEIRG---LQPK-LKEGALRLVQQSEKLGNQTQRIQAMNEKID-KMTTI 993
            EE+IS L+ ++  +     LQ K +KE      ++   L N  + ++A+  + + K++ I
Sbjct: 962  EEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKI 1021

Query: 994  V-ELHQE---VETSQ--YQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELL 1047
              +L Q+     T+Q  Y+ +L+ + D+S  +  L  ++  Y+ ++     S +  +  L
Sbjct: 1022 QKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTL 1081

Query: 1048 DKHERKWMEEKADYERELISNIEQTESLRVENSALVEKIDDGTGENNG-----DKEYLKL 1102
             ++ER W  ++     +L S+  + E L  +N  L ++I+  T  + G     DK  L  
Sbjct: 1082 KENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALN- 1140

Query: 1103 VSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQCSTDII 1162
             S+  SLR ER+ L+TK+T  +RD  + +QK + ++  + + +     SR + +    II
Sbjct: 1141 -SILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTII 1199

Query: 1163 DEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKE 1222
             + EDIM+++ Q+N+L+E+N  L+  L+   E+   +  E   L+ +I+ ++ +LA  K 
Sbjct: 1200 QQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALKY 1259

Query: 1223 QVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISXXXXXXXXXXXXXX 1282
             +     ++ + + E+ +WK+R  ++ ++ ++    + EKL +EI               
Sbjct: 1260 SMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGA 1319

Query: 1283 XXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320
                 FNRL++QA E+L  SK     LT +V++LK+ K
Sbjct: 1320 EAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAK 1357

 Score = 71.6 bits (174), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 49/59 (83%)

Query: 1430 NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKL 1488
            N++ELK +W  ++EEE + RI+EAEE LKKRIRLP+EE+I KII +++E+LE+EF  K+
Sbjct: 1497 NIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKV 1555

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  388 bits (996), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 386/1303 (29%), Positives = 670/1303 (51%), Gaps = 125/1303 (9%)

Query: 87   LKNERSKCARKIDALN---KQLNASKNTITKLNDERGVKEEAEVLKAEHQNNDLERSALG 143
            L NE     RK++ L    K++ +++    K+ DER   +E E+ K E+       +   
Sbjct: 116  LSNELESVKRKLNDLTEEKKEIQSNQQRTLKILDERL--KEVEMAKVEN-------NRTN 166

Query: 144  HENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQLSFRDEKTL 203
            +E + LR  ++E+E   QT  +N L+ + + +   QE  L+  NK W+E++LS + E+ L
Sbjct: 167  NECRNLRSTVVELETKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYL 226

Query: 204  VDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVN 263
                   + +  +  +LNR +ND++   TNN  L  +N +LS+S+++K+L++KNL D++N
Sbjct: 227  SYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLN 286

Query: 264  IEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSAREKDN-----DDPCK-NSQHANVVD 317
             EK +FS E+ L++ + DLL +QL + ++    S R+ D+     DD  K  S++ +++ 
Sbjct: 287  TEKQEFSTEIALKQRLIDLLETQLNAVKEELK-SIRKSDSSNVTSDDSRKLISENESLLK 345

Query: 318  KLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIK 377
             L  TK +L + + EC RL +I  +  EE               ++  +D   LK+Q IK
Sbjct: 346  DLRLTKEKLAQCESECLRLSSITEETGEESGTL----------TSRSSTDFILLKKQYIK 395

Query: 378  ERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKE 437
            E+  K QLQNQ+ESFI ELE K P + SFKERT+ LE EL NS  LLE  S  K    +E
Sbjct: 396  EKRAKEQLQNQIESFIVELEHKVPVINSFKERTDMLENELNNSALLLEHTSNEKNAKIRE 455

Query: 438  LTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLES 497
            L    +KI  CE +IH L +QRLDL RQV+ LL+  S       PL  +E+  ++ +L++
Sbjct: 456  LNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQN 515

Query: 498  GDV-PNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLE 556
             +    E DSQ I+T RLVEF N  ELQEKN ELL   R LADKLE++E K  ++L K+E
Sbjct: 516  DNSGTTESDSQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQNLLKIE 575

Query: 557  NQTIKEAKDAIIELEHVNSTLESRI----DILSRERDSYKLLASANGNKIYADAANKTEA 612
            N+TI EAK+AI+ L+    +LES++          + S    AS+  N +      KT+ 
Sbjct: 576  NKTINEAKEAILSLQSEKMSLESKVEELERERETLKSSISKQASSFNNSVIQQLT-KTKR 634

Query: 613  ANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKEN 672
                ++++L++ +S    E++  +  LNKE+     S+S+  I L +  + ++LA E+  
Sbjct: 635  ELESQVQDLQARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFK 694

Query: 673  L--------------LQTRIDDLKTKLEKQRSSAPSSIHGSIGSE------ETELSQYK- 711
            L              L+ R D L++ + KQ S    +++  I  +      ET LS  K 
Sbjct: 695  LLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALSNLKL 754

Query: 712  ------NKTKSLMCEISNLSKKNTDLRCM----------KESLTRDLERCCKEKMQLQMK 755
                  +  KSL  E+  LS + T LR M          +E L  +  + C      Q K
Sbjct: 755  EQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQKEREDLLDEARKSC------QNK 808

Query: 756  LTESETSHNEQKLKSDSKQVQYNTXXXXXXXXXXXXXXXXHSKVQEIETLQTSKNSQLKW 815
            + E E ++NE K+++  K                          Q I  L+    S+++W
Sbjct: 809  INEVEEAYNELKVETSHKD-------------------------QHIMQLEEDNTSKIEW 843

Query: 816  AQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLE 875
             QN I+  +K+  S+   ++EK+T I KL  ++K LE E+++ K++     N  D    +
Sbjct: 844  YQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTY-NVMDETIND 902

Query: 876  TALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEEN 935
             +L+KELE S+I+L +A+SQI+ Y+++  +   +L+E+N +L ++ E    + QSL +E 
Sbjct: 903  DSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEK 962

Query: 936  NAKEEEISFLRR-------ELDEIRGLQPKLKEGALRLVQQSEKLGNQTQRIQAMNEKID 988
               E+++S L+        ELD  +    K K    +++     L N  + I+ +  + +
Sbjct: 963  INLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIA---ILQNNNKEIETVKSEYE 1019

Query: 989  -KMTTIVE------LHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLH 1041
             K++ I +      ++     + Y+ +L+ + D+S  +  L  ++  Y+ ++K    S  
Sbjct: 1020 SKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRS 1079

Query: 1042 STQELLDKHERKWMEEKADYERELISNIEQTESLRVENSALVEKIDDGTGENNGDKEYLK 1101
              + +L ++E+ W  +K     +L  +  + E L  +N  L  +I+  T   NG  +   
Sbjct: 1080 ELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARN 1139

Query: 1102 LVSL----FSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQC 1157
              +L      +LR ER+ L+TK+T  +RD  + +QK   ++  + D +     SR +   
Sbjct: 1140 GPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDE 1199

Query: 1158 STDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDL 1217
             + I+ + + IM+++ Q+N+L+E+N  L+  L+  ++KN+ +  E   L+  I+ ++ +L
Sbjct: 1200 RSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESEL 1259

Query: 1218 AQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISXXXXXXXXX 1277
            +  K  +     ++ + + E+ +WK+R  ++ ++ ++   ++ EKL +E+          
Sbjct: 1260 SALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDK 1319

Query: 1278 XXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320
                      FNRL++QA EKL  SK  Q  LT +++ELKD K
Sbjct: 1320 MQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAK 1362

 Score = 49.7 bits (117), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 102/364 (28%), Positives = 149/364 (40%), Gaps = 127/364 (34%)

Query: 1430 NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKL- 1488
            N++E+KKQW  ++EEE   R++EAEE LKKRIRLP+EE+I KII ++KE+LE+EF  KL 
Sbjct: 1502 NIDEMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFNEKLE 1561

Query: 1489 ---KANSGS----------FTLSSDKKENEVNAE---------DDLWNSPSKGNSEKPSV 1526
               K+ SGS            +   +K+ E+  E          ++ +S S   +EK  +
Sbjct: 1562 EKVKSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDEL 1621

Query: 1527 VTNLIRQKNLILQEQLKNPKKGII------------------------------SNDSRP 1556
               +  +    L ++L+N KK                                 S +S P
Sbjct: 1622 RAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESPP 1681

Query: 1557 TSSNKENDIPGSTTA-----ENKAPLAFNF---GKPL--FPSNTSSFQSFQNPFTPAA-- 1604
              +   N++P          E  +   FN    G+ L  F S +SS  +F NPFT  +  
Sbjct: 1682 KHA---NNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFNSKSSSSGAF-NPFTSPSPK 1737

Query: 1605 -----------TSFN-----TGVSPVFNIKPALAVDATVD------------TFKTPG-- 1634
                       TS N     T ++P FNI PA  V  +              T   PG  
Sbjct: 1738 KLLQKDDVQKETSNNKTDPPTHLAPSFNI-PATRVLTSSSSTLSTDTNDEELTVNEPGQK 1796

Query: 1635 -------LNDAGT---NEAKIIEIGN------NSLKRPI-----------ENEVSFDTDS 1667
                   L+  G+    E ++ EI N       S KRPI           E+   F  +S
Sbjct: 1797 ISSAINSLSQTGSEQNQEEELFEIKNIAEEKTKSNKRPIDEVAELKDDDDEDSAEFTNES 1856

Query: 1668 KKVK 1671
            KK+K
Sbjct: 1857 KKIK 1860

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  372 bits (954), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 381/1376 (27%), Positives = 694/1376 (50%), Gaps = 92/1376 (6%)

Query: 8    YLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKS-----------QYY 56
            +L + S  L  V+  ++  +  +  +F++ + E  R +V +DE++S           Q +
Sbjct: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 57   TRISKLNELLGXXXXXXXXXXXXXXRLHNLLKNERSKCARKIDALNKQ---LNASKNTIT 113
              + +L  L G                   L +  +   RK +AL +Q   L +SKN + 
Sbjct: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRK-EALEQQKQALESSKNDVA 140

Query: 114  KLNDERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLK 173
            +L +E+     +E+   + + +DL       EN+ LR++ L++E+  +  KS  L  K +
Sbjct: 141  RLLNEKI----SELSSFKQEADDL-----MQENRRLRQQTLDLESESRVSKSEDLQRKAE 191

Query: 174  YDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTN 233
               + QE  L   N +W+E QL  ++ +      T  S +  L ++L   + + ++ +  
Sbjct: 192  LHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRT 251

Query: 234  NQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKN 293
            N+ L   N ++++ +E ++  +K L D +N EK +F++EM+L++ + DLL  Q+ S + +
Sbjct: 252  NKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSD 311

Query: 294  YSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAF-- 351
              L +   + DD   ++    + ++L     QLE+S+ + Q+L+  V D +  D+ +   
Sbjct: 312  LELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLK 371

Query: 352  DNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTE 411
             + H    SV  ++ DI  LKRQ+I E+ QK  LQNQ+E+F+ ELE K P L SFK+R +
Sbjct: 372  SSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRND 431

Query: 412  SLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLL 471
             LE++L  +  +LE+IS  K     +L   + +I++ E  I  L +QR DLARQV+ LL+
Sbjct: 432  MLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLI 491

Query: 472  NISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELL 531
              S       PL+ +E+  ++++LE GD+  E+D+Q +I+ERLVEF +  ELQ KN +LL
Sbjct: 492  QASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLL 551

Query: 532  NCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSY 591
              +R LADKLE+ E +       +EN  I+EAK+AII L+     LESRI++L++ERD+Y
Sbjct: 552  RTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAY 611

Query: 592  KLL--ASANGNKIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKS 649
            K +  ++ NGNKI   A   ++     ++ +LE  L   + E    ++ LN E+    + 
Sbjct: 612  KAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQ 671

Query: 650  QSNGQIALQEFSNFKVLAIEKENL--------------LQTRIDDLKTKLEKQRSSAPSS 695
            ++   I +++    K LA E+  +              L  R   ++  L KQ +    +
Sbjct: 672  KTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQET 731

Query: 696  IHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMK 755
            +   I   +++L+  +++ KS + +I +LS       C K++ T  +E+   E+  L + 
Sbjct: 732  LSCLIEC-QSKLATLESELKSSVAKIESLSS------CQKKN-TESIEQLTAERNNLTIL 783

Query: 756  LTESETSHNEQ-KLKSDSKQVQYNTXXXXXXXXXXXXXXXXHSKVQEIETLQTSKNSQLK 814
            +T+ +T   E+ KL +++++  Y                    K +E      + +S+ +
Sbjct: 784  VTQLQTLQGERDKLLAETEK-SYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQ 842

Query: 815  WAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQ--KTKLQ-YKLLNNSSDA 871
            W Q  ID   + +K +++ L  +  T R L  + K LE  L+  +TK Q Y +LN + D 
Sbjct: 843  WYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDV 902

Query: 872  NTLETALKKELERSQIDLKDAHSQIEAY-------EEIISTDENTLKELNDQLTKTKEEL 924
                 AL+ ELE+S+I L+DA+SQIE +       EE +S   N  +   ++ +K    +
Sbjct: 903  LAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNM 962

Query: 925  KVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLKEGALRLVQQSEKLGNQTQRIQAMN 984
            K K   L  +  A + +IS L  EL    G Q K      +   +  +L NQ   +Q+  
Sbjct: 963  KKKEDELVGQVEALKHQISNLNNEL----GHQKK------QFDSEKNELENQLVSLQSTQ 1012

Query: 985  EKIDKMTTIVE---------LHQEVETS-----QYQAKLKANKDLSALVLRLENEVLDYQ 1030
            E ++ M    E         L+Q+   +      Y+ +L+ + D+S  + +L  E   Y+
Sbjct: 1013 ETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYK 1072

Query: 1031 TELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSALVEKID--- 1087
             +    +SS+   ++ LD+ + KW+ +K +YE +L S  ++ E L V+N  L++++D   
Sbjct: 1073 NQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEA 1132

Query: 1088 -DGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQ 1146
             D   E    +   K+  L +SLR ER+ L+TKL   KR   ++ +K   +E+ ++   +
Sbjct: 1133 KDPNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELS-FAK 1191

Query: 1147 THLVSRKDVQCSTDII-DEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTS 1205
              L S + +     I+ DE   +++++ Q+N+L+E+N  L+  ++K T++ + +  +  +
Sbjct: 1192 EELSSLQALSSQNSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDN 1251

Query: 1206 LQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFN 1265
            LQ  +  L+ +LA  K  V    +++ +   E  +WKQR  ++  + +    +E +KL  
Sbjct: 1252 LQQSLQPLESELASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGE 1311

Query: 1266 EISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELKDMKN 1321
            E+S                   F RLKKQA E+LDA+K  Q  L+ E+ + ++ ++
Sbjct: 1312 ELSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQS 1367

 Score = 74.7 bits (182), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/92 (47%), Positives = 57/92 (61%), Gaps = 16/92 (17%)

Query: 1415 EATGKNTGATIENGENMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIIS 1474
            E  GK+T   IE       LKKQW + YE++T++RI+E+ E L+KRIRLP+EE+I KI+ 
Sbjct: 1516 EENGKHTPVDIET------LKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVE 1569

Query: 1475 KRKEELEQEFQRKL----------KANSGSFT 1496
             RK ELEQEF+ KL          K    SFT
Sbjct: 1570 TRKSELEQEFEAKLQKRASELANEKPQPASFT 1601

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  359 bits (922), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 381/1269 (30%), Positives = 673/1269 (53%), Gaps = 70/1269 (5%)

Query: 94   CARKIDALN---KQLNASKNTITKLNDERGVKEEAEVLKAEHQNNDLERSALGHENKLLR 150
              RK+D L    K+  +++    K+ DER   +E E+++ E  NN   RS    E K LR
Sbjct: 123  VKRKLDDLTEEKKETQSNQQRTLKILDERL--KEIELVRVE--NN---RS--NSECKKLR 173

Query: 151  RKLLEMENILQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRT 210
              ++++E   Q   +N L+ + + +   QE  L+  N  W+E++L  ++E+ L       
Sbjct: 174  STIMDLETKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTD 233

Query: 211  SHVQNLEEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFS 270
              + ++  +LNR +ND++   TNN  L  +N +LS S+++K+LEIK L D++N EK +FS
Sbjct: 234  KVILDIRNELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFS 293

Query: 271  KEMTLQKNMNDLLRSQLTSFEKNYSLSAREKDN-----DDPCKNS-QHANVVDKLIDTKL 324
             EM+L++ + DLL SQL + ++  + S RE +      DD  K + ++ +++ +L  TK 
Sbjct: 294  AEMSLKQRLVDLLESQLNAVKEELN-SIRELNTAKVIADDSKKQTPENEDLLKELQLTKE 352

Query: 325  QLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQ 384
            +L + + EC RL +I       DEA  DN  N+     K  SD   LK+QLIKER  K  
Sbjct: 353  KLAQCEKECLRLSSIT------DEADEDN-ENLSA---KSSSDFIFLKKQLIKERRTKEH 402

Query: 385  LQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQK 444
            LQNQ+E+FI ELE K P + SFKERT+ LE EL N+  LLE  S  K    KEL +  QK
Sbjct: 403  LQNQIETFIVELEHKVPIINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQK 462

Query: 445  INNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGD-VPNE 503
            +  CE ++ +L KQRLDL RQ++ LL+  S       PL  +E+  ++ +++  D    E
Sbjct: 463  LVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITE 522

Query: 504  KDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEA 563
             DSQ ++TERLVEF N  +LQEKN ELL  VR LADKLE+ E K  +SL K+E++T+ EA
Sbjct: 523  SDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEA 582

Query: 564  KDAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANK----TEAANLKKIK 619
            K+AII L+     LESRI+   ++       +  N +  Y++   K    T+     +++
Sbjct: 583  KEAIITLKSEKMDLESRIEE-LQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQ 641

Query: 620  ELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQTRID 679
            +L++ +S    E++  +  LNKE+     S+S+  I L +  + ++LA E+  LL   +D
Sbjct: 642  DLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLD 701

Query: 680  DLKT---KLEKQRSSAPSSIHGSIGSEETELSQY---KNKTKSLMCEISNLSKKNTDLRC 733
              K    +L K+     ++I          L++Y   K+K   +  E+ NL K+   LR 
Sbjct: 702  LTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNL-KEEQKLRV 760

Query: 734  -MKESLTRDLERCCKEKMQLQMKLTESETSHNEQK--LKSDSKQVQYNTXXXXXXXXXXX 790
             ++++L ++L +   EK  L++ +T+ +T   E++  L+   K  Q              
Sbjct: 761  HLEKNLKQELNKLSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELK 820

Query: 791  XXXXXHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKD 850
                   K   I+ L+   NS ++W QN I+  +K+ +S+ T +  K+T I KL  ++K 
Sbjct: 821  KETSQ--KDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKS 878

Query: 851  LEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTL 910
            LE E+++ K++     N  D    + +L+KELE+S+I+L DA+SQI+ Y+++  T   +L
Sbjct: 879  LEKEIEEDKIRLHTY-NVMDETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSL 937

Query: 911  KELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRR-------ELD-EIRGLQPKLKEG 962
            ++ N +L ++ ++   + ++L +E  + E++IS L+        ELD + +G++ +  + 
Sbjct: 938  QQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADF 997

Query: 963  ALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVE-------LHQEVETSQYQAKLKANKDL 1015
              R+      L N  + ++A+  + +   + ++       ++     + Y+ +L+ + D+
Sbjct: 998  KKRI----SILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADV 1053

Query: 1016 SALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESL 1075
            S  +  L  ++  Y+ ++K    S    +  L ++E+ W  +K     +L  +  + E L
Sbjct: 1054 SKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDL 1113

Query: 1076 RVENSALVEKIDDGTG---ENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQ 1132
              +N  L ++I   T    E N       L ++  +LR ER+ L+TK+T  +RD  + +Q
Sbjct: 1114 SSQNKLLYDQIQIYTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQ 1173

Query: 1133 KNANLEKSVNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKV 1192
            K + ++  + D +     SR + +  + II + +DIM+++ Q+N+L+E+N  L+  L+  
Sbjct: 1174 KISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENN 1233

Query: 1193 TEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQ 1252
              K + +  E   L+  ++ ++ +L   K  +     ++ + + E+ +WK+R  ++ ++ 
Sbjct: 1234 NNKKKELQSELDKLKQNVAPIESELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKH 1293

Query: 1253 KETHKDETEKLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNE 1312
            ++    + EKL +EI                    FNRL++QA E+L  SK  Q +LT +
Sbjct: 1294 EQLSSSDYEKLESEIENLKEELENKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQ 1353

Query: 1313 VDELKDMKN 1321
            V+ L+D KN
Sbjct: 1354 VNSLRDAKN 1362

 Score = 60.8 bits (146), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/44 (63%), Positives = 38/44 (86%)

Query: 1430 NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKII 1473
            NMEE+KK+W  ++E+E  ++I+EAEE LKKRIRLP+EE+I KII
Sbjct: 1501 NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKII 1544

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  347 bits (889), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 371/1389 (26%), Positives = 691/1389 (49%), Gaps = 118/1389 (8%)

Query: 2    EDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRIS- 60
            ED ++ +L +  ++L  V+ ++   +  +I +F++ + E  + +V IDE++S    ++  
Sbjct: 18   EDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGA 77

Query: 61   ---KLNELLGXXXXXXXXXXXXXXRLHNL-LKNERSKC----ARKI----------DALN 102
               +++ LL               R  NL L+  R++C     R I          +AL 
Sbjct: 78   CKDQIHSLL---------QEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALE 128

Query: 103  KQ---LNASKNTITKL-NDERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMEN 158
            +Q   L A+KN + +L N++ G   +   L+ E +        L  E + LR++ LE+E 
Sbjct: 129  QQKQVLEANKNDVAQLLNEKIG---DIATLQQETER-------LLQEARTLRQQNLELEG 178

Query: 159  ILQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEE 218
              +  KS  L  K  +  + Q+  L+  N +W+E QL+ ++ +         S + ++ +
Sbjct: 179  QARVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQ 238

Query: 219  QLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKN 278
            +L   + D ++ +   + L  QN Q    +E +   +K L D +   K +F++EM+L++ 
Sbjct: 239  RLETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQR 298

Query: 279  MNDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQN 338
            + +LL  Q+++ +         + + D       + + D+L+    QLE+S+ + Q+L+ 
Sbjct: 299  LVELLEGQVSALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQ 358

Query: 339  IVADCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELER 398
             V   +  DE     +     S+  +++DI  LK+Q+I ER QK  LQNQ+E+F+ ELE 
Sbjct: 359  TVEQLLSADEKTISGSQ----SLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELEN 414

Query: 399  KTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQ 458
            K P L SFK+R + LE+EL  +  +L++IS  K +   +L   + +I + E+ I +L +Q
Sbjct: 415  KVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQ 474

Query: 459  RLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFN 518
            R DLARQV+ LL+ ++       PLS +E   +KK++   +   + D+Q II+ERLVEF 
Sbjct: 475  RSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFK 534

Query: 519  NTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLE 578
            N  ELQ KN +LL+ VR LA++LE  E K       +EN TI EAK+AI+ L+     LE
Sbjct: 535  NIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELE 594

Query: 579  SRIDILSRERDSYKLLAS------ANGNKIYADAANKTEAANLKKIKELESELSLTKVEN 632
            +RID+++RERD+YK + S      +NG  +    A  +E ++L KI+ELE  LS  K E 
Sbjct: 595  TRIDVITRERDAYKAIQSQTSHEGSNGG-LRDVNAKASENSDL-KIRELEELLSAAKREA 652

Query: 633  SAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLA-----IEKENLLQTRIDD------- 680
             A V+ L  E     +S+S   + +++  + ++LA     I K +LL T+ ++       
Sbjct: 653  EANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRG 712

Query: 681  --LKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESL 738
              L+  L KQ +    +I        +EL   K++  +L  E+ N   K   L    + L
Sbjct: 713  LVLENNLAKQDTRTQETI--------SELIDCKSQLATLSAELKNSIAKENLLNTSHQKL 764

Query: 739  TRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTXXXXXXXXXXXXXXXXHSK 798
                E+  KE+ +L + +T+ +T   E+          +                    K
Sbjct: 765  KETNEQLTKERNELTILVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQK 824

Query: 799  VQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQ-- 856
              E+    ++ +S+ +W Q  ID   + +KS ++DL+ K   I++L  +   L  +L+  
Sbjct: 825  ATELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDA 884

Query: 857  KTKLQ-YKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELND 915
            +TK Q Y +LN + D  T   AL+ ELE+++I+LKDA SQ++ Y+ + ++ + TL  +  
Sbjct: 885  ETKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTT 944

Query: 916  QLTKTKEELKVKSQSLDEENNAKEEEISFLR-------RELDEIRGLQPKLKEGALRLVQ 968
             L  +K++  ++ ++L +E +A   + + L+        ELD  + L   LK    +  +
Sbjct: 945  ALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEE 1004

Query: 969  QSE-------KLGNQTQ-RIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVL 1020
            + +        + +Q Q  +  + E +++        QE     Y+ +L+ + D+S  + 
Sbjct: 1005 EVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQE----NYEQELQRHADVSKTIS 1060

Query: 1021 RLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENS 1080
            +L  E   ++ ++   ++S+   ++ L+++E  W  +K +YE +   + ++ E L  +N 
Sbjct: 1061 QLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNR 1120

Query: 1081 ALVEKID----DGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNAN 1136
             L ++I     D    N+  K   +   L S+L+ E + L+TKL   KRD        +N
Sbjct: 1121 LLFDQISLKDTDSIPINDELKSEAR--ELISTLKRECDILQTKLELAKRD-------ESN 1171

Query: 1137 LEKSVNDMQQTHLVSRKDV---QCSTD----IIDEFEDIMKEIAQVNILKENNTILQKSL 1189
            L++ +   +Q   V++ ++   Q ++D    +I+E   I++++ QVN+L+E+N  L+  L
Sbjct: 1172 LKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNEL 1231

Query: 1190 KKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLS 1249
            ++ +++N+ + +    LQ  +  L+ D+   +  V     ++ +   E+ +WKQR  ++ 
Sbjct: 1232 QRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDIL 1291

Query: 1250 QQQKETHKDETEKLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTAL 1309
             + +    +E +KL  E+S                   F RLKKQA E+LD ++  Q  L
Sbjct: 1292 LKYERVDPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTL 1351

Query: 1310 TNEVDELKD 1318
              E+ E ++
Sbjct: 1352 NAELTEARE 1360

 Score = 71.6 bits (174), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/60 (56%), Positives = 50/60 (83%)

Query: 1430 NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLK 1489
            ++E LKK+W ++YE+ T++RI+EA E L+KRIRLP+EE+I KII  RK EL++EF+ KL+
Sbjct: 1522 DIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQ 1581

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  323 bits (827), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 364/1264 (28%), Positives = 612/1264 (48%), Gaps = 137/1264 (10%)

Query: 136  DLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQL 195
            +LER  LG  NK LRR  +E+E  +Q+ +S +L  + +   + QE  L+  N +W   QL
Sbjct: 152  ELER-VLGV-NKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQL 209

Query: 196  --------SFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQNKQLSHS 247
                    S+R EKT          +Q+ + +LN  +N+ E    N   L ++N +LS  
Sbjct: 210  NEKNQQLNSYR-EKT-------NGEIQSTQVELNIVKNELEVEHANVAALRSKNGELSKQ 261

Query: 248  MEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTS----FEKNYSLSAREKDN 303
            ++  + E K L D+++ EK +F++EM L++ + +LL  Q+ +     EK Y ++      
Sbjct: 262  LQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAYDVA-----K 316

Query: 304  DDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVD----- 358
            +    +S+   +++ L DTK +LE S+    RL++ + + +E D       + ++     
Sbjct: 317  NGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVG 376

Query: 359  -PS----VNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESL 413
             PS    ++ V+ D+ AL++QL++ER  K +LQ Q+ESF+ ELE K P L SFK+R E L
Sbjct: 377  SPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEEL 436

Query: 414  EQELKNSTDLLETISLAKRKDEK--ELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLL 471
            E++L   T LLE    A+ +DEK  ++   + K+ + E  +  LV+QR DLARQV+ LL+
Sbjct: 437  EKQLNGVTLLLEAT--ARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLI 494

Query: 472  NISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELL 531
            +IS     + PL+ +E+  +KKL    D     D+Q II+ RLVEF +  ELQ+KN ELL
Sbjct: 495  HISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELL 554

Query: 532  NCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIEL-EHVNSTLESRIDILSRERDS 590
            N +R LA KLE  E K    +  LE  T+ EAK+AI+ L EHV   LE +++ ++ ERDS
Sbjct: 555  NAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQ-MLEDQLETVTTERDS 613

Query: 591  YKLLASAN-----GNKIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLT 645
            +KLL S        N + A A    E A+   I  LE+ L     E+    + LN+E+  
Sbjct: 614  FKLLVSEGKNNSLPNPVGAAALQPQEVAD--GIAHLEARLKAMAEESEQHAKMLNEEIKA 671

Query: 646  CKKSQSNGQIALQEFSNFKVLAIEKENL--------------LQTRIDDLKTKLEKQRSS 691
              KS S   I L+   + + LA EK +L              LQ R   L+  L +Q + 
Sbjct: 672  LYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTR 731

Query: 692  APSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESLTRDLERCCKEKMQ 751
              S+I   + S ++EL    ++   L  E   L K   DL+   ESL +D      + + 
Sbjct: 732  RQSTIEEFV-SAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKD--NNDSQLLI 788

Query: 752  LQMKLTESETSHNEQKLKSDSKQVQYNTXXXXXXXXXXXXXXXXHSKVQEIETLQTSKNS 811
            LQ+K     T+  E+    +  + +Y T                  K +E + L +S ++
Sbjct: 789  LQLK-----TAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSST 843

Query: 812  QLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQK--TKLQYKLLNNSS 869
            Q KW Q+ +D       SL  +L   K  ++  + E+  L+  L    +KL+   +++  
Sbjct: 844  QCKWFQSKLD-------SLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQ 896

Query: 870  DANTLET-------ALKKELERSQIDLKDAHSQIEAYEEIISTDENT------------- 909
             +  LE+       +L K+L+ +   L  A+S+IE Y+   +  E               
Sbjct: 897  SSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDG 956

Query: 910  -----------LKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPK 958
                       L +LN  +    + +KV    L++E N +E   S  R EL E       
Sbjct: 957  SKQAAISLEAELTKLNSDIAMANDRIKV----LEDELNRREATYSTERSELQE------- 1005

Query: 959  LKEGALRLVQQ--SEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLS 1016
             K  AL   +Q   E   +  Q+I  +   ++K  +      E ET +YQ  L+   ++S
Sbjct: 1006 -KINALVTDKQRIEEAKADYQQKITQLQTDLEKQISST---NEAET-KYQTALQKQAEIS 1060

Query: 1017 ALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLR 1076
              +  L      Y++E+ K KS+    +++L+++E+ W ++KAD E  L    ++ E L 
Sbjct: 1061 ENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELS 1120

Query: 1077 VENSALVEKIDDGTGENNGDKEYLKLVS-----LFSSLRHERNTLETKLTTCKRDLALAK 1131
             +N  L ++I+  +   +   E    +S     L  +LR ER+ LETK+   KR+  + +
Sbjct: 1121 TQNRLLYDQIELLSRSPSSSLEPDTKISSDARELIVTLRRERDILETKIDVSKREEKMLR 1180

Query: 1132 QKNANLEKSVNDMQQTHLVSRKD-VQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLK 1190
            Q+   L KS  D  +  L   K  V   TD     E++ +++ Q+N+L+E+N  L+   +
Sbjct: 1181 QR-LELTKSELDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESE 1239

Query: 1191 KVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQ 1250
            KV+E NE +  E  SLQ ++  ++  +      ++    K+ + + E ++WKQR  ++  
Sbjct: 1240 KVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILH 1299

Query: 1251 QQKETHKDETEKLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALT 1310
            + +    +E  KL +EI                    F +L+KQA+E+LD  K  +  + 
Sbjct: 1300 KYERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVE 1359

Query: 1311 NEVD 1314
            +E++
Sbjct: 1360 SELE 1363

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 111/219 (50%), Gaps = 31/219 (14%)

Query: 1413 LEEATGKNTGATIENG-ENMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQK 1471
            LEE     T  ++E   +N+E LKK+W ++YE++T++RI+EAEE LKKRIRLPSEERI +
Sbjct: 1513 LEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQ 1572

Query: 1472 IISKRKEELEQEFQRKLKANSGSF------TLSSDK----KENE---VNAEDDLWNSPSK 1518
            +I ++++ LEQEF  K+ A + +       +++SDK    K+++   V  + DL +    
Sbjct: 1573 VIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQKEIVQLKKDLADKFEG 1632

Query: 1519 GNSEKPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRPTSSNKENDIPGSTTAENKAPLA 1578
               +         RQ+ ++  + L++    + S    P  +N    +P     EN  PLA
Sbjct: 1633 QLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAKAPLGTN----VPTKIPLENTQPLA 1688

Query: 1579 FNFGKPLFPSNTSSFQSFQNPFTPAATSFNTGVSP-VFN 1616
                 P+ PS          PF  A      G  P +FN
Sbjct: 1689 QQV--PVKPS----------PFQLAYAQATFGNVPFLFN 1715

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  316 bits (809), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 368/1412 (26%), Positives = 715/1412 (50%), Gaps = 138/1412 (9%)

Query: 2    EDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISK 61
            E +I+ +L+V   +++ +   +  A+  + ++F + + +  R NVL++E K+   ++  K
Sbjct: 6    ESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEK 65

Query: 62   LNE----LLGXXXXXXXXXXXXXXRLHNLLKNERSKCARKIDALNKQLNASKNTITKLND 117
            L E    ++               ++ +L  ++ SK A +I+ L       +N I + N+
Sbjct: 66   LKEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLA-EINQLKTSNEGLQNNIDRANE 124

Query: 118  ---ERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKY 174
               E     + +V + EH  +  E+  L  + K L  K+LE+E   Q  +S+ L+ K + 
Sbjct: 125  RYKELNGSYDEKVTELEHIRD--EKKELQTQIKTLNDKILELELKCQEYQSSELNRKSEL 182

Query: 175  DTVVQEKELILENKKWMEEQLSFRDEKTLV----DDVTRTSHVQNLEEQLNRTQNDYESV 230
            +   QE  L+ +N++W+E++L+ +++  +      D+     V N+E    + ++D +  
Sbjct: 183  ERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVE----KLKSDLKIE 238

Query: 231  STNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSF 290
             ++ + L  +  + +  ++  ++E K+LKD + +EK +F KE++++  +  L  +Q+ S 
Sbjct: 239  KSSKEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSL 298

Query: 291  E-----KNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIV----- 340
            E     K  +  A E+++ +  K+     + ++L   + +L+  +++C RL++I+     
Sbjct: 299  ESTLQQKFKTAEANEENSSEVVKS-----LKEELSLAERKLQDMEEKCVRLESILDHDSN 353

Query: 341  -----------------ADCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKF 383
                                  ++  +FD++     S++++  DIK LKRQL++E+ QK 
Sbjct: 354  DVSLQTKGRKRTYSNDSNSNSSDELGSFDDSS---ISLSRMQGDIKILKRQLVQEKRQKE 410

Query: 384  QLQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQ 443
            +LQNQ+ESF+ ELE K P + SF+ERT  LE+EL ++  LLE  +        EL SL++
Sbjct: 411  KLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKK 470

Query: 444  KINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNE 503
            KI++  + +  L++QR DLA Q++ LL+NIS +      L+ DE+  +K L+ + ++ + 
Sbjct: 471  KISDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMAST 530

Query: 504  KDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKS---LAKLENQTI 560
             DSQ +I+E L++F +  +LQEKNMEL+  VR LA +LE +E K+  +       +N+  
Sbjct: 531  NDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIF 590

Query: 561  KEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKTEAANLKK--- 617
             EAK+AI+ LE VN  LE  + I+++ERD++KLL S +  + +  + +  +   LK    
Sbjct: 591  AEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNE 650

Query: 618  --IKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLA-------- 667
              +K+LE+ L+    +++A  + L +EL    K  S   + ++++ + K LA        
Sbjct: 651  TVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQ 710

Query: 668  -----IEKEN----LLQTRIDD--LKTKLEKQRS--------SAPSSIHGSIGSEETELS 708
                 + KEN    +  +R++D  L+   E Q++        S  SS+  S+ + ETE++
Sbjct: 711  NSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVT 770

Query: 709  QYKNKTKSLMCEISNLSKKNTDLRCMK---ESLTRDLERCCKEKMQLQMKLTESETSHNE 765
              K++  SL  E+SN +++ T LR M    +SL  + E    E++Q   K   SE ++  
Sbjct: 771  LLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLL-ERVQSDFKKRISEVNYIN 829

Query: 766  QKLKSDSKQVQYNTXXXXXXXXXXXXXXXXHSKVQEIETLQTSKNSQLKWAQNTIDDTEK 825
            +KL    KQ+                      +V EI+ ++  +N+Q +W Q  ID+  +
Sbjct: 830  EKL---DKQL--------------------SERVHEIDKIEKERNAQYEWYQKKIDEASQ 866

Query: 826  NMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQ---YKLLNNSSDANTLETALKKEL 882
              + +   L  K   + +L L+ K LE EL+  +++   Y+ +N ++  N  E  + KEL
Sbjct: 867  QQQQIQGQLQTKNDELERLHLQNKTLEKELEGAQIRIHTYETINQNNSENQEENDVIKEL 926

Query: 883  ERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEI 942
            E+++I+L DA+SQ+E ++ +    E+ LKELN        + +   ++L EE    E   
Sbjct: 927  EKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRF 986

Query: 943  SFLRRELDEIRG---LQPKLKEGAL-RLVQQSEKLGNQTQRIQ----AMNEKIDKMTTIV 994
              L+++L+ I+    +Q +  E    RL Q   +L    Q I+       EK+ K+   +
Sbjct: 987  EILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDL 1046

Query: 995  E---LHQEVETSQYQAKLKANKDLSALV--LRLENEVLDYQTELKKTKSSLHSTQELLDK 1049
            E   ++       Y+ +L+ + D+S  +  LR +N+ L   T  K   + L S Q+ + +
Sbjct: 1047 EEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDT--KSLTAELQSLQDQMSQ 1104

Query: 1050 HERKWMEEKADYERELISNIEQTESLRVENSALVEKID-----DGTGENNGDKEYLKLVS 1104
            +E+    E+ +Y  ++    ++ + +  +N  L  +ID     +   EN+ D E     +
Sbjct: 1105 NEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTA 1164

Query: 1105 LFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQCSTDIIDE 1164
            L  SLR ER+ L+TK+   + +    +QK  +++  + + +++  +   +    +D+I+ 
Sbjct: 1165 LVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINN 1224

Query: 1165 FEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQV 1224
            ++ I  ++ Q+N+L+E+N  L+  LK+  ++ + I K+    + E+  LQ +L      +
Sbjct: 1225 YQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLI 1284

Query: 1225 SVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISXXXXXXXXXXXXXXXX 1284
                 K+     E ++WK R + + ++ ++ + D+  KL   ++                
Sbjct: 1285 KEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNEL 1344

Query: 1285 XXXFNRLKKQAHEKLDASKKQQTALTNEVDEL 1316
               FNRLKKQAHEKL+ SK+ Q++L  ++  L
Sbjct: 1345 NDRFNRLKKQAHEKLNTSKELQSSLQEQISNL 1376

 Score = 76.6 bits (187), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 103/226 (45%), Gaps = 24/226 (10%)

Query: 1430 NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLK 1489
            ++E L+KQW +  EE   +RI EAE+NLKKRIRLPSEE+I KII KR+ ELE EF +K++
Sbjct: 1529 DVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIR 1588

Query: 1490 ANSGSFTLSSDKKE--NEV----------NAEDDLWNSPSKGNSE---KPSVVTNLIRQK 1534
              +    ++    E  NE+            ED+L  +  K   E   + ++ T L+ +K
Sbjct: 1589 DKARDLLMNDHSNEFNNELKEALEKELKERFEDELQAARKKAFEEGKQQATMKTTLLERK 1648

Query: 1535 NLILQEQLKNPKKGIISNDSRPTSSNKENDIPGSTTAENKAPLAFNFGKPLFP-SNTSSF 1593
               L+ Q++  +K     DS  T   K  +   ST +  K P   N     F  SN    
Sbjct: 1649 IQKLESQIQEKEK-----DSEETQDVKPEE--NSTPSVKKIPETLNSSDTSFGNSNNVKV 1701

Query: 1594 QSFQNPFTPAATSFNTGVSPVFNIKPALAVDATVDTFKTPGLNDAG 1639
                +PF   +   N          PA A  A   TFK       G
Sbjct: 1702 LKPSSPFGATSAFNNPFTFNNNGNPPAFA-SAFAPTFKDLMSGQGG 1746

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  304 bits (779), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 379/1412 (26%), Positives = 685/1412 (48%), Gaps = 151/1412 (10%)

Query: 4    KISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQ-------YY 56
            +++++L V  + +Q +N  +L  + ++++   + + E  R+   +D++KSQ       + 
Sbjct: 9    RVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFK 68

Query: 57   TRISKLNELLGXXXXXXXXXXXXXXRLHNLLKNER-----SKCARKIDALNKQLNASKNT 111
              IS+L + L               RLH   +  R     S+  ++I  L +++      
Sbjct: 69   IHISQLAKAL---------EDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEV---- 115

Query: 112  ITKLNDERGVKEEAEVLK---AEHQNNDLER---------SALGHENKLLRRKLLEMENI 159
                  ER  KE A+  K   AE  N  +E           A G  NK LR+K++  E  
Sbjct: 116  ------ERQQKELADASKQDIAESLNEKIEELSSTKAKLNEAQGA-NKELRQKVVNTETE 168

Query: 160  LQTCKSNTLSLKLKYDTVVQEKELIL--ENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLE 217
            LQT ++  L L+ K + +  E+E+ L  EN  W+  QL   + KT+  +  R S +  L+
Sbjct: 169  LQTQQA--LELRSKSEILRMEQEITLLRENNDWLTNQL---NTKTVQLNEFRESTISELQ 223

Query: 218  E---QLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMT 274
            +   +++  +++ E   T+NQ L      L   +EQK+ E K +KD  N  K + +KEM+
Sbjct: 224  DSQLKVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMS 283

Query: 275  LQKNMNDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQ--HANVVDKLIDTKLQLEKSKDE 332
            L++ M D L   + S +K    +   K+N D    ++     ++++L   K +L+ S+  
Sbjct: 284  LKQRMIDALEKHMESLKKEMDAT---KNNMDSSYFTEKERDELIEELNAVKYRLDASESN 340

Query: 333  CQRLQNIVADCIE----EDEAAFDNTHNVDPSVN---KVFSDIKALKRQLIKERNQKFQL 385
            C +L+  + +       ED    + T + + SV+   K++ D+  LK+QL+ E+ QK +L
Sbjct: 341  CIKLKETIDELTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDEL 400

Query: 386  QNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEK--ELTSLRQ 443
            + Q+E+F+ ELE K P L SFKER+E LE+EL   T LLE  S  K +D+K  +L  L+ 
Sbjct: 401  KMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLE--STGKDRDQKSSQLDYLKA 458

Query: 444  KINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNE 503
             + + E  I SL KQR+DLA Q++ LL+N S   +   PLS +EL  +K L  S ++   
Sbjct: 459  TVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKT 518

Query: 504  KDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEA 563
             D+Q IIT+RLVEF +  ELQ+KN ELL+ +R LAD+LE  E +    +  LE++T++EA
Sbjct: 519  SDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREA 578

Query: 564  KDAIIELEHVNSTLESRIDILSRERDSYKLLA-SANGNKIYADAANKTEAANLKKIKELE 622
            K+ I+ L      LE+++ ILS+ERD+YK L+ +A+       A       N  K+K+LE
Sbjct: 579  KETILTLHDHAQNLENQLVILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLE 638

Query: 623  SELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFS-NF------KVLAIEKENLLQ 675
            + L       +AV+Q             SN +  L E S NF      + LA ++ NLLQ
Sbjct: 639  TRL-------TAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQ 691

Query: 676  TRIDDLKTKLE--KQRSSAPSSI--HGSIGSEETELSQYKNKT--KSLMCEISNLSKKNT 729
            + ++  K + E  ++RSS    I       ++ET  S  K K+   S+  E+S L  +  
Sbjct: 692  STLELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQ 751

Query: 730  DLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTXXXXXXXXXX 789
             +  +++ L  + ER  KE ++ ++ + + +T   E+++     Q  Y            
Sbjct: 752  FMAKVQKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELS 811

Query: 790  XXXXXXHSKVQEIE----TLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKL- 844
                    +++EIE     + ++K  Q  W Q  ID          T L EK+  ++K+ 
Sbjct: 812  GSLE----RLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQ 867

Query: 845  ------SLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEA 898
                  S ++K+ E   Q     Y +L+N  DA  L   L++ELE+  + L D++SQIE 
Sbjct: 868  STINEQSAKLKEAEARAQS----YTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEH 923

Query: 899  YEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPK 958
            ++ +      ++ E++    + ++E +    +L+ E N  +  ++ L    D+++ L  +
Sbjct: 924  HKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILN---DQVKDLNNE 980

Query: 959  LKEGALRLVQQSEKLGNQTQRIQAMNEKIDKMTT-----IVELHQEVETS---------Q 1004
            +         +      +  ++Q + E +D+        I  + +++E            
Sbjct: 981  IFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRS 1040

Query: 1005 YQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERE 1064
            Y+ +L+ + D+S  +  L  E   Y+++L+  K+      E L   E+ W E+K +YE +
Sbjct: 1041 YELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDK 1100

Query: 1065 LISNIEQTESLRVENSALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCK 1124
            L    ++ + L  +N  L ++I+      + D  +     L  SLR ER+ LETKL    
Sbjct: 1101 LSVLEQRVQELSTQNKLLYDQIELLNKTEDRDNSH-DSSDLLISLRRERDMLETKLEVAL 1159

Query: 1125 RDLALAKQKNANLEKSVNDMQQTHLVSRKDVQC-STDIIDEFEDIMKEIAQVNILKENNT 1183
             +  + KQ+    +  + D+  T L   K+    S  ++++ E+IMKE+ Q+++L+E+N 
Sbjct: 1160 SEQTVLKQRLDIAKSEIEDL-NTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNV 1218

Query: 1184 ILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEI----- 1238
             L+        +N +  KE  +L+ ++ +    LA  +  +S   N + + E E+     
Sbjct: 1219 TLRS-------ENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKE 1271

Query: 1239 --EQWKQR-------YDNLSQQQKETHKDETEKLFNEISXXXXXXXXXXXXXXXXXXXFN 1289
              E+WK R       Y+ +  ++    K+E   + NE+                    F 
Sbjct: 1272 EAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQ 1331

Query: 1290 RLKKQAHEKLDASKKQQTALTNEVDELKDMKN 1321
            R++ QA ++L+ASK+++ +L++E++++ + K+
Sbjct: 1332 RIRLQARDRLNASKEKEQSLSSEINQINEAKS 1363

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 98/197 (49%), Gaps = 43/197 (21%)

Query: 1430 NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQ---- 1485
            +++ LK +W K+YE++T+ +IK AEE LKKRIRLP++++I KI+  RK  LE+ F+    
Sbjct: 1548 DIDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVN 1607

Query: 1486 ---RKLKANSGSFTLSSDKKENEVNA---------EDDLWNSPSKGNSEKPSVVTNLIRQ 1533
               +KL    G+  ++ +K   E+NA         E DL     K   E    V+  ++ 
Sbjct: 1608 EKAQKLAGEIGNDAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLK- 1666

Query: 1534 KNLILQEQLKN--PKKGIISNDSRPTSSNKENDIPGSTTAENKAPLAFNFGKPLFPSNTS 1591
                L+ +++N   +K  I    +P     END    + A         F  P+F S++ 
Sbjct: 1667 ---FLESKIRNLEQQKSTI----KPV----ENDTSNMSAA---------FQAPVFGSHS- 1705

Query: 1592 SFQSFQNPFTPAATSFN 1608
               +F +PF+ +  S N
Sbjct: 1706 ---TFTSPFSTSEISPN 1719

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  299 bits (766), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 361/1379 (26%), Positives = 692/1379 (50%), Gaps = 117/1379 (8%)

Query: 5    ISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRI----S 60
            I  +L VP + L  +  SIL  L  ++++F   + +  +  V ++E++     RI    +
Sbjct: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75

Query: 61   KLNELLGXXXXXXXXXXXXXXRL-------------HNLLKNERSKCARKIDALNKQLNA 107
            +L +L+                L              + L+ E  +   K D L KQ   
Sbjct: 76   QLEDLIEQNASASEEKKKIEKELSDEKKESFQLSSTRDNLRAELKEIQEKFDNLQKQ--- 132

Query: 108  SKNTITKLNDERGVKEEAE---VLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCK 164
            +++TI KL D +  + E E    LK  +Q    E +A  H+          +E+ +Q+ K
Sbjct: 133  NQDTI-KLLDRKISQNEVEKELTLKLTNQYR--ESTAKCHD----------LEDEIQSLK 179

Query: 165  SNTLSLKLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQ 224
             N    +   + + Q+ + I E K+ +E +L  +D+K         + +Q L ++++  +
Sbjct: 180  YNDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLE 239

Query: 225  NDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLR 284
            N+   + + N  L  +N+ +S ++ +K  +++ L +  N EK +  KE++L++ M D+L+
Sbjct: 240  NNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQ 299

Query: 285  SQLTSFEKNYSLSAREKD---NDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVA 341
            +Q+   + +Y+     K     +D  +N +   +  KLI+T+ QL K   E +  +NI  
Sbjct: 300  TQVQKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNK---ELEERRNI-- 354

Query: 342  DCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTP 401
              ++ + +   N             D+  +K++LI+ER QK +LQNQ+E FI ELE+K P
Sbjct: 355  -TMQTESSTLSNQQQ---------EDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVP 404

Query: 402  ELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLD 461
             + SFK+RT+ LE+EL ++T LLE +   K +   EL +LRQ   + +    SL KQR D
Sbjct: 405  TINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRND 464

Query: 462  LARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTN 521
            LA Q++ +L++ S       PLS +E+  ++ +L++       DSQ +I+ERLV F N  
Sbjct: 465  LAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQVISERLVTFQNIV 524

Query: 522  ELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRI 581
            ELQ+KN++LL  VR LA KLE  E  Q  +   +E Q I EAK+AII L+  N+ LE +I
Sbjct: 525  ELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKI 584

Query: 582  DILSRERDSYKLLASANGNKIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNK 641
              L+ E D YK L   +  K+  +     E  N   IKELE+ L+ ++ E++     LN 
Sbjct: 585  KTLNDELDCYKSLPKPDT-KVETEHLRLNE-ENTDLIKELETRLATSREESNKTFASLNN 642

Query: 642  EL-----------LTCKKSQSNGQIALQEF----SNFKVLAIEKENLLQTRIDDLKTKLE 686
            E+             C+  +++ ++A Q      ++  +  +E E  LQ R++ L+    
Sbjct: 643  EIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQ-LQKRLEILQDITL 701

Query: 687  KQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESLTRDLERCC 746
            KQ      ++   +   +  LS  +N+   +  ++ N+SK N      ++SL  D+    
Sbjct: 702  KQDQRTQETLKEYVSC-KVALSNSQNELNYIQSQL-NISKTN------EKSLKDDITIVS 753

Query: 747  KEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTXXXXXXXXXXXXXXXXHSKVQEIETLQ 806
            KE+ +L+  +++ ++   E++   +S ++   T                 +K +EI+ L+
Sbjct: 754  KERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELE 813

Query: 807  TSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQ---YK 863
            +++ S+++W QN ID  ++   +   +L EK   I +L+ E+K L+ +LQ ++ +   YK
Sbjct: 814  SNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYK 873

Query: 864  LLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEE 923
            +LNNS +  T    L+ ELE+S+I+L +A+++++ Y++  S  E  L+   + + +TK+E
Sbjct: 874  VLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKE 933

Query: 924  LKVKSQSL----DEENNAK---EEEISFLRRELDEIRGLQPKLKEGALRLVQQSEKLGNQ 976
               K ++L    DE  + K    E+I+ L  ELD          +    L ++SE +  +
Sbjct: 934  FIRKIETLQKDRDELLDTKSILSEQITDLNNELDH---------QNKAHLEEKSE-ISKK 983

Query: 977  TQRIQAMNEKIDKMTTIVEL--------------HQEVETSQYQAKLKANKDLSALVLRL 1022
               + A N  I++++   EL              +  +  + Y+ +L+ + +L+  + +L
Sbjct: 984  LNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQL 1043

Query: 1023 ENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSAL 1082
              +   Y+ ++   +++  + +ELL K+E+ W E++  YE ++ +  ++ E L  +N  L
Sbjct: 1044 REDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLL 1103

Query: 1083 VEKID-DGTGENNGDKEYLKLVS--LFSSLRHERNTLETKLTTCKRDLALAKQKNANLEK 1139
             +++D     EN+ +++     +  L  SLR +R+ L+T+L+  + +    + K +++  
Sbjct: 1104 FDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNT 1163

Query: 1140 SVNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAI 1199
             + + +      R+  + +   ++E ++IM ++ Q+N+L+E+N  L+       EK + +
Sbjct: 1164 ELTNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQL 1223

Query: 1200 YKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDE 1259
             ++  +L+ ++  L+ +  + KE +  N  ++  Y+ E  +WKQR  ++  + K+    E
Sbjct: 1224 QEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVE 1283

Query: 1260 TEKLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELKD 1318
             EKL  EI+                   FNR+KKQAHE+L++SK  Q  L +++ +L+D
Sbjct: 1284 HEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLED 1342

 Score = 70.1 bits (170), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 121/275 (44%), Gaps = 63/275 (22%)

Query: 1435 KKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGS 1494
            ++QW K+YEE  ++RI++AEENLK+RIRLP+EE+I  +I K+K ELE+E+  K+   +  
Sbjct: 1499 REQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKE 1558

Query: 1495 FTLSSD-------------KKENEVNAEDDLWNSPSKGNSE---KPSVVTNLIRQKNLIL 1538
              LSS+             KKE E N + +L N+ +K   E   +  + T  + +K   L
Sbjct: 1559 L-LSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKL 1617

Query: 1539 QEQLKNPKKGIISNDSRP------TSSNKENDIP-------------------------G 1567
            + QL+        N+++        + + EN++P                         G
Sbjct: 1618 ESQLQGSNAA---NENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGG 1674

Query: 1568 STTAEN--KAPLAFNFGKPLFPSNTSSFQSFQNPFT-PAATSFNTGVSPVFNIKPALAVD 1624
            +T A N  +AP +   G       TS FQ  +N    PA T       P F ++     +
Sbjct: 1675 TTLALNQSRAPSSLQNGSDSSNPFTSPFQQTKNDANIPAVT------QPAFLLREPSEPN 1728

Query: 1625 ATVDTFKTPGLNDAGTNEAKIIE---IGNNSLKRP 1656
             +V T      ++  T     +    +   S KRP
Sbjct: 1729 MSVSTISRQSTSETNTESELPVSSEGLATPSSKRP 1763

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  283 bits (724), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 377/1376 (27%), Positives = 667/1376 (48%), Gaps = 137/1376 (9%)

Query: 4    KISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISKLN 63
            +IS  L VP + L   +Y ++ A+  ++D+   S+++   ++  I+E+++    +++ L 
Sbjct: 35   QISSILDVPLEKLHTTDYDLILAVKDKLDELRNSKDQSNVVSNDINELQTLADNKLTSLG 94

Query: 64   ELLGXXXXXXXXXXXXXXRLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERGVKE 123
              L                    ++ E+ +   K++    Q N           E  +K 
Sbjct: 95   GKLAT------------------VETEKKELIDKVNGYETQFN-----------ELKIKN 125

Query: 124  EAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLK-LKYDTVVQEKE 182
            E   LK  + N +LE       N        E E +        LS++  +   + QE  
Sbjct: 126  EGLNLKVSNLNIELENWKNNSNN-------FETEKLNYVXXXXXLSIRESEIQRLKQEVT 178

Query: 183  LILENK-----KWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFL 237
             + ENK     +W++E+  F   K L++     S ++ LEE     ++    VS     L
Sbjct: 179  FLNENKSSLSEQWLKEKEEFNKAKLLLEKNLNNSTIK-LEEATTTLKSMEAKVSV----L 233

Query: 238  LAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTS----FEKN 293
              +N  L+   E  I EIKNLKD + + K D +KE+ ++  + DLL+ QL+S      +N
Sbjct: 234  SDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELRQN 293

Query: 294  YSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDN 353
              L++  K    P   SQ+  +   + D  L++E+ ++E   L +++ + +  ++   +N
Sbjct: 294  VELNS--KFTKFPDLESQNETLKSDIQDLTLKIEELQNENFNLNSMI-NQMSNEQNNSNN 350

Query: 354  THNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESL 413
            + ++D ++  ++S I  LK+Q+ +E+ +K  LQ Q+ESFI ELE K P + SF+E+ ++L
Sbjct: 351  SSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQAL 410

Query: 414  EQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNI 473
            E EL N T LL   S  K   + +L +   K+   ++NI  L++QRLDLA QVK LLL +
Sbjct: 411  ENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFV 470

Query: 474  SAVQKKASPLSNDELISLKKLLESGDVPN--EKDSQIIITERLVEFNNTNELQEKNMELL 531
            +       PL+ +E+  + K+  + +  N  E  SQ +I+ERLV F+N  ELQ KNMELL
Sbjct: 471  AVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELL 530

Query: 532  NCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSY 591
            N +R L++ LEN E     S  + +N+TI +AK+AI+ L++ N  LES++ +L  ERDS+
Sbjct: 531  NSIRSLSENLENIENAN--SHKEFQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSF 588

Query: 592  KLLASAN---GNKIYAD--AANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTC 646
            KLL + N    + I  D  +++ +   N K I++L++ +   K E       L  ++ + 
Sbjct: 589  KLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKNKDALESQIASF 648

Query: 647  KKSQSNGQIALQEFSNFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSSIHGSIGSEETE 706
               +SN  I+L++  +   L  EK +L ++  D LKT+  K+ +    ++   I  +E++
Sbjct: 649  TADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTE-NKELNKRFENLQNIIIKQESK 707

Query: 707  LSQYKNKTKSLMCEISNL------SKKNTDLRC-MKESLTRDLERCCKEKMQLQMKLTES 759
            L    NK  +   EISNL      +K   D     ++SL  +L +  +EK +L++ L++ 
Sbjct: 708  LGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQL 767

Query: 760  ETSHNEQKLKSDSKQVQYNTXXXXXXXXXXXXXXXXHSKVQEIETLQTSKNSQLKWAQNT 819
            ++  NE+    D  Q ++ +                 SK+ EI+ L  S  SQ  W QNT
Sbjct: 768  QSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNT 827

Query: 820  IDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQYKLLNN---SSDANTLET 876
            IDD +K   ++ T+L+ K + I  L+ +++ LE +       Y +  N   SS  N   +
Sbjct: 828  IDDLKKINSAIKTELTSKNSLISDLNTKIELLESQ------SYTIDTNTRCSSSGNDF-S 880

Query: 877  ALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEENN 936
             + K+L+ +++ L +A++Q+E Y+++ ++ E +LK L       K  +  K   L  EN 
Sbjct: 881  QISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKISKLLSEN- 939

Query: 937  AKEEEISFLRRELDE-IRGLQPKLKEGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVE 995
               E +     E D+ I  L   LK    +  ++  +L  Q  R+     K D   T  E
Sbjct: 940  ---ETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKF--KKDSADTASE 994

Query: 996  LHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWM 1055
              +++   Q Q +LKA           +N    Y++ L K  ++L S +E  ++ E+   
Sbjct: 995  YEEKISKLQSQLELKAK--------FADNAQEKYESLLTKDNANLQSIEEFKEQIEKL-- 1044

Query: 1056 EEKADYERELI--SNIEQTESLRVENSALV---------------EKIDDGTGENNGDKE 1098
                  +R +I  S++E+  SL  EN +L                +KID+ T +N    +
Sbjct: 1045 -----NQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVD 1099

Query: 1099 YLKLVS-----------------LFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSV 1141
             L+L++                 +F+ LR +R+ LETKL+  +RD      K  +L   +
Sbjct: 1100 QLELLNKDFSSMDSSQLSSETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDEL 1159

Query: 1142 NDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYK 1201
             ++Q   + S   +   +D+I+  E I+ E+ Q+ + KE+N  L+  + ++ EKN+ +  
Sbjct: 1160 ANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQT 1219

Query: 1202 EHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETE 1261
            +      ++S L  +L   KE +      +++ + E  +W+ R + LS Q  +   D   
Sbjct: 1220 KLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVS 1279

Query: 1262 KLFNEISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELK 1317
            KL  E+                    FN LKKQAHE+L+ASK+ Q++L  +++ELK
Sbjct: 1280 KLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELK 1335

 Score = 59.3 bits (142), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 69/233 (29%), Positives = 104/233 (44%), Gaps = 52/233 (22%)

Query: 1446 TMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLK-------ANSGSF-TL 1497
            T+ RI+EA+E LKKRIRLPSE +I ++I KRK ELE E++ KL+       AN  S  T+
Sbjct: 1505 TLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKLNEIEANRNSIETI 1564

Query: 1498 SSDKKENE----------VNAEDDLWNSPSKGNSE---KPSVVTNLIRQKNLILQEQLKN 1544
               K   E          +  E+DL  +  K   E   + S+ T L+ +K   L+ QL  
Sbjct: 1565 DPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQLSE 1624

Query: 1545 PKKGIISNDSRPTSSNKENDIPGSTTAENKAP-----LAFNFGKPLFPSNTSSFQSF--- 1596
              +    +D  P  S    D+  ++T  +  P      AF+FG     ++ ++ + F   
Sbjct: 1625 AIENDKQSDKNPIIS----DLAQTSTLASIQPPSAKKPAFSFGGFNTTNSLNANKGFSSS 1680

Query: 1597 --------------QNPFTPAATSFNTGVSPV-FNIKPALAVDATVDTFKTPG 1634
                          QNPF+   +   T  SP+ FN  P  +   T + F   G
Sbjct: 1681 SNNTSQSSKDTEIVQNPFSLGVSQ--TSSSPMHFN--PFSSSATTSNVFNQNG 1729

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  233 bits (595), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 314/1230 (25%), Positives = 613/1230 (49%), Gaps = 77/1230 (6%)

Query: 142  LGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQLSFRDEK 201
            L +E    R K+L++EN  Q  K N LS + + + + QE E I + K W+EE+L  + E+
Sbjct: 165  LNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQ 224

Query: 202  TLVDDVTRTSHV---QNLEEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNL 258
                D  R   +   Q+L+ QLN  +N+ + + + N  L  +  +LS+ +      +KN+
Sbjct: 225  F---DSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNI 281

Query: 259  KDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQHANVVDK 318
            + + N +KA   KE+TL++ +  +L+SQL   ++          +D    + + ++   +
Sbjct: 282  QQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSLTVSDTASSSRKDSDFTRE 341

Query: 319  LIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDP---SVNKVFSDIKALKRQL 375
            + D K QL   ++    L+  +     ED  A  N+ + D    S+ K + DI  LK++L
Sbjct: 342  INDLKNQLNHVQERNVELEFKLRKS--EDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKL 399

Query: 376  IKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDE 435
              E++Q+   +  +E F+ +LE + P L +++ R  + E+ELK +T LLE  +  K    
Sbjct: 400  NDEQSQRENFEKNLEEFMDDLETELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVS 459

Query: 436  KELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLL 495
             EL   + +I + E  I  + KQR DLA Q++  L++ S     A PL+++E+  ++ ++
Sbjct: 460  SELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNII 519

Query: 496  ESGDVPNEK--DSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLA 553
            +  D  ++K  D+Q +I+ERL +F +  ELQ+KNMELL   R LA KLE  +  +    +
Sbjct: 520  QEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKS 579

Query: 554  KLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKTEAA 613
            ++E +TI EAK+AI+ L++ NS+L ++I  L++E ++YK+L++   +   AD   + E  
Sbjct: 580  RIEEETIAEAKEAILTLQNYNSSLTAKIAALTKELETYKVLSNTEDSSTPADFDKQREQR 639

Query: 614  NLKK---IKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEK 670
             ++    +KELE+ ++    E+      LN ++    +  ++  I L    + K LA E+
Sbjct: 640  EIEHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEER 699

Query: 671  ENLLQTRIDDLKT---KLEKQRSSAPSSI-------HGSIGS---EETELSQYKNKTKSL 717
              LLQ  +D   T   +L+K+ +S  + +       H +I S     +EL+  +NK    
Sbjct: 700  LKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVS 759

Query: 718  MCEISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQY 777
              EI         L   +E L  +L R  +EK  +++ +T  +T  +E++    + Q ++
Sbjct: 760  QNEIKL-------LHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKF 812

Query: 778  NTXXXXXXXXXXXXXXXXHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLS-- 835
            N                   K++E E    +  S ++      DD  +  KSL  ++S  
Sbjct: 813  N----KELNDLEGTCNDLRKKLKEAE---ENYGSLMEETTELKDDFRQKKKSLKEEMSNV 865

Query: 836  EKKTT-----IRKLSLEMKDLEIEL-QKTKLQYKLLNNSSDANTLE--TALKKELERSQI 887
            EK+ +      R+   E   L  +L +KT+L  K    S D   LE  ++L+KEL+  + 
Sbjct: 866  EKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKN 925

Query: 888  DLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRR 947
            +L +++SQ E+Y + I     ++ ++N Q+   +   K +   ++   N   +  + L+ 
Sbjct: 926  ELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTVLKT 985

Query: 948  ELDEIRG---LQPKLKEG-ALRLVQQSEKLGNQTQRI-QAMNEKIDKMTTIV-ELHQEVE 1001
            ++D++     +Q KL E   +   + + +L   T+ + Q+  +  DK+ +++ +L ++V+
Sbjct: 986  QIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVK 1045

Query: 1002 TS-----QYQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWME 1056
             +      Y+ +L+ + ++S  + +L  +   Y+TE+ +   S    + LL++++  W +
Sbjct: 1046 YANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQK 1105

Query: 1057 EKADYERELISNIEQTESLRVENSALVEKI-------DDGTGENNGDKEYLKLVSLFSSL 1109
            ++ +YE+++    ++ E    +N  L E+        D+   E++G         L  SL
Sbjct: 1106 QRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSL 1165

Query: 1110 RHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRK---DVQCSTDIIDEFE 1166
            R ER+ L+ +L   + +  L +++  ++EK   D + T L  +K   +     D++++ +
Sbjct: 1166 RSERDLLQERLNVTEAEEKLLRERLTSIEK---DFRATDLELQKIKEETHNYPDLLEQHK 1222

Query: 1167 DIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSV 1226
             +M ++ Q+++L+E+N  L+    ++  KN+ +  E  +L  ++  L+ +L      +  
Sbjct: 1223 TVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLETELQTLTNLIEE 1282

Query: 1227 NANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISXXXXXXXXXXXXXXXXXX 1286
               ++ +   E E+WKQR  ++  + +     E E L  E +                  
Sbjct: 1283 KDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGN 1342

Query: 1287 XFNRLKKQAHEKLDASKKQQTALTNEVDEL 1316
             F +LKKQAHEKL+ASK  Q +LT ++++L
Sbjct: 1343 RFEKLKKQAHEKLNASKISQNSLTIQINDL 1372

 Score = 73.9 bits (180), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 86/162 (53%), Gaps = 19/162 (11%)

Query: 1434 LKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSG 1493
            ++KQ  ++YE+ T +RIKEAEENLK+RIRLP+EE+I K+I KR+ +LE EFQ K++A + 
Sbjct: 1541 IRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAK 1600

Query: 1494 SFTLSSDKKENEVNAEDDLWNSPSKGNSEKPSVV---------------TNLIRQKNLIL 1538
                  +K E     + ++    ++   E+  VV               T+ + +K   L
Sbjct: 1601 ELLTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKL 1660

Query: 1539 QEQLKNPKKGIISNDSRPTSSNKENDIPGSTTAENKAPLAFN 1580
            +  L+N K    + D+   S++ E    GS    +K P+  N
Sbjct: 1661 ESDLQNAKSNTGATDNTIVSTDNETKYEGS----DKKPVTIN 1698

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  207 bits (526), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 193/571 (33%), Positives = 312/571 (54%), Gaps = 43/571 (7%)

Query: 216 LEEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTL 275
           L++QL    ++  S+ +    L   N+ LS  +++K+  IK+L D +N  K +F+KE+TL
Sbjct: 227 LQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITL 286

Query: 276 QKNMNDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQR 335
           ++ +N+LL +++ S++K        K+ + P K      ++ +L+D K +L  S+ EC  
Sbjct: 287 KQRVNELLHNEIASYKKQIE-RLTSKNLETPEKK-----IIQELVDLKEKLVNSEKECNE 340

Query: 336 LQNIVADCIEEDE----AAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMES 391
           L++ V   I  DE    + F N   +          I+ L+RQL+KE+  K  LQ Q+ES
Sbjct: 341 LKSTVDKYINIDEKKLISKFGNPKKL----------IEILRRQLVKEKRHKDTLQRQVES 390

Query: 392 FIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEAN 451
           F+ ELE+K P + SFKER  SLE+EL   T  LE  +  +   ++ELT+L++KI+N E  
Sbjct: 391 FLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQF 450

Query: 452 IHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIIT 511
              L++QR DLA QV+ LLL I       SP +  E   +KK++ + +  N+ DS  II+
Sbjct: 451 NDELLRQRSDLAHQVQYLLLCID----NKSPFTEKEATLVKKIVSNENTENDTDSHKIIS 506

Query: 512 ERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKE-AKDAIIEL 570
           +RL+ F N  ELQ+KNMELL   R L   LE  E +Q K+L   +N  I E AK   ++L
Sbjct: 507 KRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDL 566

Query: 571 EHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKTEAANLKKIKE-LESELSLTK 629
           E    TLES+I+I+S+ERDSYKLL + +  +      + +     +  KE L +ELS  K
Sbjct: 567 EKHIKTLESKINIISQERDSYKLLVTNSTIQSNTSNNSISSLQQCELEKERLTNELSSMK 626

Query: 630 VENSAVVQRLNKELLTCKKSQSNGQIALQEFS-NFKVLAIEKENLLQTRIDDLKTKLEKQ 688
            ++  V++ L  ++ T +KSQ   ++ +++ + NF  +  +  NLL+  +D L+ K++  
Sbjct: 627 QQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMK-DNNNLLKEYVDKLENKIKTL 685

Query: 689 RSSAPSS-------IHGSIGSEE----TELSQYKNKTKSLMCEISNLSKKNTDL--RCMK 735
                 +       I G + + E     ELS  + K   L  EISNL  KN +L  + + 
Sbjct: 686 EQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILT 745

Query: 736 ESLTRDLERCCKEKMQLQMKLTESETSHNEQ 766
            +L+++L     + +QL+  L+E E   N Q
Sbjct: 746 MTLSKNL--LDNKVLQLETSLSERELPKNTQ 774

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 99/415 (23%), Positives = 184/415 (44%), Gaps = 49/415 (11%)

Query: 913  LNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLKEGALRLVQQSEK 972
            L ++ TK K +LK  +  L       E++ SFL   + +++G + +L E   +LV+++EK
Sbjct: 842  LENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGKEKELNELKSKLVEKTEK 901

Query: 973  LGNQTQRIQAMNEKIDKMT-TIVELHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQT 1031
            L        A NE  +K+   IV L   VE                       E   ++ 
Sbjct: 902  LQ------MAENENSEKINNAIVLLQTMVE-----------------------ENTTFKD 932

Query: 1032 ELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSALVEKID---- 1087
              K  K+SL   ++ ++  +++ +  +++Y  E+    E+ E   V+ ++   K+     
Sbjct: 933  AFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILE 992

Query: 1088 --DGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQ 1145
              DG   N        +  L  SL HE+  L   L +    L  A+ +N N  +      
Sbjct: 993  SYDGKILNTA-----AIGHLVRSLIHEKKMLALNLNSANYSLRRARYRNKNPREKFPSFV 1047

Query: 1146 QTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTS 1205
            +    S+K+        ++ E++M+   ++  L+E+N  L K ++  T+ NE +  +   
Sbjct: 1048 KIDQQSKKE--------EDKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLAD 1099

Query: 1206 LQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFN 1265
            +Q ++  L+ ++ + K +V+     + + + E+E+WK R   + QQ K   ++   K   
Sbjct: 1100 MQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLE 1159

Query: 1266 EISXXXXXXXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320
            +I                    F+RLKKQAHEKLDA+K  Q  LT +++EL + K
Sbjct: 1160 KIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETK 1214

 Score = 62.4 bits (150), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 87/166 (52%), Gaps = 15/166 (9%)

Query: 1447 MRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKA------NSGSFTLSSD 1500
            ++RI EAEENLKKR+RLPSEE+I  +I KR++ LEQEF+ KL+        +G  T +  
Sbjct: 1363 LKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRA 1422

Query: 1501 KKENEVNAEDDLWNSPSKGNS-----EKPSVVTNLIRQKNLILQEQLKNPKKGIISNDSR 1555
            + E E+  + +L  +  K  +     ++  + + L+ +K   L+ Q  +P K   SN+++
Sbjct: 1423 QIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQ 1482

Query: 1556 PTSSNKENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFT 1601
              S    ++I  S+    +  L  N+G  +     +      NPFT
Sbjct: 1483 VPSKINLSNINSSSPPLGEKVLQLNYGANVVAETDND----DNPFT 1524

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1674

 Score =  182 bits (462), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 137/448 (30%), Positives = 250/448 (55%), Gaps = 25/448 (5%)

Query: 153 LLEMENILQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSH 212
           +L ++  L+  KS  L  + + +  +++ EL+ E+ +W+EE L     KT  + +T+   
Sbjct: 103 ILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLV----KTTEELMTQKQS 158

Query: 213 VQNLEEQLNRTQNDYESVST---NNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADF 269
           +  +EE+     N    VS    NN  LL +N++LS ++++K++EIK   D  + ++ +F
Sbjct: 159 ILKMEEKDQEIDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQQEF 218

Query: 270 SKEMTLQKNMNDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKS 329
             E+ L+  +N  L +QL   ++  S+      N+D    ++   ++++LIDT+ QL+ S
Sbjct: 219 LHEIGLKDRINSSLETQLKEIQQEKSIQ-----NEDNTSRAESQKIMEQLIDTRKQLKDS 273

Query: 330 KDECQRLQNIVADCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQM 389
           ++EC RL++ V + I +    + ++ ++                   K + QK  L+ Q+
Sbjct: 274 RNECTRLKSYVNEFINDVNGEYSSSSSLLKKELL-------------KVKEQKDYLETQV 320

Query: 390 ESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCE 449
           E+FI ELE K P + S +++ + LE+EL + T L++ IS+ +   EKE  S ++K  + +
Sbjct: 321 ENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQSFKRKSEHND 380

Query: 450 ANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQII 509
             I +L  QR DLA Q++ LLL +       + LS DE   +++L E+       DSQ I
Sbjct: 381 GMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARNNDSQSI 440

Query: 510 ITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIE 569
           I+ERL++F +  ELQ++NM++L  VR LA +LE  E  +      +E +T++EAK A+++
Sbjct: 441 ISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKKALLD 500

Query: 570 LEHVNSTLESRIDILSRERDSYKLLASA 597
           L+   ++LE +++   +ERD YKLL+  
Sbjct: 501 LQEYTNSLERKLETFRKERDVYKLLSKG 528

 Score = 79.7 bits (195), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 92/327 (28%), Positives = 147/327 (44%), Gaps = 82/327 (25%)

Query: 1414 EEATGKNTGATIENGENMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKII 1473
            E  T  NTG+      N+++LK++  K +EE+T++RI+EA+ENLK+ IRLPSEE+IQ+II
Sbjct: 1358 ENVTNDNTGS------NVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRII 1411

Query: 1474 SKRKEELEQEFQRKL--KANSGSFTLSSD----------KKENEVNAEDDLWNSPSKGNS 1521
             KR+ ELE +F +++  KAN  +    +D          ++E E   E DL    +K  +
Sbjct: 1412 EKRRAELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDL---QAKLET 1468

Query: 1522 EKPSVVTNLIRQ---KNLILQEQLKNPKKGIISNDSRPTSSNKENDIPGSTTAENKAPLA 1578
             +        RQ   K  +L+ +L   +  +  ++   + S     I G T  +  +P  
Sbjct: 1469 IRTKAFEEGKRQAEMKTTLLERKLSKLESQVAKDNE--SGSKVRKSISGLTKIDVNSPQL 1526

Query: 1579 F--NFGK------PLFPS----NTSSFQSFQNPFT-----------PAATSFNTGVSPVF 1615
            +  N G        L P+    +     +  NPFT           PAA      ++P F
Sbjct: 1527 YKDNTGTRTEAVLKLRPTAKVDSGKDVSNDSNPFTSPTQELSKSNSPAALPI-VHMAPTF 1585

Query: 1616 NIKPALAVDATVD---------TFKTPGLNDAGTNEA---------------------KI 1645
            +  P  +   TV+         TF  P  ++ GT+ A                      +
Sbjct: 1586 SFTPGKST-GTVNKELNKTAQATFGAPTFSNFGTSTAFGGFSGFGKTTNDQSGFKPFEAL 1644

Query: 1646 IEIGNNSLKRPIENEVSFD-TDSKKVK 1671
             EI N S+KRP+ +E   D ++SKK K
Sbjct: 1645 KEIDNESIKRPVSDEKEDDFSESKKPK 1671

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  174 bits (441), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 265/1023 (25%), Positives = 469/1023 (45%), Gaps = 111/1023 (10%)

Query: 160  LQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQL--------SFRDEKTLVDDVTRTS 211
            ++T K   L L+ + D V     L ++ K+  E +         S++D K L        
Sbjct: 116  IETSKDEKLLLRTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKEL-------- 167

Query: 212  HVQNLEEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSK 271
              QN+ E L    N+    +  N  L  +N++LS  +  KI EIK+L++++     DF  
Sbjct: 168  EYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLS 227

Query: 272  EMTLQKNMNDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKD 331
            E  LQ  + + L++Q+ + ++     + EK +D   +      ++ ++ +   +LE S+ 
Sbjct: 228  EKQLQDQLINALQNQIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISER 287

Query: 332  E-------CQRLQNIVADCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQ 384
            E        +  QNI  +      +     +N   S++    D+  L++  +KER QK Q
Sbjct: 288  ERLSLVHSMEEFQNIPEEESSSVSSHASGRNNSALSLS---GDVNILRKHFLKERQQKRQ 344

Query: 385  LQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQK 444
            L+ QM   ++ELER  P L S+KER+  LE+EL +S  LLE I         EL     +
Sbjct: 345  LEEQMRQILQELERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESE 404

Query: 445  INNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEK 504
             +N  ++I+SL  QR  LARQVK LLL I   +   S L   +L  L + L +       
Sbjct: 405  CSNLRSSINSLAFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMS 464

Query: 505  DSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAK 564
            DS+ I+ ERL +F N  ELQ +NM+LL   R LA K E  E    K ++  E++TI +AK
Sbjct: 465  DSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAK 524

Query: 565  DAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKTEAANLKKIKELESE 624
            +AI+ L+  +  LES+I  LS   D   +       K    A +K E        +L  +
Sbjct: 525  EAILVLQEYSQKLESQIKELS---DELAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQ 581

Query: 625  LSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQTRIDDLKTK 684
            LS     +  ++  LN E+    ++ ++  I+L +  + + LA ++ NLL+  +  LK++
Sbjct: 582  LSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSE 641

Query: 685  LEKQRSSAPSSIHGSIGSEETELS-------QYKNKTKSLMCEISNLSKKN-------TD 730
             E+ +    + +  +I  +E + S         K+K  +   EI++L  +N       T 
Sbjct: 642  KEELQEEV-NKLQQNILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTT 700

Query: 731  LRCMKESLTRDLERCCKEKMQLQMKLTESETSHNE-QKLKSDSKQVQYNTXXXXXXXXXX 789
            LR  KE+L         E+  L+M +T+  + +NE Q L  ++K   Y+           
Sbjct: 701  LRTKKEAL-------LNERNNLRMTVTQMNSLNNELQTLLKETKS-GYDDKLKISALKCT 752

Query: 790  XXXXXXHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMK 849
                      Q +  L++  +S++KW + TIDD + N+  L+ +L +K+  I + S  ++
Sbjct: 753  QTNNQLQLVQQRMSELKSQNDSEIKWYKATIDDLKANVFELNEELKQKEEKIEEFSKTLE 812

Query: 850  DLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENT 909
            +++ EL         L NS D +  + AL+KEL   +  L+ ++ +++ YE +IST + +
Sbjct: 813  NVQNEL--------TLANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRS 864

Query: 910  LKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLKEGALRLVQQ 969
             +   ++  + ++ +K  +  LD               EL E   LQ  L     R+V Q
Sbjct: 865  FE---NKSIQYEDRIKALASKLD--------------SELRERTTLQENLSTLQARMVVQ 907

Query: 970  SEKLGNQTQRIQAMNEKIDKM----TTIVELHQEVE-------------TSQYQAKLKAN 1012
             ++L +    +  +    D +     T  +   E+              +  Y+  ++ N
Sbjct: 908  QDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERIMQEN 967

Query: 1013 KDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELIS---NI 1069
             +LS +V  L  EV +  +  +K +  L  T+ ++ K +  W EEK  +E ++ +    +
Sbjct: 968  SELSKVVELLREEVKNRTSNGEK-EGDLEDTESIIKKGQDVWDEEKKVFEVQITNLNERL 1026

Query: 1070 EQTESLRVENSALVEKIDDG----TGENN--GDKEYLKLVSLFSSLRHERNTLETKLTTC 1123
             +         A +E  D G    + E N  G++E L      ++LR ER +L  KLT  
Sbjct: 1027 SELLEENESLLARLESQDKGNNSPSAETNAAGNEETL------AALRSERTSLIEKLTAA 1080

Query: 1124 KRD 1126
            +++
Sbjct: 1081 QKE 1083

 Score = 68.9 bits (167), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 44/59 (74%)

Query: 1442 YEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLSSD 1500
            YEEE  +++ +AEENLKKRIRLP+EE+I  II KRK ELE  F++K+K  + S  L SD
Sbjct: 1224 YEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSD 1282

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1735

 Score =  165 bits (417), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 150/452 (33%), Positives = 250/452 (55%), Gaps = 43/452 (9%)

Query: 160 LQTCKSNTLSLKLKYDTVVQEKELI---LENKKWMEE----QLSFRDEKTLVDDVTRTSH 212
           L   KS T  LK KY+  V++ E +     + K  EE    +LS    K      + ++ 
Sbjct: 162 LNNFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNE 221

Query: 213 VQNLEEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKE 272
           ++N ++ L+  +  YE +   N+    +N +L+ ++  ++ + K+L++ +N  K  F++E
Sbjct: 222 LRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTRE 281

Query: 273 MTLQKNMNDLLRSQL-----TSFEKNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLE 327
           MTL ++ NDLL+  +     T+ E     S  EKD            ++ +L+D K  LE
Sbjct: 282 MTLTQHENDLLKEHIEYLKNTTKETTGGTSTLEKDR-----------LLHELVDIKKSLE 330

Query: 328 KSKDECQRLQNIVADCI-EEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQ 386
           KS+ E   L + +   + E +E+  DN             ++  LK QLIKE+ QK  LQ
Sbjct: 331 KSELENVHLNDFIEQYLTENEESTSDN-------------ELVLLKEQLIKEKRQKDYLQ 377

Query: 387 NQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKIN 446
            Q+E F+ ELE + P + S K+R ++LEQEL   T LLE          KELT+  +++ 
Sbjct: 378 EQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTTENRRLK 437

Query: 447 NCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDS 506
               NI+ L+ QR+DLA QV+ LLLN+   + +   L+ DE+  L+K+++S +  N+ DS
Sbjct: 438 EQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDS 497

Query: 507 QIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDA 566
           Q II+ERLV+F++ + LQ++NMELL   R LA++LE+ +    KS+ K+   T  E+K+ 
Sbjct: 498 QKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDT---KSVQKI---TRNESKEK 551

Query: 567 IIELEHVNSTLESRIDILSRERDSYKLLASAN 598
           I +L+   + L S+++ L +E+D+YKLL+  N
Sbjct: 552 IAKLQESINGLTSKLEKLQKEKDAYKLLSLQN 583

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 37/44 (84%)

Query: 1430 NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKII 1473
            ++E++K +W ++ EE  M+RI +AEENLKKRIRLPSEE+I ++I
Sbjct: 1468 DIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVI 1511

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  162 bits (411), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 286/1124 (25%), Positives = 492/1124 (43%), Gaps = 178/1124 (15%)

Query: 256  KNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYS----LSAREKDNDDPCK-NS 310
            K L D ++ ++ DF +E+  +  +N +L+ Q+ S            A  + ND   K +S
Sbjct: 198  KTLSDQLSSQRHDFERELATRDKLNAVLKKQVNSLHSELGNGGETPAHAEPNDQFAKQSS 257

Query: 311  QHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPSVNKVFSDIKA 370
            QH            ++   K++ + L  I+                  PS       I  
Sbjct: 258  QHEE----------EISNYKEQVEELLGILGQGA--------------PS-------IAH 286

Query: 371  LKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLA 430
            L++ L+KER +   L+ QMESF+ ELE + P L   +++ + ++Q+L  +T+ +   S A
Sbjct: 287  LRKLLLKERKENVSLKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKA 346

Query: 431  KRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELIS 490
            K + ++EL+S RQK+++     H L  QR DLA Q++ LL     V    + L   EL  
Sbjct: 347  KIRTQRELSSSRQKVDHLNQIFHKLRVQRSDLAHQIQFLL----TVNSSDTVLPPSELSF 402

Query: 491  LKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDK 550
            +K ++E+ +    KDSQ I+++RL+ F+N  ELQE+NM+L++ VR L DK+E+ E   D 
Sbjct: 403  IKTIIENENWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDS 462

Query: 551  SLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKT 610
             L      T++ AK  I +LE  N+ LES +      ++   L+ +           N T
Sbjct: 463  GL------TLEAAKLQISKLEQSNAQLESEV------KNWEALMETLKDGDSLDSKINVT 510

Query: 611  EAANLKKIKELESELS------------LTKV--ENSAVVQRLNKELLTCKKSQSNGQIA 656
                 KKI+ELES+L+            L K    N + +  LN+++    KS  N +  
Sbjct: 511  MVEQQKKIEELESKLTDVGESHVQKINVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKSE 570

Query: 657  LQEFSNFKVLAIEKENLL--------QTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELS 708
            L        +A ++ENL         Q  +D+L +K  ++       I         ELS
Sbjct: 571  L--------IACKRENLSLTQQISTKQNELDELNSKSAQKERDYQLKI--------AELS 614

Query: 709  QYKNKTKSLMCEISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKL 768
               NK KS       L+++ T +   + SL   +++  K+ +QL+ +  E E   + ++L
Sbjct: 615  VAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKEL 674

Query: 769  KSDSKQVQYNTXXXXXXXXXXXXXXXXHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMK 828
                 +   ++                  K +E++        Q+KW Q  ID+  +  K
Sbjct: 675  HRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNK 734

Query: 829  SLSTDLSEKKTTIRKLS------------LEMKDLEIELQKTKLQYKLLNNSSDANTLET 876
            + S  + E    +R LS             E+K+L+ EL   K   ++      + +  T
Sbjct: 735  NKSNKIIELNDKLRLLSEKSLSNKPYPVGTELKELQNELNGMKAALEV------SESQAT 788

Query: 877  ALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKEL---NDQLTKTKEELKVKSQSLDE 933
              K  LER+Q            Y     + +NT+ EL   N+ L+K  E L  ++Q  + 
Sbjct: 789  LYKDTLERNQ----------NFYNNSTLSFQNTISELQSKNEALSKQHETL--QNQITET 836

Query: 934  ENNAKE---EEISFLRRELDEIRGLQPKLKEGALRLVQQSEKLGNQTQRIQAMNEKIDKM 990
            EN +K    E  + + R   E   L+ KL      L    EK+        A   +I K+
Sbjct: 837  ENQSKGIQLEHQTIIDRLTSEKTALEEKLNS----LSHSEEKIAEMKGEYDA---QIQKI 889

Query: 991  TTIVELHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKH 1050
             + +++  +   +   A     K+L++  +++E       TE+ K  S + +  E  +  
Sbjct: 890  ESNLKIQSDTRLNFESALTSKEKELTSYAVQIEQ----LNTEIAKLNSDIAALTEPAEAR 945

Query: 1051 ERKWMEEKADYERELISNIEQTESLRVENSALVEKID-----DGTGENNGDKEYLKLVSL 1105
             +  ++E+    +EL    ++ ESL  +NS L +        D   E N D     L +L
Sbjct: 946  -KTLIKERDSLGQELKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNED-----LRNL 999

Query: 1106 FSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQCSTDI-IDE 1164
              +LR ER+  +++ TT +RD+ L       L+K++ ++ +   ++  ++   T+   D+
Sbjct: 1000 VINLRIERDMHQSQETTAQRDVKL-------LKKNLKEITEKLAITCPEIDEPTNTEKDD 1052

Query: 1165 F------EDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLA 1218
            F      E IM+E+  +   KE N  L +S+K + E       +  +LQ E+S+L+    
Sbjct: 1053 FSLTVTHEKIMRELEGLTNTKEENLYLDESIKSLNE-------DKRTLQEEVSRLRESEE 1105

Query: 1219 QTKEQVSVNA-----NKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISXXXXX 1273
              K+  S  +      K+  Y+ E E+WK     + QQ  E    E + L  ++      
Sbjct: 1106 LAKKNSSAISEQEWQQKIETYQQESEKWKL----MCQQMSENTATEIQNLQQQLETFKAD 1161

Query: 1274 XXXXXXXXXXXXXXFNRLKKQAHEKLDASKKQQTALTNEVDELK 1317
                          F RLKKQAHEKL+ASK    +L  E+ ELK
Sbjct: 1162 IQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELK 1205

 Score = 76.3 bits (186), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 133/294 (45%), Gaps = 48/294 (16%)

Query: 1425 IENGENMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEF 1484
            + N  N+EEL+K   +++E +T++RI+EA+ENLKK IRLP+EE+I+++I+KRK +LE++F
Sbjct: 1322 MNNNANLEELRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQF 1381

Query: 1485 QRKLKANSGSFTLS------SDKKENEVNAE---------DDLWNSPSKGNSEKPSVVTN 1529
            Q K+   +    LS      +D+ E EV  E         + L     +   ++ S+ T 
Sbjct: 1382 QTKVAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTT 1441

Query: 1530 LIRQKNLILQEQLK---NPKK-----------------GIISNDSRPTSSNKENDIPGST 1569
            L+ +K   L+ +L+    P K                 G ++N+  P    K N   G+T
Sbjct: 1442 LLERKIAKLEARLQGGTGPLKSANGLNKINIDSPLMVAGPLTNE--PVLDEKPNAFAGAT 1499

Query: 1570 TAENKAPLAFNFGKPLFPSNTSSFQSFQNPFTPAATSFNTGVSPVFNIKPALAVDATVDT 1629
            T     P +         +N  SF + + P  PA   F++   P F+         +  +
Sbjct: 1500 TTTISQPTSTTAKD---SANAFSFNAQKVPAQPA---FSSRAQPAFSFGSFNKTSFSDLS 1553

Query: 1630 FKTPGLNDAGTNEAKIIEIGNNS-LKRPIENEVSFDTDSKKVKENSDNDQVSEN 1682
             K    N  G         G  S    P +N     TD+K+  +   + +V +N
Sbjct: 1554 HK----NSVGAASGTPFRFGFASNPPTPFQNTAENGTDAKRKSQTEASKEVEDN 1603

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  111 bits (278), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 130/459 (28%), Positives = 234/459 (50%), Gaps = 17/459 (3%)

Query: 385 LQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQK 444
           L++ +++++ ELE++ P + +FK   E+L+  L     ++E++   K+++ K + S+++ 
Sbjct: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273

Query: 445 INNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEK 504
           IN   ++I +L  QR DLA Q++ LL++ S       PLS  E++ ++ L+         
Sbjct: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSS 333

Query: 505 DSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAK 564
           D Q +I++RL++F +   LQEKNMEL   +R LA  LE+ E +   S    +N TI EAK
Sbjct: 334 DVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAK 393

Query: 565 DAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKTEAANLKKIKELESE 624
           + I+ L+  N+ L+  I  L   +     L S+  N   ++  +    +NL  +K+LES+
Sbjct: 394 ETILSLQEYNNVLKLEIGTL---QSKISELQSSIPNSKESEKQHFNYHSNL--VKDLESK 448

Query: 625 LSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQTRIDDLKTK 684
           LS     + + ++ LNK++      +++  I L++  +  +LA EK  LLQ    DL T 
Sbjct: 449 LSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSY-DLLTL 507

Query: 685 LEKQRSSAPSSIHGSIGSEETELSQYKN---KTKSLMCEISN-LSKKNTDLRCMKESLTR 740
             ++ SS  S +   +  EE  L+   N   K K+ + + +N L+  N +   ++E    
Sbjct: 508 ENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLLNNNKLGLEEE-NN 566

Query: 741 DLERCCKEKMQLQMKLTESETSHNEQKLKSD-SKQVQYNTXXXXXXXXXXXXXXXXHSKV 799
            L++  K   + Q+K  +S++ H EQ L+++ SK                        K+
Sbjct: 567 SLKQEIKSNYE-QIKDLDSKSKHLEQSLENEISKYTDKVKELELNISKLNEQKLILERKL 625

Query: 800 Q----EIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDL 834
           Q    EI+ L +S   Q+ W Q  +D  EK +K+L + L
Sbjct: 626 QNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESRL 664

 Score = 72.8 bits (177), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 98/188 (52%), Gaps = 20/188 (10%)

Query: 1441 QYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLSSD 1500
            +YE +  +R+ EAEE LK++IRLPSEE+I  II  +  +LE+++++KL+  S     S+D
Sbjct: 1098 EYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLETVSAE---STD 1154

Query: 1501 KKENEVNAEDDLWNSPSKGNSE---KPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRPT 1557
             ++ +   ED+L N+  K   E   + S+ T  +  K   L+ QL+N +  +   ++   
Sbjct: 1155 IEKIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQNNESDVTDKEAEVK 1214

Query: 1558 SSNKENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFTPAATSFNTGVSPVFNI 1617
            +++ E   P     E K    F+   P  P N++ F + Q+  +P +         VF I
Sbjct: 1215 TTDNEKSNPELDKQEAKPSFTFS---P--PPNSNPFTTTQDTDSPVS---------VFGI 1260

Query: 1618 KPALAVDA 1625
            KP  ++ A
Sbjct: 1261 KPTFSLGA 1268

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1651

 Score =  110 bits (275), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 124/461 (26%), Positives = 230/461 (49%), Gaps = 49/461 (10%)

Query: 138 ERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYD-TVVQEKELILENKKW------ 190
           E S +  +   LR +L  ++N L+  K   L+L+ + D TV     L LEN         
Sbjct: 84  EVSTVTGQTSALRAELENLQNDLELLKDKDLALQSERDSTVALLDGLKLENSALRAEIEQ 143

Query: 191 MEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQ 250
            +E  S R      D  ++T  + + EE+L   +++  S       L++Q ++LS  + Q
Sbjct: 144 AKELASIRQHDYEADLDSKTGALVSKEEELRLAKSERAS-------LISQTERLSQELLQ 196

Query: 251 KILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSAREKDNDD--PCK 308
           +  +I+ L D   + + +++ E+ LQK+   LL+ Q+ S EK   L   E + +   P  
Sbjct: 197 RDADIRQLVDADKLRQDEYTDEINLQKHRARLLQEQVASLEKEAKLVGHETEPEYEIPPP 256

Query: 309 NSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPSVNKVFSDI 368
             + A          LQ        QR  +I  D +               S++++ ++I
Sbjct: 257 GEEVA----------LQ--------QRSHSISMDSL------LTGNDETSHSMSELNNNI 292

Query: 369 KALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETIS 428
             L  +L +E   K +L+ Q+  F+ ELE+  P + SFK+++E  + ++      LE ++
Sbjct: 293 SILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVT 352

Query: 429 LAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDEL 488
             K    +E+   ++++         L ++R DLARQ++ LLLN   V+    PL++ E 
Sbjct: 353 KDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLN-GFVKDSDDPLTSSEF 411

Query: 489 ISLKKLL----ESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENH 544
             +K++L    E G+  +  DSQ+II++R+++F +  ELQ++N+ LL+ VR L+D+ E  
Sbjct: 412 SYIKEILNTDPEEGNTSS-TDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETL 470

Query: 545 EGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILS 585
           E K +   +    + I EAK  +++L+  NS+LE++++ L+
Sbjct: 471 ERKLESGDSI---EAINEAKQTLLDLQQYNSSLEAKVESLT 508

 Score = 37.7 bits (86), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 113/284 (39%), Gaps = 67/284 (23%)

Query: 1430 NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLK 1489
            ++E L+KQW               E + K+R+ L  +E+  +++  + +ELE++FQ +++
Sbjct: 1399 DIETLQKQW---------------EASNKERLVLLYKEKSDQMMRAKMDELEEQFQNRVR 1443

Query: 1490 ANSGSFTLSSDKKENEVNAEDDLWNSPSKGNSEKPSVVTNLIRQKNLILQEQLKNPKKGI 1549
                        KE E+NA  D      K   E   +    ++++     +Q    K  I
Sbjct: 1444 -----------NKEKELNALKDEIEEKCKTGHEDTLIA---VKKRAFEEGKQQATMKMSI 1489

Query: 1550 ISN-------DSRPTSSNKE----NDIPGSTTAENKAPLAFNFGKPLFPSNTSSF---QS 1595
            +         +S+ T S  +     D P   T  N      N  +P   +  S F    S
Sbjct: 1490 LERKIAKLEAESKATKSGSDMSVSEDAPRFVTPNNNKVQQAN--QPFLATAGSGFSVQSS 1547

Query: 1596 FQNPFTPAAT--------SFNTGVSPVF--NIKPALAVDATV----DTFKTPGLN-DAGT 1640
              NPFT   +        S  +  +P F  N +P + V  +     DT +   ++ DAGT
Sbjct: 1548 ESNPFTTPVSRGAAHTNASSQSKFAPTFLLNSQPPVLVSGSSDEDNDTMRGTSVDEDAGT 1607

Query: 1641 NEAKIIEIGNNSLKRPIENEVSFDTDSKK---VKENSDNDQVSE 1681
                + E  NN  KRP E E +  + SKK   V E S  D   +
Sbjct: 1608 AVPSLNE--NN--KRPGEGESNLKSPSKKTRSVSEESSGDSTGD 1647

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 76.3 bits (186), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 193/364 (53%), Gaps = 37/364 (10%)

Query: 365 FSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLL 424
            ++I  +K +LIKE+ +K  L+ +   F+ ++E K P L     +  S+E E  N   + 
Sbjct: 280 INNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYL-----QNNSVENETNNGNKIE 334

Query: 425 ETISLAKRKDEK-ELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASP- 482
           E   + +    K E  SL+ K+N+ E+ + +L++QR DL  Q+  LL+  S + +  +  
Sbjct: 335 EQKIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKI 394

Query: 483 LSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLE 542
           L+ +EL  ++ L+         ++Q II+ERL++F+N ++L  KN++L++ VR L +K+E
Sbjct: 395 LTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKME 454

Query: 543 NHEGKQDKSLAKLEN--QTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGN 600
           + E +  +    LE   ++I EAK  +I L+  N   +  I+ +  E+   KLL     +
Sbjct: 455 SIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEENVKNKDIINQIISEK---KLLE----D 507

Query: 601 KIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEF 660
           KI+   +  TE   L K  E++ E +L  +E    +Q+ N+ LL     + N Q+++ E 
Sbjct: 508 KIHGLNSTVTE---LNKSMEIKREPTLKNLE----LQKTNQSLL-----EKNNQLSI-EI 554

Query: 661 SNF----KVLAIEKENLL---QTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNK 713
           SN     K+L  EK +LL    T + +LK+++     S+  S  G+  ++ +EL   K K
Sbjct: 555 SNASNENKILK-EKFDLLIKSYTELKELKSEISTYTKSSVISKDGNETAKISELVDLKAK 613

Query: 714 TKSL 717
            K+L
Sbjct: 614 CKNL 617

 Score = 41.2 bits (95), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 95/235 (40%), Gaps = 13/235 (5%)

Query: 1416 ATGKNTGATIENGENMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISK 1475
            A   NT +   + +N+  +K+ W K+Y+     RI++AE     R R   E+  ++ +SK
Sbjct: 927  AKDVNTDSIELSDDNISTMKEAWEKEYQHILKIRIEDAENQAMARTRKELEKEYEERLSK 986

Query: 1476 RKEELEQEFQRKLKANSGSFTLSSDKKENEVNAEDDLWNSPSKGNSEKPSVVTN------ 1529
              E+L  ++  KLK +     L  DKK   +  E  L N   +   E    +        
Sbjct: 987  ESEKLSDQYNNKLKDDLSEELLKIDKKY-AMELETKLKNETDESKKEFQDALGTEQTKNK 1045

Query: 1530 LIRQKNLILQEQLKNPKKGIISNDSRPTSSNKENDIPGSTTAENKAPLAFNFGKPLFPSN 1589
            ++ +K   L+ Q+K  K     + S P  S+++  IP +T         F FG+  F SN
Sbjct: 1046 ILSKKIEFLETQIKELKDEQTKHHSNPMKSDEK--IPSTTN----LSTNFAFGQNPFVSN 1099

Query: 1590 TSSFQSFQNPFTPAATSFNTGVSPVFNIKPALAVDATVDTFKTPGLNDAGTNEAK 1644
             S      N F   +          F        ++++    T   N   +NE+K
Sbjct: 1100 ASQNAYMSNVFLSGSPFSRNAPEKAFKHSTPDNTNSSITVQPTLTFNTDFSNESK 1154

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 128/253 (50%), Gaps = 11/253 (4%)

Query: 365 FSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLL 424
           F D   LK+++ K   Q+  LQ ++E  I ELE   PEL +  ++   LE  L    +  
Sbjct: 295 FCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLLSKEKNTS 354

Query: 425 ETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLS 484
           E      ++ E E  ++  ++   +  I +L ++  DL  Q++ +L++ S    K   L+
Sbjct: 355 EHFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELT 414

Query: 485 NDELISLKKLLESGDVP--NE-KDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKL 541
            +E+  +K L E G     NE  +SQ II++RL+ F +   LQ+KNMEL+  +R++  KL
Sbjct: 415 ENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKL 474

Query: 542 ENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLAS-ANG- 599
           +N E +         +  + EAK+ I+++   +  L+ +I  L ++ ++ + ++   NG 
Sbjct: 475 DNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGH 534

Query: 600 ------NKIYADA 606
                 NK+Y + 
Sbjct: 535 ESVLAENKLYTEG 547

 Score = 34.7 bits (78), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 23/30 (76%)

Query: 1288 FNRLKKQAHEKLDASKKQQTALTNEVDELK 1317
            FNRLKKQA+ +L +SK++Q AL  ++  LK
Sbjct: 991  FNRLKKQANARLHSSKEEQNALNEQISSLK 1020

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 56.2 bits (134), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 137/285 (48%), Gaps = 19/285 (6%)

Query: 183 LILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQNK 242
           L+  N KW+ E+L  RD+K  + D     +    + +L  + N    +    +FL++ N+
Sbjct: 33  LLENNYKWLNERL-VRDQKNYLIDTHDVKYSSKNDNKLYNSHNKL--LELQKEFLISHNE 89

Query: 243 QLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSAREKD 302
           +LS  + +  +E  +  ++V I+  +  K + L          +L    + YS+  +++ 
Sbjct: 90  KLSDRLNENSIEFNDKFNSVVIDNLNNEKNLIL-------FEKKLNLLNERYSIIIKDQK 142

Query: 303 N--DDPCKNSQH---ANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNV 357
           +  D+   NS++    ++ +K+I     ++  + + ++L  I+ + I+ +E   +NT+  
Sbjct: 143 DVIDNDINNSKYLEFKSLNEKIIKQNSNMKSMESKIEKLNAIIHNFIDINEFDNENTNKY 202

Query: 358 DPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQEL 417
              +N    D K LK+ L+ E+N   +LQ ++ S + EL  K P L S KE+   L+   
Sbjct: 203 SLDLN----DNKVLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVF 258

Query: 418 KNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDL 462
           +N     E +      +  ++ S+  KI + E ++  L+ QR +L
Sbjct: 259 ENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSLKQLLSQRTNL 303

 Score = 33.5 bits (75), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 24/31 (77%)

Query: 1288 FNRLKKQAHEKLDASKKQQTALTNEVDELKD 1318
            F+RLK+QA+E+L+ASK  Q  L++ V  L+D
Sbjct: 671  FSRLKRQANERLNASKTTQKELSDNVKSLED 701

>Ecym_4504 Chr4 (1009783..1011774) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ACL174W
          Length = 663

 Score = 40.4 bits (93), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%)

Query: 521 NELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAK 564
           N++   N E+  CV +L  K+ NHEGK   ++ +L+N+ + E K
Sbjct: 535 NQMMRYNKEIFECVVILGIKIPNHEGKAGFAVVQLKNEYLMEDK 578

>Kpol_529.20 s529 (59125..61998) [2874 bp, 957 aa] {ON} (59125..61998)
            [2874 nt, 958 aa]
          Length = 957

 Score = 36.2 bits (82), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 95/190 (50%), Gaps = 12/190 (6%)

Query: 826  NMKSLSTDLSEKKTTIRKLS--LEMKDLEI-ELQKT--KLQYKLLNNSSDANTLETALKK 880
            N K+ S  +SE      KL+  +++KD+EI +L +T  +L+ K L    D + L   L+ 
Sbjct: 350  NTKNYSNLISEINLKFEKLNENIKLKDIEINKLNETISELKNKDLQGKYDKDLLNEKLRL 409

Query: 881  ELE---RSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNA 937
            ++E   + + DLK  + +I+ YEEII+  + T+ EL     +    +K  +  LD     
Sbjct: 410  QVEQNNKDEDDLKILNGKIKEYEEIINNSKCTISELQANFNEANNTIKNLNAKLDSFVKN 469

Query: 938  KEEEISFLRRELDEIRGLQPKLKEGALRLVQQSEKLGNQTQRIQAMNEKI----DKMTTI 993
             EE  S L  +  EI  L  K  +  L +   +EKL   T +I  M+E +    DK++++
Sbjct: 470  LEEANSELSNKDKEINELTLKSTQQKLSIETFNEKLVTNTSQISVMSENLKEERDKLSSL 529

Query: 994  VELHQEVETS 1003
             +L Q  E S
Sbjct: 530  NDLLQTSEAS 539

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 35.8 bits (81), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 78/145 (53%), Gaps = 18/145 (12%)

Query: 317 DKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNT-HNVDPSVNKVFSDIKALKRQL 375
           +KL D K  L+++K   + L+        +D+  F N   N++  + ++ S+ + LK + 
Sbjct: 274 EKLADYKRDLDQAKANLKSLR--------KDKKPFSNAKQNLEERL-EILSNKRDLKDKQ 324

Query: 376 IKERNQKFQ-LQNQMESFIKELERKTPELISFKERTESLEQ-------ELKNSTDLLETI 427
           +KE    ++ ++ ++ES  +E+E+K  ++  ++ RT+ LE+       EL+N   LLETI
Sbjct: 325 LKEDQASYRRVEQELESIREEIEKKEQQIEYYRNRTKKLEETAAKTREELENKYKLLETI 384

Query: 428 SLAKRKDEKELTSLRQKINNCEANI 452
            L  +    E+TS R  +   EAN+
Sbjct: 385 ELPSQSVFDEITSQRHDLILREANL 409

>Kpol_1073.8 s1073 complement(10633..11919) [1287 bp, 428 aa] {ON}
            complement(10633..11919) [1287 nt, 429 aa]
          Length = 428

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 6/74 (8%)

Query: 1591 SSFQSFQNPFTPAATSFNTGVSPVFNI-KPALAVDATVDTFKTPGLNDAGTNEAKIIEIG 1649
            +S QSF+ P  P  T+F  G SP+ +I  P+LA+ +  +  + P L    T+        
Sbjct: 209  TSLQSFRTPILPQKTAFEDGPSPILSINSPSLALFSQSN--QLPPLPRISTSRKS--SFA 264

Query: 1650 NNSLKRPIENEVSF 1663
            NN+ K PI  + SF
Sbjct: 265  NNA-KSPIVRDTSF 277

>Smik_15.485 Chr15 (834349..837717) [3369 bp, 1122 aa] {ON} YOR304W
           (REAL)
          Length = 1122

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 65/143 (45%), Gaps = 21/143 (14%)

Query: 325 QLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQ 384
           +LEK   E Q   N   D  EEDE    N       ++K FS+    KR  +   N   +
Sbjct: 856 ELEKRIQEQQEKINSAPDFTEEDELQKQNL------ISKAFSNWN--KRDFMAFINACAK 907

Query: 385 L-QNQMESFIKELERKTPELIS-----FKERTESLEQELKNSTDLLETISLAKRKDEK-- 436
             ++ M+S    ++ KTPE +      F ER     +E+      L  I L ++K++K  
Sbjct: 908 YGRDDMKSIKTSIDSKTPEEVEKYAKVFWERL----REINGWEKYLHNIELGEKKNDKLK 963

Query: 437 -ELTSLRQKINNCEANIHSLVKQ 458
            + T LRQKI  C+  +H LV Q
Sbjct: 964 FQETLLRQKIEQCKHPLHELVIQ 986

>SAKL0C13750g Chr3 complement(1210007..1211494) [1488 bp, 495 aa] {ON}
            similar to uniprot|Q08287 Saccharomyces cerevisiae
            YOL144W NOP8 Nucleolar protein required for 60S ribosomal
            subunit biogenesis
          Length = 495

 Score = 34.3 bits (77), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 58/106 (54%), Gaps = 7/106 (6%)

Query: 960  KEGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALV 1019
            KE   +L+++S++  N  + +     K ++++  ++  + ++TS+ Q  +  + D     
Sbjct: 372  KENVFKLIEESDEDINHDKDL-----KKEQISNAIQEQENLQTSELQ--ITKHNDKGLFF 424

Query: 1020 LRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYEREL 1065
              LE+  L  Q +L K K+++HS Q++    ++++ + +A + RE+
Sbjct: 425  PHLESPFLVSQAQLSKIKNAMHSEQDIFASWDQQFWDNRATWTREM 470

>YOR304W Chr15 (884514..887876) [3363 bp, 1120 aa] {ON}
           ISW2ATP-dependent DNA translocase involved in chromatin
           remodeling; ATPase component that, with Itc1p, forms a
           complex required for repression of a-specific genes,
           INO1, and early meiotic genes during mitotic growth
          Length = 1120

 Score = 34.3 bits (77), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 12/81 (14%)

Query: 386 QNQMESFIKELERKTPELIS-----FKERTESLEQELKNSTDLLETISLAKRKDEK---E 437
           ++ ME+  K ++ KTPE +      F ER     +E+      L  + L ++K+EK   +
Sbjct: 908 RDDMENIKKSIDSKTPEEVEVYAKIFWERL----KEINGWEKYLHNVELGEKKNEKLKFQ 963

Query: 438 LTSLRQKINNCEANIHSLVKQ 458
            T LRQKI  C+  +H L+ Q
Sbjct: 964 ETLLRQKIEQCKHPLHELIIQ 984

>TDEL0F04210 Chr6 complement(776529..777608) [1080 bp, 359 aa] {ON}
            Anc_8.294 YLR105C
          Length = 359

 Score = 33.5 bits (75), Expect = 4.9,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 3/89 (3%)

Query: 1444 EETMRRIKEAEENLKKRI---RLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLSSD 1500
            E T+ RI E+  +  K +   R+  + R+Q++  KRK    +++   L+   GS    ++
Sbjct: 93   ERTVTRINESMGDGSKNLALERITEKRRLQRLEFKRKRVEFEKYILDLRRQGGSIEQETE 152

Query: 1501 KKENEVNAEDDLWNSPSKGNSEKPSVVTN 1529
              E +  A  D   S  K NSE+  ++ N
Sbjct: 153  VLEKQRQALRDFKASQDKDNSEEEIILYN 181

>NCAS0C05160 Chr3 complement(1050360..1051586) [1227 bp, 408 aa] {ON}
            Anc_2.639
          Length = 408

 Score = 33.5 bits (75), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 1587 PSNTSSFQSFQNPFTPAATSFNTGVSPVFNI 1617
            PS  ++ QSF+ P  PA+ +F+ G SPV ++
Sbjct: 205  PSKKNTLQSFKTPIIPASRTFDDGPSPVLSM 235

>KNAG0A06105 Chr1 complement(927040..928053) [1014 bp, 337 aa] {ON}
          Length = 337

 Score = 33.1 bits (74), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%)

Query: 82  RLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERGVKEEAEVLKAEHQNNDLER 139
           R   LL+ +  K  R++D+L +QL A +N    L   R +K+ A+ +KA H   D++R
Sbjct: 172 RKRKLLQAQLDKLDRQVDSLEEQLVAIENANLNLETVRAMKQGAKAMKAIHNGIDIDR 229

>TDEL0C03260 Chr3 complement(577094..580288) [3195 bp, 1064 aa] {ON}
           Anc_7.462 YPR042C
          Length = 1064

 Score = 33.5 bits (75), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 7/88 (7%)

Query: 401 PELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRL 460
           PEL S       +++   +S+D+++ I L  RK  K LTS+    N   A      ++ +
Sbjct: 629 PELSSDYLGNTIVQKLFTHSSDIIKDIML--RKTSKYLTSMGVHKNGTWA-----CQKMI 681

Query: 461 DLARQVKLLLLNISAVQKKASPLSNDEL 488
            +AR  + ++L    V+K  +PL ND+ 
Sbjct: 682 TMARTPRQIMLVTKGVEKYCTPLFNDQF 709

>TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {ON}
           Anc_4.238 YDL058W
          Length = 1794

 Score = 33.1 bits (74), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 879 KKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLD---EEN 935
           +KEL+   I+LK      E  E+I S   N ++ LND+LT+ KE+L +  ++LD   +E 
Sbjct: 824 QKELKDLTINLKVVSEAKENLEKINSQQSNKMERLNDELTQNKEKLSILHKTLDTLKKEK 883

Query: 936 NAKEEEISFLRREL 949
              EE I+ + REL
Sbjct: 884 AKAEEGINKMGREL 897

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.124    0.320 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 173,199,051
Number of extensions: 8202500
Number of successful extensions: 72211
Number of sequences better than 10.0: 3047
Number of HSP's gapped: 65019
Number of HSP's successfully gapped: 6599
Length of query: 1682
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1558
Effective length of database: 39,262,815
Effective search space: 61171465770
Effective search space used: 61171465770
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)