Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.385.703ON56956930550.0
Smik_9.195.703ON57257226390.0
YIL150C (MCM10)5.703ON57157126140.0
Skud_9.185.703ON57157125940.0
NCAS0G002205.703ON59257716110.0
KAFR0D022105.703ON58458715430.0
TDEL0B021705.703ON56757714950.0
NDAI0F002805.703ON61061314310.0
ZYRO0G06578g5.703ON56957714260.0
KNAG0L021505.703ON61661614300.0
CAGL0H06589g5.703ON58359713770.0
Kpol_1043.715.703ON58558913750.0
TPHA0E002105.703ON54455513401e-180
TBLA0G010205.703ON59460513091e-174
KLTH0E01034g5.703ON58356011981e-158
SAKL0E14938g5.703ON57458511971e-158
Kwal_55.196915.703ON46647210881e-143
AFR287W5.703ON6116169791e-125
KLLA0A00572g5.703ON5775839111e-115
CAGL0D04994g3.479ON692164810.30
KAFR0A074102.91ON353128780.64
NCAS0G020302.91ON35799761.0
ZYRO0B05786g3.124ON299457771.2
SAKL0H03344g4.236ON885118742.1
Kpol_1055.894.236ON75360723.7
TPHA0C037902.369ON49086714.2
SAKL0H22858g4.138ON73688715.0
Ecym_45345.601ON23858695.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.38
         (569 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...  1181   0.0  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...  1021   0.0  
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...  1011   0.0  
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...  1003   0.0  
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   625   0.0  
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   598   0.0  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   580   0.0  
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   555   0.0  
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   553   0.0  
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   555   0.0  
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   535   0.0  
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   534   0.0  
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   520   e-180
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   508   e-174
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   466   e-158
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   465   e-158
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   423   e-143
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   381   e-125
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   355   e-115
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...    36   0.30 
KAFR0A07410 Chr1 (1496247..1497308) [1062 bp, 353 aa] {ON} Anc_2...    35   0.64 
NCAS0G02030 Chr7 complement(366089..367162) [1074 bp, 357 aa] {O...    34   1.0  
ZYRO0B05786g Chr2 complement(457353..466337) [8985 bp, 2994 aa] ...    34   1.2  
SAKL0H03344g Chr8 (318176..320833) [2658 bp, 885 aa] {ON} simila...    33   2.1  
Kpol_1055.89 s1055 (228896..231154) [2259 bp, 753 aa] {ON} (2288...    32   3.7  
TPHA0C03790 Chr3 complement(822142..823614) [1473 bp, 490 aa] {O...    32   4.2  
SAKL0H22858g Chr8 (1988530..1990740) [2211 bp, 736 aa] {ON} simi...    32   5.0  
Ecym_4534 Chr4 (1055903..1056619) [717 bp, 238 aa] {ON} similar ...    31   5.2  

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score = 1181 bits (3055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/569 (100%), Positives = 569/569 (100%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 61  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKR 120
           VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKR
Sbjct: 61  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKR 120

Query: 121 NEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALHEI 180
           NEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALHEI
Sbjct: 121 NEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALHEI 180

Query: 181 KILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHSL 240
           KILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHSL
Sbjct: 181 KILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHSL 240

Query: 241 DVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEIGS 300
           DVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEIGS
Sbjct: 241 DVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEIGS 300

Query: 301 SRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPTKV 360
           SRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPTKV
Sbjct: 301 SRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPTKV 360

Query: 361 DSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLA 420
           DSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLA
Sbjct: 361 DSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLA 420

Query: 421 NLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQR 480
           NLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQR
Sbjct: 421 NLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQR 480

Query: 481 LGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRS 540
           LGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRS
Sbjct: 481 LGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRS 540

Query: 541 HREEVWQRHFGSKETEVASDASGSDLEIV 569
           HREEVWQRHFGSKETEVASDASGSDLEIV
Sbjct: 541 HREEVWQRHFGSKETEVASDASGSDLEIV 569

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score = 1021 bits (2639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/572 (85%), Positives = 528/572 (92%), Gaps = 3/572 (0%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           MDDPREILAVDPYN+VTSDEEDEQAIAKELEFMERK+QALMERLKRKQ FKKP DPNFEA
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 61  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQ-QSQ-ESPSNTTTYFMQKFQDA 118
           +EVPQSP K  +   SQ+A+KQ  R   SN NES LSQ Q Q E P NTTTYFMQKFQ+A
Sbjct: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120

Query: 119 KRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALH 178
           K++ED+QIAK+E MM+ARVHTFGTDNK+YKPII NELE FSNLWVKKRYIPE+DLKR+LH
Sbjct: 121 KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 180

Query: 179 EIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 238
           EIKILRL KLFAK+RPPKFQ P+YANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 181 EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 239 SLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 298
           +LDVYIFGKKGVERYYNLRLGD+IAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 241 TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 299 GSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPT 358
           GSSRDLGWCPIVN KTHK CGSPIN ++H CCDYHREVQFRGT AKRIELNGGYALGAPT
Sbjct: 301 GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 359 KVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDM 418
           KV+SQPSLY+AKGEN+FNI+R  RKGLSEEEER+K++SHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 361 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 419 LANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLI 478
           LANLD+KRRKI DTKKS AL+REL KIMRRK+SSGLEDKS+GEKQKMKQTTE+ALQTGLI
Sbjct: 421 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 480

Query: 479 QRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKK 538
           QRLGFDPTHG+ISKVLKSSVPGGES  N +NGKKTVINDLL YKKEKVILAPSKNEWFKK
Sbjct: 481 QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 539 RSHREEVWQRHFGSK-ETEVASDASGSDLEIV 569
           R+HREEVWQRHFG K E E ASDAS SDLEI+
Sbjct: 541 RNHREEVWQRHFGPKGEAEEASDASASDLEII 572

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score = 1011 bits (2614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/571 (84%), Positives = 525/571 (91%), Gaps = 2/571 (0%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           M+DPREILAVDPYNN+TSDEEDEQAIA+ELEFMERK+QAL+ERLKRKQ+FKKP+DPNFEA
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 61  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQES--PSNTTTYFMQKFQDA 118
           +EVPQSP K  +   S +A +Q  +   SNINE  LSQ  Q+   P++TTTYFM+KFQ+A
Sbjct: 61  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120

Query: 119 KRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALH 178
           K+NEDKQIAK+E MMNARVHTF TD K+Y PIITNELESFSNLWVKKRYIPE+DLKRALH
Sbjct: 121 KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 180

Query: 179 EIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 238
           EIKILRL KLFAKIRPPKFQEP+YANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 181 EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 239 SLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 298
           +LDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 241 TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 299 GSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPT 358
           GSSRDLGWCPIVNKKTHK CGSPIN ++H CCDYHREVQFRGT AKRIELNGGYALGAPT
Sbjct: 301 GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 359 KVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDM 418
           KVDSQPSLY+AKGEN FNI++ TRK LSEEEER+K++SHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 361 KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 419 LANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLI 478
           LANLD+KRRKII+TKKSTALSRELGKIMRR++SSGLEDKS GE+QKMK+TTESALQTGLI
Sbjct: 421 LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 480

Query: 479 QRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKK 538
           QRLGFDPTHGKIS+VLKSSV G E   N +  KKTVINDLL YKKEKVILAPSKNEWFKK
Sbjct: 481 QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 539 RSHREEVWQRHFGSKETEVASDASGSDLEIV 569
           RSHREEVWQ+HFGSKET+  SD S SDLEI+
Sbjct: 541 RSHREEVWQKHFGSKETKETSDGSASDLEII 571

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/571 (84%), Positives = 519/571 (90%), Gaps = 2/571 (0%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           MDDPRE L  DPYNNVTSDE+DEQ IAKELEFMERKKQAL+ERLKRKQ+FK+ EDPNFEA
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 61  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQ--QSQESPSNTTTYFMQKFQDA 118
           +EVPQSPAK   + KSQ+ +K+ +RP ASNIN+  LSQ  Q QE PSNTT YFMQKFQ+A
Sbjct: 61  IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDLKLSQLQQKQELPSNTTGYFMQKFQNA 120

Query: 119 KRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALH 178
           KRNE+KQ AKYE MMNARVHTFGTD KEY+  I NELE FSN+WVKKRYIPE+DLKRALH
Sbjct: 121 KRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEEFSNIWVKKRYIPEDDLKRALH 180

Query: 179 EIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 238
           EIKILRL KLFAKIRPPKFQEPDYANWA VGLISHKSD+KFTSS+KP KFFMFTITDFQH
Sbjct: 181 EIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDFQH 240

Query: 239 SLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 298
           +LDVYIFGKK VERYYNLRLGDVIAILNPEVLPWRPSG+GNFIKSFNLRISHDFKCILEI
Sbjct: 241 TLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCILEI 300

Query: 299 GSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPT 358
           GSSRDLGWCPIVN+K +++CGSPIN  +H CCDYHREVQFRGT AKRIELNGGYALGAPT
Sbjct: 301 GSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 359 KVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDM 418
           KVD+QP+LYRAKGEN FN+VRS RK LSEEEER+K+NSHNF NSNSAKAFFDEKFQNPDM
Sbjct: 361 KVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDM 420

Query: 419 LANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLI 478
           LANLDSKRRKIID+KKSTALSRELGKIMRRK SSGLEDK + EKQK+KQTTESALQTGL+
Sbjct: 421 LANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLL 480

Query: 479 QRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKK 538
           QRLGFDPTHGKISKVLKSSVPGGE     + GKKTVI+DLL YKKEKVILAPSKNEWFKK
Sbjct: 481 QRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKK 540

Query: 539 RSHREEVWQRHFGSKETEVASDASGSDLEIV 569
           RSHREEVWQ+HFGSK+T+  SDAS SDLEIV
Sbjct: 541 RSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/577 (54%), Positives = 426/577 (73%), Gaps = 23/577 (3%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           M+DPRE+L  DPY+NV+SDE+DE+AI ++LE +ERK+Q L+ R+K KQ+ KK  DPNF+ 
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 61  VEVPQSPAKKS------IVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQK 114
           ++VP SP KK+       +KKS + ++        N NE  + ++S + PSNTTTYFM+K
Sbjct: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIP----HENPNELRIREKSGQLPSNTTTYFMEK 116

Query: 115 FQDAKRNEDKQIAKYEGMMNARVHTFGTDN--KEYKPIITNELESFSNLWVKKRYIPEED 172
           FQ +K+ E+ +I K E MMNARVHTF      +E+KPI  NE+E +SN+W+KKRYIP+ +
Sbjct: 117 FQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSE 176

Query: 173 LKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFT 232
           L++ LH IKILRL+KLFAK+RPPKF EP Y+NWA +G+IS K D KFT+++KP K+  FT
Sbjct: 177 LRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFT 236

Query: 233 ITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDF 292
           +TDFQH LDVYIFGK GVERYYNLR+GDVIAILNPEV PWRPSG+G FIKSFNLRI+HDF
Sbjct: 237 MTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDF 296

Query: 293 KCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGY 352
           KCILEIGSS+DLG+C + + +    C +PIN +    CDYH+E++FR   +KRIELNG +
Sbjct: 297 KCILEIGSSKDLGFCKVTS-RNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSF 355

Query: 353 ALGAPTKVDSQPSLYRAK-GE------NQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSA 405
           ALGAPTKV++ P+LYR K GE      N+ N   S   G   +++   RN H F+N+NSA
Sbjct: 356 ALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNRH-FSNNNSA 414

Query: 406 KAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKM 465
           KAFFDEKFQNPDML NL+SKRRKI D KK T + +EL K +  + S  L ++S  E ++M
Sbjct: 415 KAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQM 474

Query: 466 KQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGE--SMPNRINGKKTVINDLLQYKK 523
           K+ TE+ LQ+G+IQRLGFDPTHGKI+ VL+++    E  ++  +++GKK  +NDLL ++K
Sbjct: 475 KRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRK 534

Query: 524 EKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVASD 560
             VILAP++NE  ++R  RE +WQ +FG K   ++++
Sbjct: 535 SHVILAPTRNELIERRDRRERIWQENFGQKRKPISAN 571

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/587 (52%), Positives = 408/587 (69%), Gaps = 21/587 (3%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           M DPREI   D Y N+T D+ED + I  ELE +E  K+ L+ERL RK+   +  DPNF  
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 61  VEVPQSPAKK---SIVKKSQDALKQAIRPVASN--INESMLSQQSQESPSN------TTT 109
           V+VP SP KK    +V++    LK   R   SN   NE  L Q+ Q+  +       +T 
Sbjct: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120

Query: 110 YFMQKFQDAKRNEDKQIAKYEGMMNARVHTF-GTDNK-EYKPIITNELESFSNLWVKKRY 167
           YFM+KF+DAKR E   I K+E MM +RVHTF G + K EY+ +I +ELE +SNLW+ KRY
Sbjct: 121 YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180

Query: 168 IPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVK 227
            P  +LK  LHE+KILRLNKLFAK+RPPKF+EP Y+NW  VG++S KSDIKFT+S KP K
Sbjct: 181 TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240

Query: 228 FFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLR 287
           +  FT+TDF+H +D YIFGK+GVERYYNLR+GD+IA+LNPE+LPWRPSG+ N+IKSFNLR
Sbjct: 241 YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNLR 300

Query: 288 ISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIE 347
           ISH +KCILEIG SRDL  CPIV + T K CG PIN  V  CC+YHRE++ R   +KR++
Sbjct: 301 ISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRLD 360

Query: 348 LNGGYALGAPTKVDSQPSLYRAKGE-----NQFNIVRSTRKGLSEEEERVKRNSHNFTNS 402
           L+G YALGAPTK++SQP+LYR           F +  S  +      ++    S  F+N 
Sbjct: 361 LSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKFFSNR 420

Query: 403 NSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEK 462
           N+AKAFFD++FQNPDM++NLD+KRRKI++ +KS  L+REL +++R+     LE K+  E 
Sbjct: 421 NAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRK--DQDLEGKTREEV 478

Query: 463 QKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYK 522
           +KMKQTT+  LQ+GL Q++GFDPT GKIS++LK+     +  P  ++ K   ++DL+ +K
Sbjct: 479 EKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMAFK 538

Query: 523 KEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVASDASGSDLEIV 569
           KE +ILAPSK +   K++ RE+VWQ +FG  ++   S+ S SDLEIV
Sbjct: 539 KEYIILAPSKVDLLNKKNKREKVWQENFGQNKSNDNSE-SDSDLEIV 584

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/577 (51%), Positives = 412/577 (71%), Gaps = 18/577 (3%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           M+DPRE++  DP+  +TSDEED++ +  ++  +ER+K+ L+ERLK K+  K  +DPNF+A
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKS-KDPNFDA 59

Query: 61  VEVPQSPAKKSI--VKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDA 118
           ++V  SP KK    +K      K+ +     N+NE  +  +SQ  P+NTT+YF+  F+++
Sbjct: 60  IQVESSPVKKPAESIKVEPSRTKRVLD--IENLNEKKVESRSQ-IPANTTSYFIDNFRNS 116

Query: 119 KRNEDKQIAKYEGMMNARVHTF-GTD-NKEYKPIITNELESFSNLWVKKRYIPEEDLKRA 176
           K+ E K   + + +++ RVHTF G D N ++K +   E+E +S+LWVK+RYI ++DL++ 
Sbjct: 117 KKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLRKV 176

Query: 177 LHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 236
           LHE+KILRL+KLFAKI+PPKF EP Y+NWA +G+IS K  +KF+SS KP+K+F FT+TDF
Sbjct: 177 LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236

Query: 237 QHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 296
           Q++LDVY+FGKKGVERYYNLR+GD++AILNPEVLPWRPS +GNFIKSFNLRISHDF CIL
Sbjct: 237 QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296

Query: 297 EIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGA 356
           EIG SRD+ WC   NK  +K+CG+PIN     CCD+HRE+QFR   AKRIELNG +ALGA
Sbjct: 297 EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356

Query: 357 PTKVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSH----NFTNSNSAKAFFDEK 412
           PTKVDS P+LYR K        R+ +   +  ++ V +NS     +F+N N+AKAFF+++
Sbjct: 357 PTKVDSGPALYREKSAGAH---RNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKAFFNDE 413

Query: 413 FQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESA 472
           FQNPD+L NLDSKRRK  D KKS  L ++L +I  R  +  +E K   + +++ +TTE+ 
Sbjct: 414 FQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTEAT 472

Query: 473 LQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSK 532
           LQ+GLIQ LGFDPTHG+I  VLK +    +S   ++N K+  ++ LL++KKE V L P+K
Sbjct: 473 LQSGLIQNLGFDPTHGEIGNVLKQAAK-DKSNNGQLNKKQKEVSSLLKFKKEHVELKPAK 531

Query: 533 NEWFKKRSHREEVWQRHFGSKETEVASDASGSDLEIV 569
               +++  RE  WQ +FG K   ++SD S SD+EIV
Sbjct: 532 EVLLQRKRDRERAWQENFGDKSVNLSSD-SDSDIEIV 567

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/613 (48%), Positives = 411/613 (67%), Gaps = 47/613 (7%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           M+DPRE    DP+ +++  EE+E A+ +ELE ++R+K  L+ RLK  ++ +K  DPNF+ 
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 61  VEVPQSPAKKS--IVKKSQDALKQAIRPVAS------------NINESMLSQQSQ---ES 103
           V++P +P +K+  I    Q  L+   R                N NE  + ++ +   + 
Sbjct: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKL 120

Query: 104 PSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNK-------EYKPIITNELE 156
           PSNTT+YFM+KFQ  K+ E+ +  + E M+ ARVH F   NK       EY+P   NE+E
Sbjct: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 157 SFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSD 216
            +S L ++KRYIP+++L      IKILRLNKLFAK+RPPKF+EP Y+NW T+G+I+ K  
Sbjct: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 217 IKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG 276
           IKFTSS+KP K+F FTI+DF++++D++IF K  VERYYNLR+GD+IAILNPEVLPWRPS 
Sbjct: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300

Query: 277 --RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHK-SCGSPINTNVHMCCDYH 333
              G  IKSFNLRI+H++ CI+E+G S+DLG+CPI NK     +C +PI+ +    C YH
Sbjct: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360

Query: 334 REVQFRGTGAKRIELNGGYALGAPTKVDSQPSLYR-----AKG---ENQFNIVRSTRKGL 385
           +E++FR  G+KRIELNG +ALGAP KV +QP LYR      +G    N+FN+V+ +    
Sbjct: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420

Query: 386 SEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKI 445
           +E +   +R    F+++NSAKAFFDEKFQNPDML NLD+KRRKI D K+S  L +EL K 
Sbjct: 421 NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA 480

Query: 446 MRRKDSSGLE-DKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESM 504
           +  K S+ L  +K++ E  KMK  TE+ LQTG+IQRLGFDPTHGKI+KVL++   G +S 
Sbjct: 481 IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQT---GKDSG 537

Query: 505 PNRINGKKTV--INDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVAS--- 559
            + ++    V  + DLL++KK KV+LAP+K E  K+++ REEVWQ+HFGS +        
Sbjct: 538 KDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLN 597

Query: 560 ---DASGSDLEIV 569
              D S SDLEIV
Sbjct: 598 DDVDTSESDLEIV 610

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/577 (49%), Positives = 397/577 (68%), Gaps = 17/577 (2%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           M DPRE+L  D Y+ +TS+ E+E  I  ++  +ER+K+ L++RL  K+   KP DPN   
Sbjct: 1   MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 61  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQES-PSNTTTYFMQKFQDAK 119
           ++V  SP K +         +Q  R    N N + L  QSQE  P+NTT++F++K+  +K
Sbjct: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQIPANTTSFFIEKYSTSK 120

Query: 120 RNEDKQIAKYEGMMNARVHTFGTDNK--EYKPIITNELESFSNLWVKKRYIPEEDLKRAL 177
           R +D ++   E +++ RVHTF    +  EYKPI TNELE FSNLW+ KRYIP+E+ +   
Sbjct: 121 RKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSIF 180

Query: 178 HEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQ 237
             IKILRL+KLFAK++PPKF EP Y+NWA +GLIS+K ++KFTS+  P K+F FT+T+FQ
Sbjct: 181 ANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNFQ 240

Query: 238 HSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILE 297
           +S+D YIFGK+GVERYYNLR+GD+IAILNP+VLPWRPSG    IKSFNLRISH F+CILE
Sbjct: 241 YSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECILE 300

Query: 298 IGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAP 357
           IG+SRDLGWCP+ NK  ++ C +PIN +   CC+YHRE++FR T AKR+EL+G YALGAP
Sbjct: 301 IGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGAP 360

Query: 358 TKVDSQPSLYRAKGENQ----FNIVRSTRKGLSEEE-ERVKRNSHNFTNSNSAKAFFDEK 412
           T++D+QP+LYR  G +Q    +NI+ +   G S +E   +  N+ +F+N N+AKAFFDE+
Sbjct: 361 TRIDAQPALYRG-GSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFDER 419

Query: 413 FQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESA 472
           FQNP+ L NL++KRRK+ D +KS  L+REL    ++     ++ KS  E  ++K+TTES 
Sbjct: 420 FQNPETLRNLENKRRKLRDNRKSNILNREL----KKNSELDIKHKSAEEIDEIKRTTEST 475

Query: 473 LQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSK 532
           + +G+++ LGFDPT GKI+ V K      +  P  +  K + +  LL +KK+ V L PSK
Sbjct: 476 MGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKP--LTEKDSSVASLLSFKKDNVKLKPSK 533

Query: 533 NEWFKKRSHREEVWQRHFGSKETEVASDASGSDLEIV 569
               K++  RE VW+ HFGS   E   D S SDLEIV
Sbjct: 534 EILIKQKRRRERVWKEHFGSGGDE--KDDSDSDLEIV 568

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/616 (47%), Positives = 412/616 (66%), Gaps = 52/616 (8%)

Query: 3   DPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA-V 61
           DPR+++  DPY+N+TSDE++E  I +ELE MER+K+ L +RLK K+   KP D N +  V
Sbjct: 4   DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 62  EVPQSPAKKSIV--------KKSQDALKQAIRPVA------SNINESMLSQ----QSQES 103
           +VP SP K+S+         ++  +A+K+    +A       N+NE+  +Q      ++S
Sbjct: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123

Query: 104 PSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWV 163
            + TT+YF++KFQ +K+ E  +I   E M++ARVHTF   +KE++    NELE FS+LW+
Sbjct: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQFSDLWI 183

Query: 164 KKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSE 223
            KRYIP++ L+ +L ++K+LRLNKLFAK+RPPKFQEP Y+NWA + +IS KS++KFT+S+
Sbjct: 184 SKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSK 243

Query: 224 KPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG---RGNF 280
            P KF  FT+T+FQ  LD+++FG  GV+RYYNLR GD++A+LNPE+LPWRPSG   +   
Sbjct: 244 NPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQTTS 303

Query: 281 IKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRG 340
           IKSFNL+I+H FKCILEIG SRDLG+CP+  K +++ CGS IN      C+YHRE+Q R 
Sbjct: 304 IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQMRQ 363

Query: 341 TGAKRIELNGGYALGAPTKVDSQPSLYR-AKG-------------------ENQFNIVRS 380
             +KR++LNGG+ALGAPTKV +QP L+R A G                   E  +N  R 
Sbjct: 364 NSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWN-SRH 422

Query: 381 TRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSR 440
            + G SEE   +K     FT+SN+AKAFFD++FQNPDML NLD+KRRK+ D+KKS  L R
Sbjct: 423 GQGGSSEENYGLK--GKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDR 480

Query: 441 ELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLK---SS 497
           +L +++ + +     DK+  E   +K+TTE+AL TGLIQRLGFDPTHG+ + V+K   S 
Sbjct: 481 KLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSE 540

Query: 498 VPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEV 557
              G +    ++ K+ ++N+LL++K++K  L PS+ +   ++ HR EVW+  FG K T V
Sbjct: 541 RGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGTPV 600

Query: 558 AS----DASGSDLEIV 569
            S    +    DLEIV
Sbjct: 601 DSQPVDNDDSDDLEIV 616

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/597 (47%), Positives = 404/597 (67%), Gaps = 49/597 (8%)

Query: 2   DDPREILAVDPYNNVTSDE-EDEQAIAKELEFMERKKQALMERLK--RKQDFKKPEDPNF 58
           +DPRE+  +DPY +++ D+ E E  I +ELE +ERKKQ L+ RLK  +++   K  DPN 
Sbjct: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 59  EA------VEVPQSPAKKSIVKKSQDALKQAIRPVA---------SNINESMLSQQSQES 103
           +       VEVP+SP ++S+   +Q+ L+  +  V          +N NE  + ++  + 
Sbjct: 67  KNINSRGRVEVPRSPKRESL--PAQENLQHNVPQVTHNQAANNKKANPNEEDIVRKELDV 124

Query: 104 PSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTF--GTDNKEYKPIITNELESFSNL 161
            + TT+YF  KF+++K +E++ +  Y+ MM+AR HTF   T   + K I  +ELE +SN 
Sbjct: 125 VA-TTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNF 183

Query: 162 WVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTS 221
            +KKRYIP++++ + LH IKILRLNKLFAK+RPP F EP Y+NW  +G IS K D+K T+
Sbjct: 184 HIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTN 243

Query: 222 SEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFI 281
           + KPVK+F FT+TDF+H+LDVY+FGKK VERYYNLR+GD+IA+LNPE+LPWRPSG  N I
Sbjct: 244 AAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGI 303

Query: 282 KSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGT 341
           KSFNLRI HDF CILEIG+SRDLGWC +VN    K C SPINT    CC++HRE+Q R T
Sbjct: 304 KSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRST 363

Query: 342 GAKRIELNGGYALGAPTKVDSQPSLYRAKGENQFNIVRSTRKGLS---------EEEERV 392
            +KRIEL+G YALGAPTKV +QPS+Y+   +++ N   +  K  S         +E+E+ 
Sbjct: 364 ASKRIELSGSYALGAPTKVGTQPSIYKDNNKSR-NTNPAKHKMFSITGHGSKKEQEKEKH 422

Query: 393 KRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSS 452
           +  +H+F+N  +AKAFFD+ FQ+P +LANL+SKRRKI    K++ + R L K +  +D+S
Sbjct: 423 EIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALNGEDAS 478

Query: 453 GLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKK 512
             ++     KQ++K+ TE  LQTG+IQRLGFDP+ G+I+KVL  S  G ++    I+ K 
Sbjct: 479 QSKN-----KQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSR-GTKTDDPTISKKM 532

Query: 513 TVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVASDASGSDLEIV 569
            +INDL+ +KK+K+ L PS+    +KR  RE +W++HF        ++ S SDLEIV
Sbjct: 533 GLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQD------TNDSDSDLEIV 583

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/589 (47%), Positives = 399/589 (67%), Gaps = 36/589 (6%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           M+DPRE    D Y+N++SDE ++  I+++L+ +ER+KQ L+ERLK+K++ K   DPNF  
Sbjct: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 61  VEVPQSPAKKSIVKKSQDALKQAIRPV------ASNINESMLSQQSQESPSNTTTYFMQK 114
           V+VP SP K  +V+     LK   +P+             +      +S   TT+YFM+K
Sbjct: 59  VQVPSSPKKSRVVE-----LKPTSKPIDNNEEEEEENPNEVALMTKDDSNYGTTSYFMEK 113

Query: 115 FQDAKRNEDKQIAKYEGMMNARVHTF-GTDNK-EYKPIITNELESFSNLWVKKRYIPEED 172
           F ++K++ ++++  Y  MM++RVHTF GT +K E+KP   +EL+ +SNLW++ RYIP ++
Sbjct: 114 FYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDE 173

Query: 173 LKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFT 232
           L   L +IKILRL KLFAK+RPPKF EP Y+NW   G+I+ K DIK+TSS KP K+F FT
Sbjct: 174 LNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFT 233

Query: 233 ITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS----GRGNFIKSFNLRI 288
           I+DFQH+LDV+IFG KGVE+YYNLR+GDV+AILNPE+LPWRPS    G G+ IKSFNLRI
Sbjct: 234 ISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRI 293

Query: 289 SHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIEL 348
           SH F CILEIG+SRDLGWCPI N   +  C +PIN +    C YHRE+QFR T + R+EL
Sbjct: 294 SHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVEL 353

Query: 349 NGGYALGAPTKVDSQPSLYRAKG-------ENQFNIVRSTRKGLSEEEERVKRNSHNFTN 401
           +G YALGAPTKVD++P+LY+ +G       +  +N+V  +     ++  +++   H+F+ 
Sbjct: 354 SGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFST 413

Query: 402 SNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGE 461
            NSAKAFFDE FQNPD+L NLDSKRRKI D+K    + R L K ++        DK    
Sbjct: 414 MNSAKAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNLVKALK-----NTVDKESKN 464

Query: 462 KQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQY 521
            + +K  T++ LQTG++QRLGFDPT GK+S V+++S    E        KK  ++DL+ +
Sbjct: 465 FKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTF 524

Query: 522 KKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEV-ASDASGSDLEIV 569
           +K+ V L PSK++  K+R  R+  W++ FG +++ +  +D SGSDL+I+
Sbjct: 525 RKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQSSIDNNDDSGSDLKIL 573

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  520 bits (1340), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 272/555 (49%), Positives = 365/555 (65%), Gaps = 37/555 (6%)

Query: 41  MERLKRKQDFKKPEDPNFEAVEVPQSPAKKSI---VKKSQDALKQAIRPVASNINESMLS 97
           M+RLK K++ +K  DPNF  +++ +SP KK        +   LK+ +  V  N NE+ + 
Sbjct: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDV--NPNEAKVV 58

Query: 98  QQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDN--KEYKPIITNEL 155
             +   P+NTT+YFMQ F  AK+ E KQ+ +Y+  M++RVH+F   N  K+Y+ II  EL
Sbjct: 59  SNAN-LPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEEL 117

Query: 156 ESFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKS 215
           E +S   + KRY+P+E++ + LH IKILRLNKLFAKIRPPKF EPDYANWA  G+I  K 
Sbjct: 118 EEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKE 177

Query: 216 DIKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS 275
           DIK TSS+ PVKFF FTIT+FQH+LD++IFG  GVE+YYNLR+GD+I ILNPEVLPWRP 
Sbjct: 178 DIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPE 237

Query: 276 GRGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHRE 335
            +GN IKSFNLRISH F CILEI  S+D+ WC  +N+KT   C +PIN +    CDYH+E
Sbjct: 238 FKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKE 297

Query: 336 VQFRGTGAKRIELNGGYALGAPTKVDSQPSLYRAKGE------NQFNIVRSTRKGLSEEE 389
           +QFR   AKR+EL+G YALGAPT++DS+P+LYR+K        N FNIV   R    +E 
Sbjct: 298 MQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKEN 357

Query: 390 ERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRK 449
           + +    H+F++SNSAKAFFDE FQNPDML NL++KRRKI D K+   L R L      +
Sbjct: 358 DPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRAL------R 411

Query: 450 DSSG-----LEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESM 504
           +S G     L+DKS  E Q M+ TT++ LQ G IQ+LGFDPT G+I  VL+ S    +S 
Sbjct: 412 ESVGNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKS--ADKST 469

Query: 505 PNRINGKKT-VINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGS---------KE 554
            +++  +K+  + +L+ +KK  V L PS+    +K  HRE+ + ++  S         K 
Sbjct: 470 QSKLQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKS 529

Query: 555 TEVASDASGSDLEIV 569
               +D    DLEI+
Sbjct: 530 ASTKNDTDSDDLEII 544

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  508 bits (1309), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 268/605 (44%), Positives = 384/605 (63%), Gaps = 47/605 (7%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           M+DPRE+   D ++N++ DE++E  + K++E +ER+K+ L ERL+ K+   +  DPNF +
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 61  VE------------VPQSPAKKSIVKKSQDALKQAIRPVA-------SNINESMLSQQSQ 101
            E            VP SP K   +K+    L  A  PV         N NE  L  Q +
Sbjct: 61  TEGNVDATSESRIQVPGSPEK---IKRKHTQL--AATPVTKKNTGIQDNPNELKLKNQIE 115

Query: 102 ES--PSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDN---KEYKPIITNELE 156
            +  P+ +T YFM  F  +K+ E ++I  YE +M+ARVH+FG      KE + I   E E
Sbjct: 116 PASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKE 175

Query: 157 SFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSD 216
            +S LW+ +RY+ EE + + L +IKILRLNKLFAKIRPPKF+ P Y+NW  VG+I+ KS 
Sbjct: 176 KYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSG 235

Query: 217 IKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG 276
            K TSS  P K+F FTI DFQ ++ +++F ++ + +YYNLR+GD+I ILNP + PWRPS 
Sbjct: 236 FKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSE 295

Query: 277 RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPI-VNKKTHKSCGSPINTNVHMCCDYHRE 335
              +IKSFNL I   + CI+EIG SRDLGWC + V  K  K CG+PIN     CC++HRE
Sbjct: 296 ENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRE 355

Query: 336 VQFRGTGAKRIELNGGYALGAPTKVDSQPSLYRAK-----GENQFNIVRSTRKGLSEEEE 390
            +FR   AKRIELNG +ALGAPTK D+ PSLY+ K      +NQFN+VR  R+   +E +
Sbjct: 356 TEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVR--RRNARKEGD 413

Query: 391 RVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKD 450
               NS NF ++N AKAFF+++FQNPD+++NLDSKRRK+ D K+ + L +EL K + ++D
Sbjct: 414 SKLHNS-NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKED 472

Query: 451 --SSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRI 508
             S  LE KS+ + ++M+  TE+ +Q G+++ +G+DPTHGK+  ++K S   G+  P+  
Sbjct: 473 NVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS--NGKD-PSYT 529

Query: 509 NGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFG----SKETEVASDASGS 564
           + +   +NDLL +KK+KV L P K++   K+  R+E+W  +FG    S    + S    S
Sbjct: 530 SNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDS 589

Query: 565 DLEIV 569
           DLEIV
Sbjct: 590 DLEIV 594

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  466 bits (1198), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 239/560 (42%), Positives = 368/560 (65%), Gaps = 16/560 (2%)

Query: 3   DPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVE 62
           DPRE+L +D ++ VTSDE+++  I ++L+ +ER+++ L +RL++K   KK +  + E VE
Sbjct: 6   DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERVE 65

Query: 63  VPQSPAKKSIVKKSQDALKQAIR-PVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRN 121
           VP SP ++   K S  + K +    +A+N N   +    +  PSNTT+YF++ F +A++ 
Sbjct: 66  VPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVPWKNGPSNTTSYFVENFVNARKV 125

Query: 122 EDKQIAKYEGMMNARVHTF-GTDN-KEYKPIITNELESFSNLWVKKRYIPEEDLKRALHE 179
           E+++I     +++ RVHTF G D+ K  +P+  +E E +S   + +RY+   +L   + E
Sbjct: 126 EEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIMRE 185

Query: 180 IKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHS 239
           IK+LRL KLF+K+RPPKF EPDYANW  +G+IS KS++K TSS KP K+F  T+TDF H+
Sbjct: 186 IKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFTHN 245

Query: 240 LDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG------RGNFIKSFNLRISHDFK 293
           LD+YIF  K VE+YYNLR+GD+IAILNP++LPWRPS        G  +KSFNL I H+F 
Sbjct: 246 LDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHNFD 305

Query: 294 CILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYA 353
           C+LEIG+S+DLG+C I NK T K+CG+PIN      C+YH++V+FR   A+R+ELNG  +
Sbjct: 306 CVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGSTS 365

Query: 354 LGAPTKVDSQPSLYRAKG-ENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEK 412
           L +P K   + +LY   G + +  ++       +++ E   +N+  F+N N AKAFFD+ 
Sbjct: 366 LRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGE--SQNTLFFSNPNYAKAFFDDS 423

Query: 413 FQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESA 472
           +QNPDML NL++KRRK+ D++K   L  +L   + +       +KS+ E+++MK  TE  
Sbjct: 424 YQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDATEQV 483

Query: 473 LQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSK 532
           L +GL++ +GFDP  GK+ +VLK     G+++ + +N K + + +++ +KK  V LAPSK
Sbjct: 484 LNSGLLRDIGFDPFRGKMREVLK----FGKNVNSGLNSKSSQVKEIMSFKKSNVSLAPSK 539

Query: 533 NEWFKKRSHREEVWQRHFGS 552
            E  K+   RE+VW+ HF +
Sbjct: 540 AEQKKRLLRREQVWREHFDT 559

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  465 bits (1197), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 249/585 (42%), Positives = 375/585 (64%), Gaps = 27/585 (4%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           M+DPRE   +D ++ ++ DE+D+  + K L+ +ER+K+ L +RL+     KK  DPNF  
Sbjct: 1   MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 61  VEVPQSPAKKSIV-----KKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKF 115
           VEVP+SP+K   V      +S+D  +++  P   N+NE  + +++  S S +T YF Q F
Sbjct: 59  VEVPRSPSKSKHVAVKETSRSKDD-RESCFPAHENLNELQVQKKASLS-SISTPYFAQNF 116

Query: 116 QDAKRNEDKQIAKYEGMMNARVHTF-GTD-NKEYKPIITNELESFSNLWVKKRYIPEEDL 173
             +K+ ++ +  +   M+N RVHTF G D  +EY PI  NE E FS  W+ KRYI  E  
Sbjct: 117 SSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQA 176

Query: 174 KRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTI 233
           ++ L E K+LRL KLFAK+RPP F EP Y+NW T+G+IS KS +K T+  KP ++F  T+
Sbjct: 177 RKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTL 236

Query: 234 TDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS------GRGNFIKSFNLR 287
           TDF+H++++Y+FG K VE+YYNL++GD+IA+LNPE+ PWRPS           IKSFNL 
Sbjct: 237 TDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLC 296

Query: 288 ISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIE 347
           I H+F  ILEIG+SRD G+C I NK   K+CG+PIN +V   C YH+EVQFR   AKR+E
Sbjct: 297 IKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLE 356

Query: 348 LNGGYALGAPTKVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKA 407
           LNG  +L +PTK   +  LY      +++++    +   + + +  +N   F+N N+A+A
Sbjct: 357 LNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPD--RYAPQTQSKDSQNVLYFSNPNAARA 414

Query: 408 FFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQ 467
           FFD+ +QNPD L NLDSKRRK+   KK   L ++L +++ + +S+  ++++  ++ ++++
Sbjct: 415 FFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTKQDEIRR 474

Query: 468 TTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVI 527
            T++AL++GLI+++GFDPT G++S VLK++  G +        K + + ++LQ KKEK+ 
Sbjct: 475 ATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQ-----AKNSAVEEILQIKKEKIE 529

Query: 528 LAPSKNEWFKKRSHREEVWQRHFGSKETE---VASDASGSDLEIV 569
           L PSK    +K   REEVW  HF  +E     V S    S+LEIV
Sbjct: 530 LKPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGDSELEIV 574

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  423 bits (1088), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 215/472 (45%), Positives = 307/472 (65%), Gaps = 20/472 (4%)

Query: 112 MQKFQDAKRNEDKQIAKYEGMMNARVHTFG--TDNKEYKPIITNELESFSNLWVKKRYIP 169
           M+ F ++++ E+ +I     M+++RVHTF      K  KPI   E E  S LWV +RYI 
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 170 EEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFF 229
            ++L   L +IKILRL KLF+K+RPPKF EPDYANW  VG++ HKS +K TSS KP K+F
Sbjct: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 230 MFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGN------FIKS 283
             TITDF HSLDVY+F    VE+YYNLR+GD+IAILN ++LPWRPS  GN       +KS
Sbjct: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 284 FNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGA 343
           FNL I  ++ C+LEIG+SRDLG+C I NK   K CG+PIN      CDYH+E++FR   A
Sbjct: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 344 KRIELNGGYALGAPTKVDSQPSLYRAKG-ENQFNIVRSTRKGLSEEEERVKRNSHNFTNS 402
           +R+ELNG  +L +P K   + +LY + G + + N++    K   ++++R  +N+  F+N 
Sbjct: 241 QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPD--KHAPQQQDRESQNTLYFSNP 298

Query: 403 NSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEK 462
           N AKAFFD+ +QNPD+L NLDSKRRK+ DT+    L  +L + + +       +K++ E+
Sbjct: 299 NYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQEQ 358

Query: 463 QKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYK 522
           ++MKQ TE  + +GL++ +GFDPT GK+  VLK     G++  N  + K   + ++++ +
Sbjct: 359 KQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKV----GKNSKNSTDTKSIQVREIIETR 414

Query: 523 KEKVILAPSKNEWFKKRSHREEVWQRHFGSK-----ETEVASDASGSDLEIV 569
           K  V LAPSK +  K+   RE+VW+ HF +K       ++ SD+S SDLEIV
Sbjct: 415 KTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  381 bits (979), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 226/616 (36%), Positives = 341/616 (55%), Gaps = 58/616 (9%)

Query: 1   MDDPREILAVDPYNNVTSDEED-----------------------EQAIAKELEFMERKK 37
           ++DPREI+    Y+ + SDEED                          +   L+ +E ++
Sbjct: 6   LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64

Query: 38  QALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLS 97
             L+ RL+  +   K +      VEVP+SP K   V+        A         E+   
Sbjct: 65  SDLLARLEELKHRSKKKAKKSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVEEPEENENE 124

Query: 98  QQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNK--EYKPIITNEL 155
           +    + + TT+YF +KF  A+ +    + + + ++  RV+TF   +   EY     +E+
Sbjct: 125 RYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEV 184

Query: 156 ESFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKS 215
           E++SN+ + KRY+PEEDLKR LH+IK+LRL KLFAK+RPPKF EPDYANW T+G IS+KS
Sbjct: 185 ETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKS 244

Query: 216 DIKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS 275
           D+K TS EKP K+F   ITDF + + + +FG+K VE+YY LR+GDVIAILNPE+ PW+ S
Sbjct: 245 DVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKES 304

Query: 276 GRG------NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMC 329
            +          +SF L I H+  CILEIG S++LG+CP +NK     CG+PIN      
Sbjct: 305 AKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQV 364

Query: 330 CDYHREVQFRGTGAKRIELNGGYALGAPTKVDSQPSLYRAKGENQFNI-----VRSTRKG 384
           C YH+E   R   AKR+ELNG  +L APT+   Q + Y  +  +   I     V + R  
Sbjct: 365 CSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPRAP 424

Query: 385 LSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGK 444
            +E++ R      +F ++N+ +A+FD  + NPD+L NL+SKRRKI  +KK   ++++L  
Sbjct: 425 GAEQKFR-----EHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSL 479

Query: 445 IMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESM 504
           ++ +  +   +  SE   Q+ ++ T++ ++TG+++ +GFDPT G+++ VL      G+  
Sbjct: 480 VLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQ----GDHG 535

Query: 505 PNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHF---------GSKET 555
           P     ++  I+++L  KK  + L PSK    K+   R EV+   F         GS ET
Sbjct: 536 PAD-TVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCET 594

Query: 556 EVASDASGSD--LEIV 569
              S A  SD  LEIV
Sbjct: 595 AQLSSADSSDEELEIV 610

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  355 bits (911), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 213/583 (36%), Positives = 333/583 (57%), Gaps = 24/583 (4%)

Query: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60
           + DPREI A DPY  ++ DE + + + + +  ++ +K+ L  RL   +  +  +DPNF++
Sbjct: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 61  VEVPQSPAKKSIVKKSQDALKQAIRPVAS------NINESMLSQQSQESPSNTTTYFMQK 114
           ++VP+SP K     K  + +K  I PVA       N+NE  + ++ ++    TT+YF +K
Sbjct: 65  IDVPESPKKSDNATKGIEDIKH-IAPVADIEEATFNVNEDYVREKVKKL--GTTSYFTEK 121

Query: 115 FQDAKRNEDKQIAKYEGMMNARVHTFGTDN-KEYKPIITNELESFSNLWVKKRYIPEEDL 173
            +    NE + I + + ++  RV+TF  D   EY+PI  +E +  S L + +RY+P   L
Sbjct: 122 LRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAVL 181

Query: 174 KRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTI 233
           ++    IK+LRL KLF+K+R PKF EPDY NW  +G+IS K++ + T+S KPVKFF  TI
Sbjct: 182 RKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLTI 241

Query: 234 TDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWR--PSGRGNFIKSFNLRISHD 291
           +DFQ  L+V  FGK  VE+YY LRLGD+IAILNPE++P +   +G      +F+L++S D
Sbjct: 242 SDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSKD 301

Query: 292 FKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGG 351
              ILE+G S++ G C    K   K CG+PIN      C YH+E + R   ++R+E++  
Sbjct: 302 TNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISSS 361

Query: 352 YALGAPTKVDSQPSLYRAKGENQFNIVRSTR---KGLSEEEERVKRNSHNFTNSNSAKAF 408
            A+ AP     Q ++ +++  N    +R  +   K    E    + N   F+++N++ AF
Sbjct: 362 VAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTAF 421

Query: 409 FDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQT 468
           FD+ ++NPD+LANLD+KRRKI + + +  L ++L K +  K  S  ED+   E +K    
Sbjct: 422 FDDDYENPDILANLDNKRRKIQELRNNRNLEKKL-KGLSDKLLSKKEDRVNQEAKKT--A 478

Query: 469 TESALQTGLIQRLGFDPTHGKIS-KVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVI 527
           T S  Q GL  ++G+DPT GK S ++L+ S           N K+  I D+   KK+ V 
Sbjct: 479 TLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPK----NDKQLAITDICNIKKDNVS 534

Query: 528 LAPSKNEWFKKRSHREEVWQRHF-GSKETEVASDASGSDLEIV 569
           L PSK +  +K   R  ++     GS+E     + S  DLEI+
Sbjct: 535 LKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 68/164 (41%), Gaps = 39/164 (23%)

Query: 163 VKKRYIPEEDLKRALH-EIKILRLN-KLFAKIRPPKFQEPD------------------- 201
           +KK  + EE L+RALH E++ LR N +++ +IRPP   E D                   
Sbjct: 326 IKKILVKEESLRRALHNELQELRGNIRVYCRIRPPLPHEDDNIEHIKVQPFDDDNGDQGM 385

Query: 202 YANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHSLD-----VYIFGKKGVERYYN- 255
             N     +I  K D  F   E   + F       Q SLD     ++ +G+ G  + Y  
Sbjct: 386 TINRGNSQVIPFKFDKIFDQQETNDEIFKEVGQLIQSSLDGYNVCIFAYGQTGSGKTYTM 445

Query: 256 LRLGDVI--AILNPEVLPW--RPSGRG-------NFIKSFNLRI 288
           L  GD I  A +N  +  W  + + RG        FI+ +N  I
Sbjct: 446 LNPGDGIVPATIN-HIFSWIDKLAARGWSYKVSCEFIEIYNENI 488

>KAFR0A07410 Chr1 (1496247..1497308) [1062 bp, 353 aa] {ON} Anc_2.91
           YNL164C
          Length = 353

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 55/128 (42%), Gaps = 26/128 (20%)

Query: 358 TKVDSQPSLYRAKGEN------QFNIVRSTRK-GLSEEEERVKRNSHN-FTNSNSAKAFF 409
            K D   S Y   GEN        ++++ T    L+  ++    NS N   +S SA AFF
Sbjct: 61  VKSDGDSSHYSKSGENASITSTDGDVLKMTNHLALNGAQKTGDLNSANILIDSKSAGAFF 120

Query: 410 DEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTT 469
           DE+F +P++  N                   E  +I+   +S  +ED +EG  +K+ +  
Sbjct: 121 DEEFPDPELHIN------------------GEEAEIIFDYESHDMEDPTEGIGRKISEMI 162

Query: 470 ESALQTGL 477
           ES L  G 
Sbjct: 163 ESVLPGGF 170

>NCAS0G02030 Chr7 complement(366089..367162) [1074 bp, 357 aa] {ON}
           Anc_2.91 YNL164C
          Length = 357

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 42/99 (42%), Gaps = 23/99 (23%)

Query: 398 NFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDK 457
           N  N++  + F DE+FQ+P++                   L  E G+I+   ++  L D 
Sbjct: 122 NVLNNDDVQNFLDEEFQDPEL------------------HLDDEEGEIIFDYETHDLMDA 163

Query: 458 SEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKS 496
            +G  +++ Q  ES L  G  +       HG++  V+  
Sbjct: 164 PDGIGERISQMIESVLPNGFPKD-----AHGRLHAVVNG 197

>ZYRO0B05786g Chr2 complement(457353..466337) [8985 bp, 2994 aa] {ON}
            similar to uniprot|P18963 Saccharomyces cerevisiae
            YBR140c IRA1 or uniprot|P19158 Saccharomyces cerevisiae
            YOL081w IRA2
          Length = 2994

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%)

Query: 139  TFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPP 195
            +F + N E + II    + ++ +W  K Y+  +      HEI +++L  LF  + PP
Sbjct: 1966 SFRSKNIEIETIIYRTFQIYARIWSVKYYLVLDCTHFDEHEIDVVKLTSLFNNLVPP 2022

>SAKL0H03344g Chr8 (318176..320833) [2658 bp, 885 aa] {ON} similar
           to uniprot|P11325 Saccharomyces cerevisiae YLR382C NAM2
           Mitochondrial leucyl-tRNA synthetase also has a direct
           role in splicing of several mitochondrial group I
           introns indirectly required for mitochondrial genome
           maintenance
          Length = 885

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 55/118 (46%), Gaps = 3/118 (2%)

Query: 66  SPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQ 125
           S  +KS++ ++   L   I PV  +I+E  +   +       + Y   + + AK   +  
Sbjct: 766 SSVRKSVIMRAVQKLVTVIYPVVPSISEEAVDIINGNQNWEWSQYNWPQLETAK---ESN 822

Query: 126 IAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALHEIKIL 183
           I  Y+ M+N ++      ++++     N +E+   L   KRYI  +++K  + + K++
Sbjct: 823 IVNYQVMINGKIRFTYPADQDFIKDRDNVIETLKTLPEGKRYIVGKEIKNVILKRKVI 880

>Kpol_1055.89 s1055 (228896..231154) [2259 bp, 753 aa] {ON}
           (228896..231154) [2259 nt, 753 aa]
          Length = 753

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 366 LYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSK 425
           L++A  EN  N       G+    ER      N TN  +A A FDEKF  PD+L+  ++K
Sbjct: 672 LFQAPIENILNWDSQKIVGI----ERWLNKLINLTNQITALASFDEKFSTPDVLSGPNAK 727

>TPHA0C03790 Chr3 complement(822142..823614) [1473 bp, 490 aa] {ON}
           Anc_2.369 YDL088C
          Length = 490

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 11/86 (12%)

Query: 105 SNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESF--SNL- 161
           SN +  F+Q  +D  + +  Q   Y  + N    ++   N + KP+  N+L+S   +N+ 
Sbjct: 14  SNVSINFLQPSEDTSQQQGNQQKTYHQLQNNSQQSYIQLNNKNKPLFANDLQSQFDTNMK 73

Query: 162 -----WV---KKRYIPEEDLKRALHE 179
                W    KKR IP+  ++R ++E
Sbjct: 74  GQEPEWFNNPKKRNIPQNVIRRNVNE 99

>SAKL0H22858g Chr8 (1988530..1990740) [2211 bp, 736 aa] {ON} similar
           to uniprot|P53202 Saccharomyces cerevisiae YGR003W
          Length = 736

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 45/88 (51%), Gaps = 14/88 (15%)

Query: 84  IRPVASNINESMLSQ--QSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFG 141
           +RP+ + I ESML +   ++E+ S    Y + K         + +A  E +++   + + 
Sbjct: 146 VRPLCTKIQESMLHEINMARENKSTPVNYSLLK---------EIVAMMETLVDVNDNYYL 196

Query: 142 TDNKEYKPIITNELESFSNLWVKKRYIP 169
           T   E++P +  E E++ N +V+K  +P
Sbjct: 197 T---EFEPYLLKETENYYNTFVQKHSLP 221

>Ecym_4534 Chr4 (1055903..1056619) [717 bp, 238 aa] {ON} similar to
           Ashbya gossypii AFR408C
          Length = 238

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 85  RPVASNI-NESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFG 141
           +P+ S + NES+L +  Q S S   T+  Q+    +R+  K + + EG +NA  +T G
Sbjct: 36  KPLQSRLYNESLLDKNKQVSLS-AFTFLFQEMVAQQRDSSKTVVEIEGKLNALGYTIG 92

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,146,440
Number of extensions: 3088631
Number of successful extensions: 11372
Number of sequences better than 10.0: 208
Number of HSP's gapped: 11893
Number of HSP's successfully gapped: 215
Length of query: 569
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 454
Effective length of database: 40,294,809
Effective search space: 18293843286
Effective search space used: 18293843286
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)