Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.385.703ON56956929570.0
Smik_9.195.703ON57257225700.0
YIL150C (MCM10)5.703ON57157125450.0
Skud_9.185.703ON57157125270.0
NCAS0G002205.703ON59259816270.0
KAFR0D022105.703ON58458715330.0
TDEL0B021705.703ON56757714950.0
ZYRO0G06578g5.703ON56957714370.0
NDAI0F002805.703ON61061114280.0
Kpol_1043.715.703ON58558914090.0
KNAG0L021505.703ON61661514090.0
CAGL0H06589g5.703ON58359413800.0
TPHA0E002105.703ON54455013151e-176
TBLA0G010205.703ON59460513041e-174
KLTH0E01034g5.703ON58358312321e-163
SAKL0E14938g5.703ON57458512011e-158
Kwal_55.196915.703ON46647210761e-141
AFR287W5.703ON6116139871e-126
KLLA0A00572g5.703ON5775839261e-117
NCAS0A128402.586ON612123900.029
CAGL0D04994g3.479ON692187900.030
SAKL0G15818g4.268ON647218880.052
NDAI0B061903.547ON947102870.074
TBLA0A088904.77ON698127850.12
SAKL0H03344g4.236ON885118850.13
Smik_15.3858.609ON470189830.19
ZYRO0D01276g7.527ON668133830.21
YBR237W (PRP5)6.148ON849171830.22
KAFR0A074102.91ON353126820.22
Kpol_1024.298.562ON199670820.31
TBLA0A001503.204ON201117790.31
CAGL0M07678g2.561ON473105810.32
KLLA0E21517g5.414ON858212810.38
NDAI0B032102.356ON306152790.46
TDEL0C045202.235ON1313108800.52
ZYRO0G21318g1.294ON145461800.53
Skud_15.3658.609ON470187790.56
YOR198C (BFR1)8.609ON470189790.56
TPHA0C037902.369ON49088790.57
Kpol_1052.262.548ON314103780.62
TDEL0H013101.260ON525121780.77
TPHA0C019308.460ON567186780.78
ZYRO0G00484g4.385ON647171780.81
YNL167C (SKO1)2.86ON64792780.81
NDAI0E018302.409ON1270118780.90
CAGL0C01265g2.253ON1501168780.91
Suva_10.5464.310ON2223117780.93
Kpol_1013.427.530ON430104770.95
Kpol_1026.214.61ON43783770.95
Kpol_1010.237.451ON288116761.0
Smik_10.2805.221ON591159771.0
Smik_14.1602.86ON65089771.1
Suva_14.1712.86ON65295771.1
SAKL0C04884g1.163ON898148771.1
YKL201C (MNN4)1.509ON1178111771.2
YNL005C (MRP7)1.410ON371153761.2
TBLA0I02620singletonON3166128771.2
Kpol_1072.538.609ON471186761.3
Suva_6.2491.170ON73799761.4
SAKL0B10758g7.50ON986120761.5
Kwal_23.43435.51ON1031172761.5
NCAS0B037408.279ON1049111761.5
Suva_9.415.700ON1219117761.5
NCAS0A041102.409ON1247118761.5
KLTH0E09218g2.409ON1253100761.5
TBLA0H003002.409ON127594761.5
Smik_5.3368.228ON1468144761.6
YLR430W (SEN1)4.310ON2231123761.6
ZYRO0G03498g6.173ON519223751.7
KLLA0F11396gsingletonOFF199114731.8
Ecym_10911.87ON28499741.8
Kwal_56.226463.100ON68066751.9
YJL168C (SET2)1.170ON733112751.9
Kpol_499.154.165ON1063172752.0
TBLA0B049007.536ON345130742.0
SAKL0A00352g6.378ON490130742.3
ZYRO0B01320g2.503ON268141732.3
KNAG0G031908.787ON52368742.3
Skud_10.461.170ON73491742.5
Skud_4.7831.52ON1135116742.6
KLLA0D07502g8.68ON1243208742.7
CAGL0M11616g8.295ON4880162742.9
ZYRO0G06402g2.146ON42886732.9
AEL344W7.94ON54034552.9
Smik_4.6285.425ON458100732.9
Klac_YGOB_F11386g8.665ON533114733.1
Kpol_1052.103.293ON64176733.2
ZYRO0C14036g5.328ON661111733.2
SAKL0H22858g4.138ON73688733.3
CAGL0H05357g8.542ON770132733.3
Kwal_47.177812.409ON127398733.5
CAGL0K06413g5.586ON359126723.5
KNAG0A079303.491ON452176643.8
KLTH0D03916g4.61ON50590724.0
NCAS0G020002.86ON55155724.1
KLTH0G10274g2.282ON559148724.1
NCAS0A079905.591ON95750724.5
Kpol_1026.314.46ON1005195724.5
ZYRO0G12716g3.303ON1012138724.5
SAKL0E04730g2.402ON112761724.5
KNAG0A060202.409ON1252133724.6
SAKL0E04532g2.409ON1273119724.6
TBLA0D008108.777ON1504198724.7
Suva_2.3278.345ON17288694.8
Ecym_64102.86ON48748715.2
TPHA0C032202.261ON255109705.2
TBLA0A104205.274ON492188715.2
Kpol_1028.1038.770ON15196685.4
Suva_4.937.330ON605141715.5
KLTH0A00858g7.535ON647105715.5
KLLA0F13354g8.440ON65279715.5
Kpol_1055.894.236ON75360715.7
Smik_15.4238.665ON304137705.7
Ecym_64762.16ON850188715.8
TBLA0D032208.834ON1139133716.0
Smik_12.5264.310ON2227125716.3
NCAS0I005207.93ON44898706.7
KNAG0G025608.673ON46092706.7
ZYRO0G20922g1.309ON497116706.9
TDEL0A066108.716ON59081707.1
NDAI0G035608.121ON643177707.3
Kwal_26.94685.23ON667140707.3
SAKL0C09746g3.100ON72172707.4
TPHA0J014405.677ON796204707.5
NDAI0G023908.359ON96563707.7
YNL215W (IES2)2.31ON32079697.8
Suva_15.3541.100ON1229142707.9
ZYRO0A08888g2.409ON1266107707.9
NCAS0G027202.199ON129790708.0
KAFR0B027108.259ON1416207708.0
TBLA0E044108.259ON1422147708.0
TPHA0G004908.753ON1758121708.1
Smik_11.3465.676ON13388668.2
SAKL0H09570g8.562ON235446708.3
TPHA0D020705.349ON373114698.3
TDEL0H012101.239ON42877698.7
NCAS0C051902.636ON444131698.8
NCAS0H010906.173ON460129698.9
Skud_14.2082.146ON484136699.0
Kwal_14.14284.186ON536110699.2
TPHA0E027906.226ON55860699.3
Suva_2.6881.50ON661112699.6
KLLA0F12892g5.218ON775112699.9
TPHA0G012408.770ON15194669.9
KAFR0A022802.590ON8301556910.0
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Suva_9.38
         (1710 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...  1143   0.0  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   994   0.0  
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   984   0.0  
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   978   0.0  
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   631   0.0  
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   595   0.0  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   580   0.0  
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   558   0.0  
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   554   0.0  
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   547   0.0  
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   547   0.0  
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   536   0.0  
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   511   e-176
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   506   e-174
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   479   e-163
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   467   e-158
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   419   e-141
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   384   e-126
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   361   e-117
NCAS0A12840 Chr1 complement(2532530..2534368) [1839 bp, 612 aa] ...    39   0.029
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...    39   0.030
SAKL0G15818g Chr7 (1363027..1364970) [1944 bp, 647 aa] {ON} simi...    39   0.052
NDAI0B06190 Chr2 (1503529..1506372) [2844 bp, 947 aa] {ON} Anc_3...    38   0.074
TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4...    37   0.12 
SAKL0H03344g Chr8 (318176..320833) [2658 bp, 885 aa] {ON} simila...    37   0.13 
Smik_15.385 Chr15 complement(668338..669750) [1413 bp, 470 aa] {...    37   0.19 
ZYRO0D01276g Chr4 complement(96840..98846) [2007 bp, 668 aa] {ON...    37   0.21 
YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA he...    37   0.22 
KAFR0A07410 Chr1 (1496247..1497308) [1062 bp, 353 aa] {ON} Anc_2...    36   0.22 
Kpol_1024.29 s1024 (83563..89553) [5991 bp, 1996 aa] {ON} (83563...    36   0.31 
TBLA0A00150 Chr1 complement(13868..14473) [606 bp, 201 aa] {ON} ...    35   0.31 
CAGL0M07678g Chr13 complement(767857..769278) [1422 bp, 473 aa] ...    36   0.32 
KLLA0E21517g Chr5 complement(1920040..1922616) [2577 bp, 858 aa]...    36   0.38 
NDAI0B03210 Chr2 (819236..820156) [921 bp, 306 aa] {ON} Anc_2.35...    35   0.46 
TDEL0C04520 Chr3 (814803..818744) [3942 bp, 1313 aa] {ON} Anc_2....    35   0.52 
ZYRO0G21318g Chr7 complement(1751145..1755509) [4365 bp, 1454 aa...    35   0.53 
Skud_15.365 Chr15 complement(657763..659175) [1413 bp, 470 aa] {...    35   0.56 
YOR198C Chr15 complement(718653..720065) [1413 bp, 470 aa] {ON} ...    35   0.56 
TPHA0C03790 Chr3 complement(822142..823614) [1473 bp, 490 aa] {O...    35   0.57 
Kpol_1052.26 s1052 complement(86331..87275) [945 bp, 314 aa] {ON...    35   0.62 
TDEL0H01310 Chr8 (224588..226165) [1578 bp, 525 aa] {ON} Anc_1.2...    35   0.77 
TPHA0C01930 Chr3 (438203..439906) [1704 bp, 567 aa] {ON} Anc_8.4...    35   0.78 
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    35   0.81 
YNL167C Chr14 complement(319416..321359) [1944 bp, 647 aa] {ON} ...    35   0.81 
NDAI0E01830 Chr5 complement(363691..367503) [3813 bp, 1270 aa] {...    35   0.90 
CAGL0C01265g Chr3 complement(129884..134389) [4506 bp, 1501 aa] ...    35   0.91 
Suva_10.546 Chr10 (948276..954947) [6672 bp, 2223 aa] {ON} YLR43...    35   0.93 
Kpol_1013.42 s1013 (96318..97610) [1293 bp, 430 aa] {ON} (96318....    34   0.95 
Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {O...    34   0.95 
Kpol_1010.23 s1010 (52012..52878) [867 bp, 288 aa] {ON} (52012.....    34   1.0  
Smik_10.280 Chr10 (435799..437574) [1776 bp, 591 aa] {ON} YJR002...    34   1.0  
Smik_14.160 Chr14 complement(298499..300451) [1953 bp, 650 aa] {...    34   1.1  
Suva_14.171 Chr14 complement(315525..317483) [1959 bp, 652 aa] {...    34   1.1  
SAKL0C04884g Chr3 complement(468461..471157) [2697 bp, 898 aa] {...    34   1.1  
YKL201C Chr11 complement(63930..67466) [3537 bp, 1178 aa] {ON}  ...    34   1.2  
YNL005C Chr14 complement(621313..622428) [1116 bp, 371 aa] {ON} ...    34   1.2  
TBLA0I02620 Chr9 complement(605456..614956) [9501 bp, 3166 aa] {...    34   1.2  
Kpol_1072.53 s1072 (122356..123771) [1416 bp, 471 aa] {ON} (1223...    34   1.3  
Suva_6.249 Chr6 (444869..447082) [2214 bp, 737 aa] {ON} YJL168C ...    34   1.4  
SAKL0B10758g Chr2 complement(931458..934418) [2961 bp, 986 aa] {...    34   1.5  
Kwal_23.4343 s23 (675819..678914) [3096 bp, 1031 aa] {ON} YGR258...    34   1.5  
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    34   1.5  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...    34   1.5  
NCAS0A04110 Chr1 complement(829352..833095) [3744 bp, 1247 aa] {...    34   1.5  
KLTH0E09218g Chr5 (835647..839408) [3762 bp, 1253 aa] {ON} simil...    34   1.5  
TBLA0H00300 Chr8 complement(51145..54972) [3828 bp, 1275 aa] {ON...    34   1.5  
Smik_5.336 Chr5 (504898..509304) [4407 bp, 1468 aa] {ON} YER164W...    34   1.6  
YLR430W Chr12 (993434..1000129) [6696 bp, 2231 aa] {ON}  SEN1Pre...    34   1.6  
ZYRO0G03498g Chr7 (275243..276802) [1560 bp, 519 aa] {ON} weakly...    33   1.7  
KLLA0F11396g Chr6 complement(1048734..1049333) [600 bp, 199 aa] ...    33   1.8  
Ecym_1091 Chr1 complement(191292..192146) [855 bp, 284 aa] {ON} ...    33   1.8  
Kwal_56.22646 s56 complement(218373..220415) [2043 bp, 680 aa] {...    33   1.9  
YJL168C Chr10 complement(102227..104428) [2202 bp, 733 aa] {ON} ...    33   1.9  
Kpol_499.15 s499 (44708..47899) [3192 bp, 1063 aa] {ON} (44708.....    33   2.0  
TBLA0B04900 Chr2 (1154499..1155536) [1038 bp, 345 aa] {ON} Anc_7...    33   2.0  
SAKL0A00352g Chr1 complement(38015..39487) [1473 bp, 490 aa] {ON...    33   2.3  
ZYRO0B01320g Chr2 (111463..112269) [807 bp, 268 aa] {ON} highly ...    33   2.3  
KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {O...    33   2.3  
Skud_10.46 Chr10 complement(76968..79172) [2205 bp, 734 aa] {ON}...    33   2.5  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    33   2.6  
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...    33   2.7  
CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 ...    33   2.9  
ZYRO0G06402g Chr7 (505987..507273) [1287 bp, 428 aa] {ON} some s...    33   2.9  
AEL344W Chr5 (5878..7500) [1623 bp, 540 aa] {ON} Syntenic homolo...    26   2.9  
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...    33   2.9  
Klac_YGOB_F11386g Chr6 complement(1047731..1048744,1048746..1049...    33   3.1  
Kpol_1052.10 s1052 (32230..34155) [1926 bp, 641 aa] {ON} (32230....    33   3.2  
ZYRO0C14036g Chr3 (1101220..1103205) [1986 bp, 661 aa] {ON} simi...    33   3.2  
SAKL0H22858g Chr8 (1988530..1990740) [2211 bp, 736 aa] {ON} simi...    33   3.3  
CAGL0H05357g Chr8 complement(514513..516825) [2313 bp, 770 aa] {...    33   3.3  
Kwal_47.17781 s47 (552713..556534) [3822 bp, 1273 aa] {ON} YMR12...    33   3.5  
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    32   3.5  
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...    29   3.8  
KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some s...    32   4.0  
NCAS0G02000 Chr7 complement(360567..362222) [1656 bp, 551 aa] {O...    32   4.1  
KLTH0G10274g Chr7 complement(868108..869787) [1680 bp, 559 aa] {...    32   4.1  
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    32   4.5  
Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {...    32   4.5  
ZYRO0G12716g Chr7 complement(1009177..1012215) [3039 bp, 1012 aa...    32   4.5  
SAKL0E04730g Chr5 complement(381559..384942) [3384 bp, 1127 aa] ...    32   4.5  
KNAG0A06020 Chr1 complement(905792..909550) [3759 bp, 1252 aa] {...    32   4.6  
SAKL0E04532g Chr5 (364158..367979) [3822 bp, 1273 aa] {ON} simil...    32   4.6  
TBLA0D00810 Chr4 complement(213322..217836) [4515 bp, 1504 aa] {...    32   4.7  
Suva_2.327 Chr2 (575454..575972) [519 bp, 172 aa] {ON} YDR163W (...    31   4.8  
Ecym_6410 Chr6 (795710..797173) [1464 bp, 487 aa] {ON} similar t...    32   5.2  
TPHA0C03220 Chr3 complement(707955..708705,708802..708818) [768 ...    32   5.2  
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    32   5.2  
Kpol_1028.103 s1028 (227568..228023) [456 bp, 151 aa] {ON} (2275...    31   5.4  
Suva_4.93 Chr4 complement(169009..170826) [1818 bp, 605 aa] {ON}...    32   5.5  
KLTH0A00858g Chr1 (88180..90123) [1944 bp, 647 aa] {ON} similar ...    32   5.5  
KLLA0F13354g Chr6 complement(1231619..1233577) [1959 bp, 652 aa]...    32   5.5  
Kpol_1055.89 s1055 (228896..231154) [2259 bp, 753 aa] {ON} (2288...    32   5.7  
Smik_15.423 Chr15 (734506..735420) [915 bp, 304 aa] {ON}  YOR239...    32   5.7  
Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar t...    32   5.8  
TBLA0D03220 Chr4 complement(785837..789256) [3420 bp, 1139 aa] {...    32   6.0  
Smik_12.526 Chr12 (922417..929100) [6684 bp, 2227 aa] {ON} YLR43...    32   6.3  
NCAS0I00520 Chr9 complement(83655..85001) [1347 bp, 448 aa] {ON}...    32   6.7  
KNAG0G02560 Chr7 (582049..583431) [1383 bp, 460 aa] {ON} Anc_8.6...    32   6.7  
ZYRO0G20922g Chr7 (1718986..1720479) [1494 bp, 497 aa] {ON} simi...    32   6.9  
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    32   7.1  
NDAI0G03560 Chr7 complement(855635..857566) [1932 bp, 643 aa] {O...    32   7.3  
Kwal_26.9468 s26 complement(1230777..1232780) [2004 bp, 667 aa] ...    32   7.3  
SAKL0C09746g Chr3 (880534..882699) [2166 bp, 721 aa] {ON} weakly...    32   7.4  
TPHA0J01440 Chr10 (334822..337212) [2391 bp, 796 aa] {ON} Anc_5....    32   7.5  
NDAI0G02390 Chr7 complement(547355..550252) [2898 bp, 965 aa] {O...    32   7.7  
YNL215W Chr14 (244468..245430) [963 bp, 320 aa] {ON}  IES2Protei...    31   7.8  
Suva_15.354 Chr15 (611006..614695) [3690 bp, 1229 aa] {ON} YHR15...    32   7.9  
ZYRO0A08888g Chr1 complement(707590..711390) [3801 bp, 1266 aa] ...    32   7.9  
NCAS0G02720 Chr7 (487110..491003) [3894 bp, 1297 aa] {ON} Anc_2....    32   8.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....    32   8.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...    32   8.0  
TPHA0G00490 Chr7 (93383..98659) [5277 bp, 1758 aa] {ON} Anc_8.75...    32   8.1  
Smik_11.346 Chr11 complement(586369..586770) [402 bp, 133 aa] {O...    30   8.2  
SAKL0H09570g Chr8 (813906..820970) [7065 bp, 2354 aa] {ON} weakl...    32   8.3  
TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.3...    31   8.3  
TDEL0H01210 Chr8 complement(208056..209342) [1287 bp, 428 aa] {O...    31   8.7  
NCAS0C05190 Chr3 complement(1056868..1058202) [1335 bp, 444 aa] ...    31   8.8  
NCAS0H01090 Chr8 complement(205335..206717) [1383 bp, 460 aa] {O...    31   8.9  
Skud_14.208 Chr14 (383074..384528) [1455 bp, 484 aa] {ON} YNL124...    31   9.0  
Kwal_14.1428 s14 (319817..321427) [1611 bp, 536 aa] {ON} YGR041W...    31   9.2  
TPHA0E02790 Chr5 complement(583642..585318) [1677 bp, 558 aa] {O...    31   9.3  
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...    31   9.6  
KLLA0F12892g Chr6 complement(1187526..1189853) [2328 bp, 775 aa]...    31   9.9  
TPHA0G01240 Chr7 (252228..252683) [456 bp, 151 aa] {ON} Anc_8.77...    30   9.9  
KAFR0A02280 Chr1 complement(473811..476303) [2493 bp, 830 aa] {O...    31   10.0 

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
            YIL150C (REAL)
          Length = 569

 Score = 1143 bits (2957), Expect = 0.0
 Identities = 569/569 (100%), Positives = 569/569 (100%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA
Sbjct: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 181  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKR 360
            VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKR
Sbjct: 61   VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKR 120

Query: 361  NEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALHEI 540
            NEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALHEI
Sbjct: 121  NEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALHEI 180

Query: 541  KILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHSL 720
            KILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHSL
Sbjct: 181  KILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHSL 240

Query: 721  DVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEIGS 900
            DVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEIGS
Sbjct: 241  DVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEIGS 300

Query: 901  SRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPTKV 1080
            SRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPTKV
Sbjct: 301  SRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPTKV 360

Query: 1081 DSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLA 1260
            DSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLA
Sbjct: 361  DSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLA 420

Query: 1261 NLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQR 1440
            NLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQR
Sbjct: 421  NLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQR 480

Query: 1441 LGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRS 1620
            LGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRS
Sbjct: 481  LGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRS 540

Query: 1621 HREEVWQRHFGSKETEVASDASGSDLEIV 1707
            HREEVWQRHFGSKETEVASDASGSDLEIV
Sbjct: 541  HREEVWQRHFGSKETEVASDASGSDLEIV 569

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
            YIL150C (REAL)
          Length = 572

 Score =  994 bits (2570), Expect = 0.0
 Identities = 489/572 (85%), Positives = 527/572 (92%), Gaps = 3/572 (0%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            MDDPREILAVDPYN+VTSDEEDEQAIAKELEFMERK+QALMERLKRKQ FKKP DPNFEA
Sbjct: 1    MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 181  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQ--QSQESPSNTTTYFMQKFQDA 354
            +EVPQSP K  +   SQ+A+KQ  R   SN NES LSQ  +  E P NTTTYFMQKFQ+A
Sbjct: 61   IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120

Query: 355  KRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALH 534
            K++ED+QIAK+E MM+ARVHTFGTDNK+YKPII NELE FSNLWVKKRYIPE+DLKR+LH
Sbjct: 121  KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 180

Query: 535  EIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 714
            EIKILRL KLFAK+RPPKFQ P+YANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 181  EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 715  SLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 894
            +LDVYIFGKKGVERYYNLRLGD+IAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 241  TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 895  GSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPT 1074
            GSSRDLGWCPIVN KTHK CGSPIN ++H CCDYHREVQFRGT AKRIELNGGYALGAPT
Sbjct: 301  GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 1075 KVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDM 1254
            KV+SQPSLY+AKGEN+FNI+R  RKGLSEEEER+K++SHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 361  KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 1255 LANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLI 1434
            LANLD+KRRKI DTKKS AL+REL KIMRRK+SSGLEDKS+GEKQKMKQTTE+ALQTGLI
Sbjct: 421  LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 480

Query: 1435 QRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKK 1614
            QRLGFDPTHG+ISKVLKSSVPGGES  N +NGKKTVINDLL YKKEKVILAPSKNEWFKK
Sbjct: 481  QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 1615 RSHREEVWQRHFGSK-ETEVASDASGSDLEIV 1707
            R+HREEVWQRHFG K E E ASDAS SDLEI+
Sbjct: 541  RNHREEVWQRHFGPKGEAEEASDASASDLEII 572

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
            MCM10Essential chromatin-associated protein involved in
            the initiation of DNA replication; required for the
            association of the MCM2-7 complex with replication
            origins
          Length = 571

 Score =  984 bits (2545), Expect = 0.0
 Identities = 483/571 (84%), Positives = 525/571 (91%), Gaps = 2/571 (0%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            M+DPREILAVDPYNN+TSDEEDEQAIA+ELEFMERK+QAL+ERLKRKQ+FKKP+DPNFEA
Sbjct: 1    MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 181  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQES--PSNTTTYFMQKFQDA 354
            +EVPQSP K  +   S +A +Q  +   SNINE  LSQ  Q+   P++TTTYFM+KFQ+A
Sbjct: 61   IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120

Query: 355  KRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALH 534
            K+NEDKQIAK+E MMNARVHTF TD K+Y PIITNELESFSNLWVKKRYIPE+DLKRALH
Sbjct: 121  KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 180

Query: 535  EIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 714
            EIKILRL KLFAKIRPPKFQEP+YANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 181  EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 715  SLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 894
            +LDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 241  TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 895  GSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPT 1074
            GSSRDLGWCPIVNKKTHK CGSPIN ++H CCDYHREVQFRGT AKRIELNGGYALGAPT
Sbjct: 301  GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 1075 KVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDM 1254
            KVDSQPSLY+AKGEN FNI++ TRK LSEEEER+K++SHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 361  KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 1255 LANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLI 1434
            LANLD+KRRKII+TKKSTALSRELGKIMRR++SSGLEDKS GE+QKMK+TTESALQTGLI
Sbjct: 421  LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 480

Query: 1435 QRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKK 1614
            QRLGFDPTHGKIS+VLKSSV G E   N +  KKTVINDLL YKKEKVILAPSKNEWFKK
Sbjct: 481  QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 1615 RSHREEVWQRHFGSKETEVASDASGSDLEIV 1707
            RSHREEVWQ+HFGSKET+  SD S SDLEI+
Sbjct: 541  RSHREEVWQKHFGSKETKETSDGSASDLEII 571

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
            YIL150C (REAL)
          Length = 571

 Score =  978 bits (2527), Expect = 0.0
 Identities = 480/571 (84%), Positives = 519/571 (90%), Gaps = 2/571 (0%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            MDDPRE L  DPYNNVTSDE+DEQ IAKELEFMERKKQAL+ERLKRKQ+FK+ EDPNFEA
Sbjct: 1    MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 181  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQ--QSQESPSNTTTYFMQKFQDA 354
            +EVPQSPAK   + KSQ+ +K+ +RP ASNIN+  LSQ  Q QE PSNTT YFMQKFQ+A
Sbjct: 61   IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDLKLSQLQQKQELPSNTTGYFMQKFQNA 120

Query: 355  KRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALH 534
            KRNE+KQ AKYE MMNARVHTFGTD KEY+  I NELE FSN+WVKKRYIPE+DLKRALH
Sbjct: 121  KRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEEFSNIWVKKRYIPEDDLKRALH 180

Query: 535  EIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 714
            EIKILRL KLFAKIRPPKFQEPDYANWA VGLISHKSD+KFTSS+KP KFFMFTITDFQH
Sbjct: 181  EIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDFQH 240

Query: 715  SLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 894
            +LDVYIFGKK VERYYNLRLGDVIAILNPEVLPWRPSG+GNFIKSFNLRISHDFKCILEI
Sbjct: 241  TLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCILEI 300

Query: 895  GSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPT 1074
            GSSRDLGWCPIVN+K +++CGSPIN  +H CCDYHREVQFRGT AKRIELNGGYALGAPT
Sbjct: 301  GSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 1075 KVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDM 1254
            KVD+QP+LYRAKGEN FN+VRS RK LSEEEER+K+NSHNF NSNSAKAFFDEKFQNPDM
Sbjct: 361  KVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDM 420

Query: 1255 LANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLI 1434
            LANLDSKRRKIID+KKSTALSRELGKIMRRK SSGLEDK + EKQK+KQTTESALQTGL+
Sbjct: 421  LANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLL 480

Query: 1435 QRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKK 1614
            QRLGFDPTHGKISKVLKSSVPGGE     + GKKTVI+DLL YKKEKVILAPSKNEWFKK
Sbjct: 481  QRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKK 540

Query: 1615 RSHREEVWQRHFGSKETEVASDASGSDLEIV 1707
            RSHREEVWQ+HFGSK+T+  SDAS SDLEIV
Sbjct: 541  RSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
            Anc_5.703 YIL150C
          Length = 592

 Score =  631 bits (1627), Expect = 0.0
 Identities = 321/598 (53%), Positives = 432/598 (72%), Gaps = 29/598 (4%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            M+DPRE+L  DPY+NV+SDE+DE+AI ++LE +ERK+Q L+ R+K KQ+ KK  DPNF+ 
Sbjct: 1    MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 181  VEVPQSPAKKS------IVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQK 342
            ++VP SP KK+       +KKS + ++        N NE  + ++S + PSNTTTYFM+K
Sbjct: 61   LQVPCSPVKKTETNVPVAMKKSTNEMEIP----HENPNELRIREKSGQLPSNTTTYFMEK 116

Query: 343  FQDAKRNEDKQIAKYEGMMNARVHTFGTDN--KEYKPIITNELESFSNLWVKKRYIPEED 516
            FQ +K+ E+ +I K E MMNARVHTF      +E+KPI  NE+E +SN+W+KKRYIP+ +
Sbjct: 117  FQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSE 176

Query: 517  LKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFT 696
            L++ LH IKILRL+KLFAK+RPPKF EP Y+NWA +G+IS K D KFT+++KP K+  FT
Sbjct: 177  LRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFT 236

Query: 697  ITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDF 876
            +TDFQH LDVYIFGK GVERYYNLR+GDVIAILNPEV PWRPSG+G FIKSFNLRI+HDF
Sbjct: 237  MTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDF 296

Query: 877  KCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGY 1056
            KCILEIGSS+DLG+C  V  +    C +PIN +    CDYH+E++FR   +KRIELNG +
Sbjct: 297  KCILEIGSSKDLGFCK-VTSRNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSF 355

Query: 1057 ALGAPTKVDSQPSLYRAKG-------ENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSA 1215
            ALGAPTKV++ P+LYR K        +N+ N   S   G   +++   RN H F+N+NSA
Sbjct: 356  ALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNRH-FSNNNSA 414

Query: 1216 KAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKM 1395
            KAFFDEKFQNPDML NL+SKRRKI D KK T + +EL K +  + S  L ++S  E ++M
Sbjct: 415  KAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQM 474

Query: 1396 KQTTESALQTGLIQRLGFDPTHGKISKVLKS--SVPGGESMPNRINGKKTVINDLLQYKK 1569
            K+ TE+ LQ+G+IQRLGFDPTHGKI+ VL++  S    +++  +++GKK  +NDLL ++K
Sbjct: 475  KRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRK 534

Query: 1570 EKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVASD------------ASGSDLEIV 1707
              VILAP++NE  ++R  RE +WQ +FG K   ++++            +S S+LEI+
Sbjct: 535  SHVILAPTRNELIERRDRRERIWQENFGQKRKPISANDLLAIEGSSSDSSSDSELEII 592

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
            Anc_5.703 YIL150C
          Length = 584

 Score =  595 bits (1533), Expect = 0.0
 Identities = 307/587 (52%), Positives = 409/587 (69%), Gaps = 18/587 (3%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            M DPREI   D Y N+T D+ED + I  ELE +E  K+ L+ERL RK+   +  DPNF  
Sbjct: 1    MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 181  VEVPQSPAKK---SIVKKSQDALKQAIRPVASNINESML-------SQQSQESPSNTTT- 327
            V+VP SP KK    +V++    LK   R   SN N + L        Q ++ + SN +T 
Sbjct: 61   VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120

Query: 328  YFMQKFQDAKRNEDKQIAKYEGMMNARVHTF-GTDNK-EYKPIITNELESFSNLWVKKRY 501
            YFM+KF+DAKR E   I K+E MM +RVHTF G + K EY+ +I +ELE +SNLW+ KRY
Sbjct: 121  YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180

Query: 502  IPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVK 681
             P  +LK  LHE+KILRLNKLFAK+RPPKF+EP Y+NW  VG++S KSDIKFT+S KP K
Sbjct: 181  TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240

Query: 682  FFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLR 861
            +  FT+TDF+H +D YIFGK+GVERYYNLR+GD+IA+LNPE+LPWRPSG+ N+IKSFNLR
Sbjct: 241  YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNLR 300

Query: 862  ISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIE 1041
            ISH +KCILEIG SRDL  CPIV + T K CG PIN  V  CC+YHRE++ R   +KR++
Sbjct: 301  ISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRLD 360

Query: 1042 LNGGYALGAPTKVDSQPSLYRAKGE-----NQFNIVRSTRKGLSEEEERVKRNSHNFTNS 1206
            L+G YALGAPTK++SQP+LYR           F +  S  +      ++    S  F+N 
Sbjct: 361  LSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKFFSNR 420

Query: 1207 NSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEK 1386
            N+AKAFFD++FQNPDM++NLD+KRRKI++ +KS  L+REL +++R+     LE K+  E 
Sbjct: 421  NAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRK--DQDLEGKTREEV 478

Query: 1387 QKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYK 1566
            +KMKQTT+  LQ+GL Q++GFDPT GKIS++LK+     +  P  ++ K   ++DL+ +K
Sbjct: 479  EKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMAFK 538

Query: 1567 KEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVASDASGSDLEIV 1707
            KE +ILAPSK +   K++ RE+VWQ +FG  ++   S+ S SDLEIV
Sbjct: 539  KEYIILAPSKVDLLNKKNKREKVWQENFGQNKSNDNSE-SDSDLEIV 584

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
            Anc_5.703 YIL150C
          Length = 567

 Score =  580 bits (1495), Expect = 0.0
 Identities = 295/577 (51%), Positives = 412/577 (71%), Gaps = 8/577 (1%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            M+DPRE++  DP+  +TSDEED++ +  ++  +ER+K+ L+ERLK K+  K  +DPNF+A
Sbjct: 1    MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKS-KDPNFDA 59

Query: 181  VEVPQSPAKKSI--VKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDA 354
            ++V  SP KK    +K      K+ +     N+NE  +  +SQ  P+NTT+YF+  F+++
Sbjct: 60   IQVESSPVKKPAESIKVEPSRTKRVLD--IENLNEKKVESRSQ-IPANTTSYFIDNFRNS 116

Query: 355  KRNEDKQIAKYEGMMNARVHTF-GTD-NKEYKPIITNELESFSNLWVKKRYIPEEDLKRA 528
            K+ E K   + + +++ RVHTF G D N ++K +   E+E +S+LWVK+RYI ++DL++ 
Sbjct: 117  KKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLRKV 176

Query: 529  LHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 708
            LHE+KILRL+KLFAKI+PPKF EP Y+NWA +G+IS K  +KF+SS KP+K+F FT+TDF
Sbjct: 177  LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236

Query: 709  QHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 888
            Q++LDVY+FGKKGVERYYNLR+GD++AILNPEVLPWRPS +GNFIKSFNLRISHDF CIL
Sbjct: 237  QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296

Query: 889  EIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGA 1068
            EIG SRD+ WC   NK  +K+CG+PIN     CCD+HRE+QFR   AKRIELNG +ALGA
Sbjct: 297  EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356

Query: 1069 PTKVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSH----NFTNSNSAKAFFDEK 1236
            PTKVDS P+LYR K        R+ +   +  ++ V +NS     +F+N N+AKAFF+++
Sbjct: 357  PTKVDSGPALYREKSAGAH---RNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKAFFNDE 413

Query: 1237 FQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESA 1416
            FQNPD+L NLDSKRRK  D KKS  L ++L +I  R  +  +E K   + +++ +TTE+ 
Sbjct: 414  FQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTEAT 472

Query: 1417 LQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSK 1596
            LQ+GLIQ LGFDPTHG+I  VLK +    +S   ++N K+  ++ LL++KKE V L P+K
Sbjct: 473  LQSGLIQNLGFDPTHGEIGNVLKQAAK-DKSNNGQLNKKQKEVSSLLKFKKEHVELKPAK 531

Query: 1597 NEWFKKRSHREEVWQRHFGSKETEVASDASGSDLEIV 1707
                +++  RE  WQ +FG K   ++SD S SD+EIV
Sbjct: 532  EVLLQRKRDRERAWQENFGDKSVNLSSD-SDSDIEIV 567

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
            similar to uniprot|P32354 Saccharomyces cerevisiae
            YIL150C MCM10 Essential chromatin-associated protein
            involved in the initiation of DNA replication required
            for the association of the MCM2-7 complex with
            replication origins
          Length = 569

 Score =  558 bits (1437), Expect = 0.0
 Identities = 288/577 (49%), Positives = 397/577 (68%), Gaps = 8/577 (1%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            M DPRE+L  D Y+ +TS+ E+E  I  ++  +ER+K+ L++RL  K+   KP DPN   
Sbjct: 1    MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 181  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQES-PSNTTTYFMQKFQDAK 357
            ++V  SP K +         +Q  R    N N + L  QSQE  P+NTT++F++K+  +K
Sbjct: 61   IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQEQIPANTTSFFIEKYSTSK 120

Query: 358  RNEDKQIAKYEGMMNARVHTFGTDNK--EYKPIITNELESFSNLWVKKRYIPEEDLKRAL 531
            R +D ++   E +++ RVHTF    +  EYKPI TNELE FSNLW+ KRYIP+E+ +   
Sbjct: 121  RKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSIF 180

Query: 532  HEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQ 711
              IKILRL+KLFAK++PPKF EP Y+NWA +GLIS+K ++KFTS+  P K+F FT+T+FQ
Sbjct: 181  ANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNFQ 240

Query: 712  HSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILE 891
            +S+D YIFGK+GVERYYNLR+GD+IAILNP+VLPWRPSG    IKSFNLRISH F+CILE
Sbjct: 241  YSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECILE 300

Query: 892  IGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAP 1071
            IG+SRDLGWCP+ NK  ++ C +PIN +   CC+YHRE++FR T AKR+EL+G YALGAP
Sbjct: 301  IGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGAP 360

Query: 1072 TKVDSQPSLYRAKGENQ----FNIVRSTRKGLSEEE-ERVKRNSHNFTNSNSAKAFFDEK 1236
            T++D+QP+LYR  G +Q    +NI+ +   G S +E   +  N+ +F+N N+AKAFFDE+
Sbjct: 361  TRIDAQPALYRG-GSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFDER 419

Query: 1237 FQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESA 1416
            FQNP+ L NL++KRRK+ D +KS  L+REL    ++     ++ KS  E  ++K+TTES 
Sbjct: 420  FQNPETLRNLENKRRKLRDNRKSNILNREL----KKNSELDIKHKSAEEIDEIKRTTEST 475

Query: 1417 LQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSK 1596
            + +G+++ LGFDPT GKI+ V K      +  P  +  K + +  LL +KK+ V L PSK
Sbjct: 476  MGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKP--LTEKDSSVASLLSFKKDNVKLKPSK 533

Query: 1597 NEWFKKRSHREEVWQRHFGSKETEVASDASGSDLEIV 1707
                K++  RE VW+ HFGS   E   D S SDLEIV
Sbjct: 534  EILIKQKRRRERVWKEHFGSGGDE--KDDSDSDLEIV 568

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
            Anc_5.703 YIL150C
          Length = 610

 Score =  554 bits (1428), Expect = 0.0
 Identities = 290/611 (47%), Positives = 408/611 (66%), Gaps = 42/611 (6%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            M+DPRE    DP+ +++  EE+E A+ +ELE ++R+K  L+ RLK  ++ +K  DPNF+ 
Sbjct: 1    MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 181  VEVPQSPAKKSI--------VKKSQDALKQAIR---------PVASNINESMLSQQSQES 309
            V++P +P +K+         + +++D  ++ +          P  + +      +  ++ 
Sbjct: 61   VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKL 120

Query: 310  PSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNK-------EYKPIITNELE 468
            PSNTT+YFM+KFQ  K+ E+ +  + E M+ ARVH F   NK       EY+P   NE+E
Sbjct: 121  PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 469  SFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSD 648
             +S L ++KRYIP+++L      IKILRLNKLFAK+RPPKF+EP Y+NW T+G+I+ K  
Sbjct: 181  EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 649  IKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG 828
            IKFTSS+KP K+F FTI+DF++++D++IF K  VERYYNLR+GD+IAILNPEVLPWRPS 
Sbjct: 241  IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300

Query: 829  --RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHK-SCGSPINTNVHMCCDYH 999
               G  IKSFNLRI+H++ CI+E+G S+DLG+CPI NK     +C +PI+ +    C YH
Sbjct: 301  NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360

Query: 1000 REVQFRGTGAKRIELNGGYALGAPTKVDSQPSLYRAKG--------ENQFNIVRSTRKGL 1155
            +E++FR  G+KRIELNG +ALGAP KV +QP LYR            N+FN+V+ +    
Sbjct: 361  QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420

Query: 1156 SEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKI 1335
            +E +   +R    F+++NSAKAFFDEKFQNPDML NLD+KRRKI D K+S  L +EL K 
Sbjct: 421  NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA 480

Query: 1336 MRRKDSSGLE-DKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESM 1512
            +  K S+ L  +K++ E  KMK  TE+ LQTG+IQRLGFDPTHGKI+KVL++    G+  
Sbjct: 481  IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSGKDN 540

Query: 1513 PNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVAS----- 1677
             +  + K   + DLL++KK KV+LAP+K E  K+++ REEVWQ+HFGS +          
Sbjct: 541  VHNTH-KVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLNDD 599

Query: 1678 -DASGSDLEIV 1707
             D S SDLEIV
Sbjct: 600  VDTSESDLEIV 610

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
            (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  547 bits (1409), Expect = 0.0
 Identities = 284/589 (48%), Positives = 402/589 (68%), Gaps = 20/589 (3%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            M+DPRE    D Y+N++SDE ++  I+++L+ +ER+KQ L+ERLK+K++ K   DPNF  
Sbjct: 1    MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 181  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINES------MLSQQSQESPSNTTTYFMQK 342
            V+VP SP K  +V+     LK   +P+ +N  E       +      +S   TT+YFM+K
Sbjct: 59   VQVPSSPKKSRVVE-----LKPTSKPIDNNEEEEEENPNEVALMTKDDSNYGTTSYFMEK 113

Query: 343  FQDAKRNEDKQIAKYEGMMNARVHTF-GTDNK-EYKPIITNELESFSNLWVKKRYIPEED 516
            F ++K++ ++++  Y  MM++RVHTF GT +K E+KP   +EL+ +SNLW++ RYIP ++
Sbjct: 114  FYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDE 173

Query: 517  LKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFT 696
            L   L +IKILRL KLFAK+RPPKF EP Y+NW   G+I+ K DIK+TSS KP K+F FT
Sbjct: 174  LNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFT 233

Query: 697  ITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS----GRGNFIKSFNLRI 864
            I+DFQH+LDV+IFG KGVE+YYNLR+GDV+AILNPE+LPWRPS    G G+ IKSFNLRI
Sbjct: 234  ISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRI 293

Query: 865  SHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIEL 1044
            SH F CILEIG+SRDLGWCPI N   +  C +PIN +    C YHRE+QFR T + R+EL
Sbjct: 294  SHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVEL 353

Query: 1045 NGGYALGAPTKVDSQPSLYRAKG-------ENQFNIVRSTRKGLSEEEERVKRNSHNFTN 1203
            +G YALGAPTKVD++P+LY+ +G       +  +N+V  +     ++  +++   H+F+ 
Sbjct: 354  SGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFST 413

Query: 1204 SNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGE 1383
             NSAKAFFDE FQNPD+L NLDSKRRKI D+K    + R L K ++        DK    
Sbjct: 414  MNSAKAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNLVKALK-----NTVDKESKN 464

Query: 1384 KQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQY 1563
             + +K  T++ LQTG++QRLGFDPT GK+S V+++S    E        KK  ++DL+ +
Sbjct: 465  FKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTF 524

Query: 1564 KKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEV-ASDASGSDLEIV 1707
            +K+ V L PSK++  K+R  R+  W++ FG +++ +  +D SGSDL+I+
Sbjct: 525  RKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQSSIDNNDDSGSDLKIL 573

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
            YIL150C
          Length = 616

 Score =  547 bits (1409), Expect = 0.0
 Identities = 287/615 (46%), Positives = 408/615 (66%), Gaps = 48/615 (7%)
 Frame = +1

Query: 7    DPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA-V 183
            DPR+++  DPY+N+TSDE++E  I +ELE MER+K+ L +RLK K+   KP D N +  V
Sbjct: 4    DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 184  EVPQSPAKKSIV--------KKSQDALKQAIRPVASN------INESMLSQ----QSQES 309
            +VP SP K+S+         ++  +A+K+    +A N      +NE+  +Q      ++S
Sbjct: 64   QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123

Query: 310  PSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWV 489
             + TT+YF++KFQ +K+ E  +I   E M++ARVHTF   +KE++    NELE FS+LW+
Sbjct: 124  VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQFSDLWI 183

Query: 490  KKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSE 669
             KRYIP++ L+ +L ++K+LRLNKLFAK+RPPKFQEP Y+NWA + +IS KS++KFT+S+
Sbjct: 184  SKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSK 243

Query: 670  KPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG---RGNF 840
             P KF  FT+T+FQ  LD+++FG  GV+RYYNLR GD++A+LNPE+LPWRPSG   +   
Sbjct: 244  NPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQTTS 303

Query: 841  IKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRG 1020
            IKSFNL+I+H FKCILEIG SRDLG+CP+  K +++ CGS IN      C+YHRE+Q R 
Sbjct: 304  IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQMRQ 363

Query: 1021 TGAKRIELNGGYALGAPTKVDSQPSLYRAKGENQFNIVRSTRK----------------- 1149
              +KR++LNGG+ALGAPTKV +QP L+R          RS  +                 
Sbjct: 364  NSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNSRHG 423

Query: 1150 --GLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRE 1323
              G SEE   +K     FT+SN+AKAFFD++FQNPDML NLD+KRRK+ D+KKS  L R+
Sbjct: 424  QGGSSEENYGLK--GKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDRK 481

Query: 1324 LGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLK---SSV 1494
            L +++ + +     DK+  E   +K+TTE+AL TGLIQRLGFDPTHG+ + V+K   S  
Sbjct: 482  LKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSER 541

Query: 1495 PGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVA 1674
              G +    ++ K+ ++N+LL++K++K  L PS+ +   ++ HR EVW+  FG K T V 
Sbjct: 542  GSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGTPVD 601

Query: 1675 S----DASGSDLEIV 1707
            S    +    DLEIV
Sbjct: 602  SQPVDNDDSDDLEIV 616

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar to
            uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  536 bits (1380), Expect = 0.0
 Identities = 284/594 (47%), Positives = 401/594 (67%), Gaps = 26/594 (4%)
 Frame = +1

Query: 4    DDPREILAVDPYNNVTSDEEDEQA-IAKELEFMERKKQALMERLK--RKQDFKKPEDPNF 174
            +DPRE+  +DPY +++ D++++++ I +ELE +ERKKQ L+ RLK  +++   K  DPN 
Sbjct: 7    NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 175  E------AVEVPQSPAKKSIVKKS-------QDALKQAIRPVASNINESMLSQQSQESPS 315
            +       VEVP+SP ++S+  +        Q    QA     +N NE  + ++  +  +
Sbjct: 67   KNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAANNKKANPNEEDIVRKELDVVA 126

Query: 316  NTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFG--TDNKEYKPIITNELESFSNLWV 489
             TT+YF  KF+++K +E++ +  Y+ MM+AR HTF   T   + K I  +ELE +SN  +
Sbjct: 127  -TTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFHI 185

Query: 490  KKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSE 669
            KKRYIP++++ + LH IKILRLNKLFAK+RPP F EP Y+NW  +G IS K D+K T++ 
Sbjct: 186  KKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNAA 245

Query: 670  KPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKS 849
            KPVK+F FT+TDF+H+LDVY+FGKK VERYYNLR+GD+IA+LNPE+LPWRPSG  N IKS
Sbjct: 246  KPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGIKS 305

Query: 850  FNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGA 1029
            FNLRI HDF CILEIG+SRDLGWC +VN    K C SPINT    CC++HRE+Q R T +
Sbjct: 306  FNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRSTAS 365

Query: 1030 KRIELNGGYALGAPTKVDSQPSLYRAKGEN------QFNIVRSTRKGLSEEEERVKR--N 1185
            KRIEL+G YALGAPTKV +QPS+Y+   ++      +  +   T  G  +E+E+ K    
Sbjct: 366  KRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSKKEQEKEKHEIE 425

Query: 1186 SHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLE 1365
            +H+F+N  +AKAFFD+ FQ+P +LANL+SKRRKI    K++ + R L K +  +D+S   
Sbjct: 426  AHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALNGEDAS--- 478

Query: 1366 DKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVI 1545
                  KQ++K+ TE  LQTG+IQRLGFDP+ G+I+KVL  S  G ++    I+ K  +I
Sbjct: 479  --QSKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKS-RGTKTDDPTISKKMGLI 535

Query: 1546 NDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVASDASGSDLEIV 1707
            NDL+ +KK+K+ L PS+    +KR  RE +W++HF        ++ S SDLEIV
Sbjct: 536  NDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQD------TNDSDSDLEIV 583

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
            Anc_5.703 YIL150C
          Length = 544

 Score =  511 bits (1315), Expect = e-176
 Identities = 270/550 (49%), Positives = 363/550 (66%), Gaps = 21/550 (3%)
 Frame = +1

Query: 121  MERLKRKQDFKKPEDPNFEAVEVPQSPAKKSI---VKKSQDALKQAIRPVASNINESMLS 291
            M+RLK K++ +K  DPNF  +++ +SP KK        +   LK+ +  V  N NE+ + 
Sbjct: 1    MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDV--NPNEAKVV 58

Query: 292  QQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDN--KEYKPIITNEL 465
              +   P+NTT+YFMQ F  AK+ E KQ+ +Y+  M++RVH+F   N  K+Y+ II  EL
Sbjct: 59   SNAN-LPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEEL 117

Query: 466  ESFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKS 645
            E +S   + KRY+P+E++ + LH IKILRLNKLFAKIRPPKF EPDYANWA  G+I  K 
Sbjct: 118  EEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKE 177

Query: 646  DIKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS 825
            DIK TSS+ PVKFF FTIT+FQH+LD++IFG  GVE+YYNLR+GD+I ILNPEVLPWRP 
Sbjct: 178  DIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPE 237

Query: 826  GRGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHRE 1005
             +GN IKSFNLRISH F CILEI  S+D+ WC  +N+KT   C +PIN +    CDYH+E
Sbjct: 238  FKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKE 297

Query: 1006 VQFRGTGAKRIELNGGYALGAPTKVDSQPSLYRAKGE------NQFNIVRSTRKGLSEEE 1167
            +QFR   AKR+EL+G YALGAPT++DS+P+LYR+K        N FNIV   R    +E 
Sbjct: 298  MQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKEN 357

Query: 1168 ERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRK 1347
            + +    H+F++SNSAKAFFDE FQNPDML NL++KRRKI D K+   L R L + +   
Sbjct: 358  DPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRALRESVGNS 417

Query: 1348 DSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRIN 1527
                L+DKS  E Q M+ TT++ LQ G IQ+LGFDPT G+I  VL+ S    +S  +++ 
Sbjct: 418  KLL-LKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKS--ADKSTQSKLQ 474

Query: 1528 GKKT-VINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGS---------KETEVAS 1677
             +K+  + +L+ +KK  V L PS+    +K  HRE+ + ++  S         K     +
Sbjct: 475  KQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSASTKN 534

Query: 1678 DASGSDLEIV 1707
            D    DLEI+
Sbjct: 535  DTDSDDLEII 544

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
            YIL150C
          Length = 594

 Score =  506 bits (1304), Expect = e-174
 Identities = 267/605 (44%), Positives = 384/605 (63%), Gaps = 36/605 (5%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNF-- 174
            M+DPRE+   D ++N++ DE++E  + K++E +ER+K+ L ERL+ K+   +  DPNF  
Sbjct: 1    MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 175  ----------EAVEVPQSPAKKSIVKKSQDALKQAIRPVAS-------NINESMLSQQSQ 303
                        ++VP SP K   +K+    L  A  PV         N NE  L  Q +
Sbjct: 61   TEGNVDATSESRIQVPGSPEK---IKRKHTQL--AATPVTKKNTGIQDNPNELKLKNQIE 115

Query: 304  ES--PSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDN---KEYKPIITNELE 468
             +  P+ +T YFM  F  +K+ E ++I  YE +M+ARVH+FG      KE + I   E E
Sbjct: 116  PASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKE 175

Query: 469  SFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSD 648
             +S LW+ +RY+ EE + + L +IKILRLNKLFAKIRPPKF+ P Y+NW  VG+I+ KS 
Sbjct: 176  KYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSG 235

Query: 649  IKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG 828
             K TSS  P K+F FTI DFQ ++ +++F ++ + +YYNLR+GD+I ILNP + PWRPS 
Sbjct: 236  FKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSE 295

Query: 829  RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPI-VNKKTHKSCGSPINTNVHMCCDYHRE 1005
               +IKSFNL I   + CI+EIG SRDLGWC + V  K  K CG+PIN     CC++HRE
Sbjct: 296  ENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRE 355

Query: 1006 VQFRGTGAKRIELNGGYALGAPTKVDSQPSLYRAK-----GENQFNIVRSTRKGLSEEEE 1170
             +FR   AKRIELNG +ALGAPTK D+ PSLY+ K      +NQFN+VR  R+   +E +
Sbjct: 356  TEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVR--RRNARKEGD 413

Query: 1171 RVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKD 1350
                NS NF ++N AKAFF+++FQNPD+++NLDSKRRK+ D K+ + L +EL K + ++D
Sbjct: 414  SKLHNS-NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKED 472

Query: 1351 --SSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRI 1524
              S  LE KS+ + ++M+  TE+ +Q G+++ +G+DPTHGK+  ++K S   G+  P+  
Sbjct: 473  NVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS--NGKD-PSYT 529

Query: 1525 NGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFG----SKETEVASDASGS 1692
            + +   +NDLL +KK+KV L P K++   K+  R+E+W  +FG    S    + S    S
Sbjct: 530  SNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDS 589

Query: 1693 DLEIV 1707
            DLEIV
Sbjct: 590  DLEIV 594

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp, 583
            aa] {ON} similar to uniprot|P32354 Saccharomyces
            cerevisiae YIL150C MCM10 Essential chromatin-associated
            protein involved in the initiation of DNA replication
          Length = 583

 Score =  479 bits (1232), Expect = e-163
 Identities = 247/583 (42%), Positives = 379/583 (65%), Gaps = 16/583 (2%)
 Frame = +1

Query: 7    DPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVE 186
            DPRE+L +D ++ VTSDE+++  I ++L+ +ER+++ L +RL++K   KK +  + E VE
Sbjct: 6    DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERVE 65

Query: 187  VPQSPAKKSIVKKSQDALKQAIR-PVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRN 363
            VP SP ++   K S  + K +    +A+N N   +    +  PSNTT+YF++ F +A++ 
Sbjct: 66   VPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVPWKNGPSNTTSYFVENFVNARKV 125

Query: 364  EDKQIAKYEGMMNARVHTF-GTDN-KEYKPIITNELESFSNLWVKKRYIPEEDLKRALHE 537
            E+++I     +++ RVHTF G D+ K  +P+  +E E +S   + +RY+   +L   + E
Sbjct: 126  EEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIMRE 185

Query: 538  IKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHS 717
            IK+LRL KLF+K+RPPKF EPDYANW  +G+IS KS++K TSS KP K+F  T+TDF H+
Sbjct: 186  IKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFTHN 245

Query: 718  LDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG------RGNFIKSFNLRISHDFK 879
            LD+YIF  K VE+YYNLR+GD+IAILNP++LPWRPS        G  +KSFNL I H+F 
Sbjct: 246  LDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHNFD 305

Query: 880  CILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYA 1059
            C+LEIG+S+DLG+C I NK T K+CG+PIN      C+YH++V+FR   A+R+ELNG  +
Sbjct: 306  CVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGSTS 365

Query: 1060 LGAPTKVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKF 1239
            L +P K   + +LY   G  +  +     K   + ++   +N+  F+N N AKAFFD+ +
Sbjct: 366  LRSPVKNGKKQALYGTSGVKR-KLQLLPDKHAPQAQDGESQNTLFFSNPNYAKAFFDDSY 424

Query: 1240 QNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESAL 1419
            QNPDML NL++KRRK+ D++K   L  +L   + +       +KS+ E+++MK  TE  L
Sbjct: 425  QNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDATEQVL 484

Query: 1420 QTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKN 1599
             +GL++ +GFDP  GK+ +VLK     G+++ + +N K + + +++ +KK  V LAPSK 
Sbjct: 485  NSGLLRDIGFDPFRGKMREVLKF----GKNVNSGLNSKSSQVKEIMSFKKSNVSLAPSKA 540

Query: 1600 EWFKKRSHREEVWQRHFGS-------KETEVASDASGSDLEIV 1707
            E  K+   RE+VW+ HF +       ++   +S++S SDLEIV
Sbjct: 541  EQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESSDSDLEIV 583

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
            aa] {ON} similar to uniprot|P32354 Saccharomyces
            cerevisiae YIL150C MCM10 Essential chromatin-associated
            protein involved in the initiation of DNA replication
            required for the association of the MCM2-7 complex with
            replication origins
          Length = 574

 Score =  467 bits (1201), Expect = e-158
 Identities = 247/585 (42%), Positives = 374/585 (63%), Gaps = 16/585 (2%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            M+DPRE   +D ++ ++ DE+D+  + K L+ +ER+K+ L +RL+     KK  DPNF  
Sbjct: 1    MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 181  VEVPQSPAKKSIV-----KKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKF 345
            VEVP+SP+K   V      +S+D  +++  P   N+NE  + +++  S S +T YF Q F
Sbjct: 59   VEVPRSPSKSKHVAVKETSRSKDD-RESCFPAHENLNELQVQKKASLS-SISTPYFAQNF 116

Query: 346  QDAKRNEDKQIAKYEGMMNARVHTFGTDN--KEYKPIITNELESFSNLWVKKRYIPEEDL 519
              +K+ ++ +  +   M+N RVHTF   +  +EY PI  NE E FS  W+ KRYI  E  
Sbjct: 117  SSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQA 176

Query: 520  KRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTI 699
            ++ L E K+LRL KLFAK+RPP F EP Y+NW T+G+IS KS +K T+  KP ++F  T+
Sbjct: 177  RKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTL 236

Query: 700  TDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS------GRGNFIKSFNLR 861
            TDF+H++++Y+FG K VE+YYNL++GD+IA+LNPE+ PWRPS           IKSFNL 
Sbjct: 237  TDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLC 296

Query: 862  ISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIE 1041
            I H+F  ILEIG+SRD G+C I NK   K+CG+PIN +V   C YH+EVQFR   AKR+E
Sbjct: 297  IKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLE 356

Query: 1042 LNGGYALGAPTKVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKA 1221
            LNG  +L +PTK   +  LY      +++++    +   + + +  +N   F+N N+A+A
Sbjct: 357  LNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPD--RYAPQTQSKDSQNVLYFSNPNAARA 414

Query: 1222 FFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQ 1401
            FFD+ +QNPD L NLDSKRRK+   KK   L ++L +++ + +S+  ++++  ++ ++++
Sbjct: 415  FFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTKQDEIRR 474

Query: 1402 TTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVI 1581
             T++AL++GLI+++GFDPT G++S VLK++  G +        K + + ++LQ KKEK+ 
Sbjct: 475  ATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKE-----QAKNSAVEEILQIKKEKIE 529

Query: 1582 LAPSKNEWFKKRSHREEVWQRHFGSKETE---VASDASGSDLEIV 1707
            L PSK    +K   REEVW  HF  +E     V S    S+LEIV
Sbjct: 530  LKPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGDSELEIV 574

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
            YIL150C (DNA43) - (putative) involved in DNA replication
            [contig 159] FULL
          Length = 466

 Score =  419 bits (1076), Expect = e-141
 Identities = 215/472 (45%), Positives = 307/472 (65%), Gaps = 14/472 (2%)
 Frame = +1

Query: 334  MQKFQDAKRNEDKQIAKYEGMMNARVHTFG--TDNKEYKPIITNELESFSNLWVKKRYIP 507
            M+ F ++++ E+ +I     M+++RVHTF      K  KPI   E E  S LWV +RYI 
Sbjct: 1    MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 508  EEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFF 687
             ++L   L +IKILRL KLF+K+RPPKF EPDYANW  VG++ HKS +K TSS KP K+F
Sbjct: 61   SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 688  MFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGN------FIKS 849
              TITDF HSLDVY+F    VE+YYNLR+GD+IAILN ++LPWRPS  GN       +KS
Sbjct: 121  KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 850  FNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGA 1029
            FNL I  ++ C+LEIG+SRDLG+C I NK   K CG+PIN      CDYH+E++FR   A
Sbjct: 181  FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 1030 KRIELNGGYALGAPTKVDSQPSLYRAKG-ENQFNIVRSTRKGLSEEEERVKRNSHNFTNS 1206
            +R+ELNG  +L +P K   + +LY + G + + N++    K   ++++R  +N+  F+N 
Sbjct: 241  QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPD--KHAPQQQDRESQNTLYFSNP 298

Query: 1207 NSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEK 1386
            N AKAFFD+ +QNPD+L NLDSKRRK+ DT+    L  +L + + +       +K++ E+
Sbjct: 299  NYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQEQ 358

Query: 1387 QKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYK 1566
            ++MKQ TE  + +GL++ +GFDPT GK+  VLK     G++  N  + K   + ++++ +
Sbjct: 359  KQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKV----GKNSKNSTDTKSIQVREIIETR 414

Query: 1567 KEKVILAPSKNEWFKKRSHREEVWQRHFGSK-----ETEVASDASGSDLEIV 1707
            K  V LAPSK +  K+   RE+VW+ HF +K       ++ SD+S SDLEIV
Sbjct: 415  KTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  384 bits (987), Expect = e-126
 Identities = 222/613 (36%), Positives = 337/613 (54%), Gaps = 45/613 (7%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDE-----------------------QAIAKELEFMERKK 111
            ++DPREI+    Y+ + SDEED                          +   L+ +E ++
Sbjct: 6    LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64

Query: 112  QALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLS 291
              L+ RL+  +   K +      VEVP+SP K   V+        A         E+   
Sbjct: 65   SDLLARLEELKHRSKKKAKKSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVEEPEENENE 124

Query: 292  QQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNK--EYKPIITNEL 465
            +    + + TT+YF +KF  A+ +    + + + ++  RV+TF   +   EY     +E+
Sbjct: 125  RYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEV 184

Query: 466  ESFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKS 645
            E++SN+ + KRY+PEEDLKR LH+IK+LRL KLFAK+RPPKF EPDYANW T+G IS+KS
Sbjct: 185  ETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKS 244

Query: 646  DIKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS 825
            D+K TS EKP K+F   ITDF + + + +FG+K VE+YY LR+GDVIAILNPE+ PW+ S
Sbjct: 245  DVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKES 304

Query: 826  GR------GNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMC 987
             +          +SF L I H+  CILEIG S++LG+CP +NK     CG+PIN      
Sbjct: 305  AKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQV 364

Query: 988  CDYHREVQFRGTGAKRIELNGGYALGAPTKVDSQPSLYRAKGENQFNI-----VRSTRKG 1152
            C YH+E   R   AKR+ELNG  +L APT+   Q + Y  +  +   I     V + R  
Sbjct: 365  CSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPRAP 424

Query: 1153 LSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGK 1332
             +E++ R      +F ++N+ +A+FD  + NPD+L NL+SKRRKI  +KK   ++++L  
Sbjct: 425  GAEQKFR-----EHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSL 479

Query: 1333 IMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESM 1512
            ++ +  +   +  SE   Q+ ++ T++ ++TG+++ +GFDPT G+++ VL     G    
Sbjct: 480  VLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPAD- 538

Query: 1513 PNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHF---------GSKET 1665
                  ++  I+++L  KK  + L PSK    K+   R EV+   F         GS ET
Sbjct: 539  ----TVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCET 594

Query: 1666 EVASDASGSDLEI 1704
               S A  SD E+
Sbjct: 595  AQLSSADSSDEEL 607

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp, 577
            aa] {ON} similar to uniprot|P32354 Saccharomyces
            cerevisiae YIL150C MCM10 Essential chromatin-associated
            protein involved in the initiation of DNA replication
          Length = 577

 Score =  361 bits (926), Expect = e-117
 Identities = 212/583 (36%), Positives = 333/583 (57%), Gaps = 14/583 (2%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            + DPREI A DPY  ++ DE + + + + +  ++ +K+ L  RL   +  +  +DPNF++
Sbjct: 5    LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 181  VEVPQSPAKKSIVKKSQDALKQAIRPVAS------NINESMLSQQSQESPSNTTTYFMQK 342
            ++VP+SP K     K  + +K  I PVA       N+NE  + ++ ++    TT+YF +K
Sbjct: 65   IDVPESPKKSDNATKGIEDIKH-IAPVADIEEATFNVNEDYVREKVKKL--GTTSYFTEK 121

Query: 343  FQDAKRNEDKQIAKYEGMMNARVHTFGTDN-KEYKPIITNELESFSNLWVKKRYIPEEDL 519
             +    NE + I + + ++  RV+TF  D   EY+PI  +E +  S L + +RY+P   L
Sbjct: 122  LRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAVL 181

Query: 520  KRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTI 699
            ++    IK+LRL KLF+K+R PKF EPDY NW  +G+IS K++ + T+S KPVKFF  TI
Sbjct: 182  RKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLTI 241

Query: 700  TDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWR--PSGRGNFIKSFNLRISHD 873
            +DFQ  L+V  FGK  VE+YY LRLGD+IAILNPE++P +   +G      +F+L++S D
Sbjct: 242  SDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSKD 301

Query: 874  FKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGG 1053
               ILE+G S++ G C    K   K CG+PIN      C YH+E + R   ++R+E++  
Sbjct: 302  TNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISSS 361

Query: 1054 YALGAPTKVDSQPSLYRAK---GENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAF 1224
             A+ AP     Q ++ +++   G+      ++  K    E    + N   F+++N++ AF
Sbjct: 362  VAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTAF 421

Query: 1225 FDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQT 1404
            FD+ ++NPD+LANLD+KRRKI + + +  L ++L K +  K  S  ED+   E +  K  
Sbjct: 422  FDDDYENPDILANLDNKRRKIQELRNNRNLEKKL-KGLSDKLLSKKEDRVNQEAK--KTA 478

Query: 1405 TESALQTGLIQRLGFDPTHGKIS-KVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVI 1581
            T S  Q GL  ++G+DPT GK S ++L+ S           N K+  I D+   KK+ V 
Sbjct: 479  TLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPK----NDKQLAITDICNIKKDNVS 534

Query: 1582 LAPSKNEWFKKRSHREEVWQRHF-GSKETEVASDASGSDLEIV 1707
            L PSK +  +K   R  ++     GS+E     + S  DLEI+
Sbjct: 535  LKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577

>NCAS0A12840 Chr1 complement(2532530..2534368) [1839 bp, 612 aa]
           {ON} Anc_2.586 YKL054C
          Length = 612

 Score = 39.3 bits (90), Expect = 0.029
 Identities = 30/123 (24%), Positives = 57/123 (46%), Gaps = 3/123 (2%)
 Frame = +1

Query: 43  NVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPA-KKSIV 219
           NV ++EE+E +  +  E  E  ++      + +   ++ E    +A E  ++ + KKS V
Sbjct: 246 NVENEEEEESSEEESSEEEETSEEEESSEEEEESSEEEEESSEEKAKEEEKTVSVKKSEV 305

Query: 220 KKSQDALKQAIRPVAS--NINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEG 393
           KK++  + QA     S  +  E +  QQ QE P    +   Q +   ++ + +Q  +Y G
Sbjct: 306 KKAKAEVPQAAPQTESLQSKPEPVQQQQQQEQPQQDISQQQQNYYQQQQQQQQQQQQYPG 365

Query: 394 MMN 402
             N
Sbjct: 366 QQN 368

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score = 39.3 bits (90), Expect = 0.030
 Identities = 43/187 (22%), Positives = 85/187 (45%), Gaps = 4/187 (2%)
 Frame = +1

Query: 55  DEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNF-EAVEVPQSPAKKSIVKKSQ 231
           +E   + I  ++   +R K    + L+ K+ + K     + E  E  Q   +K+   KS+
Sbjct: 192 EEIRNKMITNDVALQQRMKDIEADHLEEKEKWLKDYQKEWREVTEKNQESIRKTKELKSE 251

Query: 232 DALKQAIRPVASNINESMLSQQSQ-ESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNAR 408
             ++  + P     N+ +   +S+ +   +T     ++  + ++N D +  K + ++  +
Sbjct: 252 --IETVLTPRIDTQNKRLEELKSEIKKLDDTLQNKNEQVGEIRKNIDLEREKKDKLLAEK 309

Query: 409 VHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALH-EIKILRLN-KLFAKIRP 582
                   K  K     E+E      +KK  + EE L+RALH E++ LR N +++ +IRP
Sbjct: 310 EEILAYIEKSKK-----EVEE-----IKKILVKEESLRRALHNELQELRGNIRVYCRIRP 359

Query: 583 PKFQEPD 603
           P   E D
Sbjct: 360 PLPHEDD 366

>SAKL0G15818g Chr7 (1363027..1364970) [1944 bp, 647 aa] {ON} similar
            to uniprot|Q07457 Saccharomyces cerevisiae YDL074C BRE1
            E3 ubiquitin ligase for Rad6p required for the
            ubiquitination of histone H2B recruitment of Rad6p to
            promoter chromatin and subsequent methylation of histone
            H3 (on L4 and L79) contains RING finger domain
          Length = 647

 Score = 38.5 bits (88), Expect = 0.052
 Identities = 42/218 (19%), Positives = 95/218 (43%), Gaps = 11/218 (5%)
 Frame = +1

Query: 22   LAVDPYNNVTS--DEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA----- 180
            L  +  N ++S  D  D+ A+ KEL+ +E+  + L     +K      E  N E+     
Sbjct: 373  LQTEQINKLSSRCDSNDQNALMKELQDLEKAFKELSSLSHKKYS----EYMNHESIISKL 428

Query: 181  -VEVPQSPAKKSIVKKSQDALKQAIRPVASNI---NESMLSQQSQESPSNTTTYFMQKFQ 348
             VE  ++  K     +S+D++    + ++ N+   NE +L  +  E         ++K  
Sbjct: 429  TVEKTKADQKYFAAMRSKDSILIENKNLSKNLSKSNELILQLKDLEKTLQLKIENLEKQM 488

Query: 349  DAKRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRA 528
               +N +K++ +     + ++    +   + K ++ N LES +     ++   E  L  +
Sbjct: 489  QLSQNNEKRLIESNKSTSLKIMELTSQVNKSKKLL-NSLESNNKKLTTEKTELESKLNDS 547

Query: 529  LHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHK 642
              E+K +++  + A+ +  K  +   +N    G+I+ +
Sbjct: 548  SIELKTMKVRVVHAETKAKKLHKSLISNGGDAGVIAEE 585

>NDAI0B06190 Chr2 (1503529..1506372) [2844 bp, 947 aa] {ON} Anc_3.547
          Length = 947

 Score = 38.1 bits (87), Expect = 0.074
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 5/102 (4%)
 Frame = +1

Query: 994  YHREVQFRGTGAKRIELNGGY-ALGAPTKVDSQPSLYRAKGENQFNIVRSTRKGLSEEEE 1170
            Y R +  + T  K+ ELNG +  L      +++P+    K + +FN   S     + E+E
Sbjct: 548  YKRNLYLQSTNDKKHELNGAFNELTLNDNNNNEPAKKIMKNDTKFNANDSINNHNNNEKE 607

Query: 1171 RVKRNSHNFTNSN----SAKAFFDEKFQNPDMLANLDSKRRK 1284
                N H  TN N          DE F+ P +  N + K RK
Sbjct: 608  ETSTNEHINTNQNIFAIDDVEEVDESFEIPYVGINQNEKLRK 649

>TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4.77
           YGR145W
          Length = 698

 Score = 37.4 bits (85), Expect = 0.12
 Identities = 27/127 (21%), Positives = 54/127 (42%), Gaps = 6/127 (4%)
 Frame = +1

Query: 58  EEDEQAIAKELEFMERKK------QALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIV 219
           E+D++ +AK+ E +ER++      +  M +LK  +     +    E         KK   
Sbjct: 569 EKDKKRLAKQREAVERRRKERIESEKYMNKLKASRGDSNDKQLQEETFGKKVRELKKEEF 628

Query: 220 KKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMM 399
            K QD      R        + + ++ + +P N  T   Q+  + KR+  +   +++G  
Sbjct: 629 AKKQDGGSTVHRNHRGEAELTFIPKKKESTPKNIRTNTEQEEGEVKRDNGRSRPRFKGRR 688

Query: 400 NARVHTF 420
           +A  +TF
Sbjct: 689 SASKNTF 695

>SAKL0H03344g Chr8 (318176..320833) [2658 bp, 885 aa] {ON} similar to
            uniprot|P11325 Saccharomyces cerevisiae YLR382C NAM2
            Mitochondrial leucyl-tRNA synthetase also has a direct
            role in splicing of several mitochondrial group I introns
            indirectly required for mitochondrial genome maintenance
          Length = 885

 Score = 37.4 bits (85), Expect = 0.13
 Identities = 25/118 (21%), Positives = 55/118 (46%)
 Frame = +1

Query: 196  SPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQ 375
            S  +KS++ ++   L   I PV  +I+E  +   +       + Y   + + AK   +  
Sbjct: 766  SSVRKSVIMRAVQKLVTVIYPVVPSISEEAVDIINGNQNWEWSQYNWPQLETAK---ESN 822

Query: 376  IAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALHEIKIL 549
            I  Y+ M+N ++      ++++     N +E+   L   KRYI  +++K  + + K++
Sbjct: 823  IVNYQVMINGKIRFTYPADQDFIKDRDNVIETLKTLPEGKRYIVGKEIKNVILKRKVI 880

>Smik_15.385 Chr15 complement(668338..669750) [1413 bp, 470 aa] {ON}
            YOR198C (REAL)
          Length = 470

 Score = 36.6 bits (83), Expect = 0.19
 Identities = 44/189 (23%), Positives = 87/189 (46%), Gaps = 15/189 (7%)
 Frame = +1

Query: 1108 KGENQFNIVRSTRKGLSEEEERV--------KRNSHNFTNSNSAKAFFDEKFQNPDMLAN 1263
            + + + N + S  +G+ ++ + +        K+    ++     +A FD +F++    A 
Sbjct: 188  ENQQKLNDIHSKTQGVYDKRQTLFNKRTALYKKRDELYSQIRQIRADFDNEFKS--FRAK 245

Query: 1264 LDSKRRKIIDTKKSTALSRELGKIMRRKD--SSGLEDKSEGEKQKMKQTTESALQTGLIQ 1437
            LD +R K  + +K       L K++ +KD     L++K    K         A++  L  
Sbjct: 246  LDKERLKREEEQK-------LSKLLEQKDVDMGKLQEKLTHAKIPAFTYEIGAIENSL-- 296

Query: 1438 RLGFDPTHGKISKVLKSSVPGG--ESMPNRINGKKTVINDLLQYKKEK---VILAPSKNE 1602
             L  DPT+ K  K + + +     E+ P R    K V +DL+    +K   V +APSK++
Sbjct: 297  -LVLDPTYVKPKKNILADLSDNVMETKPAR----KVVADDLVLVTPKKDDFVNVAPSKSK 351

Query: 1603 WFKKRSHRE 1629
             +KK++ ++
Sbjct: 352  KYKKKNQQK 360

>ZYRO0D01276g Chr4 complement(96840..98846) [2007 bp, 668 aa] {ON}
           weakly similar to uniprot|Q06604 Saccharomyces
           cerevisiae YPR171W BSP1 Adapter that links synaptojanins
           Inp2p and Inp53p to the cortical actin cytoskeleton
          Length = 668

 Score = 36.6 bits (83), Expect = 0.21
 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 6/133 (4%)
 Frame = +1

Query: 13  REILAVDPYNNVTSDEEDEQAIAKELEFME--RKKQALMERLKRKQDFKKPEDPNFEAVE 186
           R +   D + N  + E D  A  K+    E  +K  +L E LKR  +  K   P     +
Sbjct: 461 RHVDRTDSHGNKINSEADFTAKLKKTTPPEVPKKNPSLPEALKRLSNLSKAAPPPKPEED 520

Query: 187 VPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFM----QKFQDA 354
           VP++  K   + ++    K+A     +  +   L++ S++ P  T    M    QK Q+ 
Sbjct: 521 VPEALTKVGHLSRAAPPPKRAEDVPEALAHLEKLNKVSKQPPVPTRKISMGEALQKAQEL 580

Query: 355 KRNEDKQIAKYEG 393
           K+ + KQ    EG
Sbjct: 581 KKQQQKQSQSSEG 593

>YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA
           helicase in the DEAD-box family, necessary for
           prespliceosome formation, bridges U1 and U2 snRNPs and
           enables stable U2 snRNP association with intron RNA
          Length = 849

 Score = 36.6 bits (83), Expect = 0.22
 Identities = 43/171 (25%), Positives = 74/171 (43%), Gaps = 15/171 (8%)
 Frame = +1

Query: 46  VTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKK 225
           VT+  E +Q   K  E  ER K+ L    KRK +F+K ++P   +V+  +  +K+S VKK
Sbjct: 47  VTNSLEGKQTTEKFTERQERVKEELR---KRKNEFRKSDEP--VSVKPSKKKSKRSKVKK 101

Query: 226 ------SQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKY 387
                 S D   +    V+    E +      ++  +    FM   ++ K +  K +   
Sbjct: 102 KISFDFSDDDDSEI--GVSFRSKEHIQKAPEHDNEKDPLDEFMTSLKEEKMSNSKGMYDR 159

Query: 388 EGMMNARVHTF---GTDNKEYKPIITN-ELESFSNLWVKKR-----YIPEE 513
             +++     F   GTD+++ +    N  +   + L  KKR     Y PEE
Sbjct: 160 GDILDVEDQLFELGGTDDEDVEDNTDNSNIAKIAKLKAKKRVKQIYYSPEE 210

>KAFR0A07410 Chr1 (1496247..1497308) [1062 bp, 353 aa] {ON} Anc_2.91
            YNL164C
          Length = 353

 Score = 36.2 bits (82), Expect = 0.22
 Identities = 35/126 (27%), Positives = 55/126 (43%), Gaps = 8/126 (6%)
 Frame = +1

Query: 1075 KVDSQPSLYRAKGENQF------NIVRSTRK-GLSEEEERVKRNSHNFT-NSNSAKAFFD 1230
            K D   S Y   GEN        ++++ T    L+  ++    NS N   +S SA AFFD
Sbjct: 62   KSDGDSSHYSKSGENASITSTDGDVLKMTNHLALNGAQKTGDLNSANILIDSKSAGAFFD 121

Query: 1231 EKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTE 1410
            E+F +P++  N                   E  +I+   +S  +ED +EG  +K+ +  E
Sbjct: 122  EEFPDPELHIN------------------GEEAEIIFDYESHDMEDPTEGIGRKISEMIE 163

Query: 1411 SALQTG 1428
            S L  G
Sbjct: 164  SVLPGG 169

>Kpol_1024.29 s1024 (83563..89553) [5991 bp, 1996 aa] {ON}
            (83563..89553) [5991 nt, 1997 aa]
          Length = 1996

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query: 40   NNVTSDEEDEQAIAKELEFMERKK-QALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSI 216
            NN     EDE    +E E  ERK+ +  M R K +Q+ KK E+   +  E+ +   KKS 
Sbjct: 1759 NNYDDIVEDESEDEEERELQERKRMEEEMVRKKEEQEMKKREEEAKKEKELEREREKKSK 1818

Query: 217  VKKSQDALKQ 246
             K+ ++  KQ
Sbjct: 1819 EKQDKEQSKQ 1828

>TBLA0A00150 Chr1 complement(13868..14473) [606 bp, 201 aa] {ON}
           Anc_3.204 YDR002W
          Length = 201

 Score = 35.0 bits (79), Expect = 0.31
 Identities = 26/117 (22%), Positives = 52/117 (44%), Gaps = 5/117 (4%)
 Frame = +1

Query: 160 EDPNFEAVEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYF-- 333
           E P  E+ + P S A  S+    ++  K+ ++    +  +   ++   E    T  +F  
Sbjct: 11  EKPTNESTQKPPSAAVFSMFGGKKEVKKEEVKEEKEDAGDDKKAKAETEEEEETDVHFEP 70

Query: 334 ---MQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKK 495
              ++K  D K NE+ +   ++  + A++  F  +NKE+K   T + +   N   KK
Sbjct: 71  IVHLEKV-DVKTNEENEEVLHK--VRAKLFRFDAENKEWKERGTGDCKFLQNKETKK 124

>CAGL0M07678g Chr13 complement(767857..769278) [1422 bp, 473 aa] {ON}
            similar to uniprot|Q04347 Saccharomyces cerevisiae
            YMR014w
          Length = 473

 Score = 35.8 bits (81), Expect = 0.32
 Identities = 27/105 (25%), Positives = 51/105 (48%)
 Frame = +1

Query: 1357 GLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKK 1536
            G +D+S+ E+   K    SA +    +R+G      K+ K  K+ +P  E M   ++G  
Sbjct: 290  GSDDESDEEEDSAKS---SASEDETSERIGKQEPVPKLKKKEKAKLP--ELMVGYVSGGS 344

Query: 1537 TVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEV 1671
                ++    KE++ + P K     +R+ R+ +W++ +GSK   V
Sbjct: 345  DEEIEVDDIAKEQIEIKPQKKNRRGQRARRK-IWEQKYGSKAKHV 388

>KLLA0E21517g Chr5 complement(1920040..1922616) [2577 bp, 858 aa] {ON}
            similar to uniprot|Q756L3 Ashbya gossypii AER241W
            AER241Wp and weakly similar to YDR356W uniprot|P32380
            Saccharomyces cerevisiae YDR356W SPC110 Inner plaque
            spindle pole body (SPB) component ortholog of human
            kendrin involved in connecting nuclear microtubules to
            SPB interacts with Tub4p-complex and calmodulin
            phosphorylated by Mps1p in cell cycle-dependent manner
          Length = 858

 Score = 35.8 bits (81), Expect = 0.38
 Identities = 50/212 (23%), Positives = 83/212 (39%), Gaps = 6/212 (2%)
 Frame = +1

Query: 1066 APTKVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQN 1245
            +P+K   +  + R    N+   +RST K L  E + V  N      ++  +     K  N
Sbjct: 485  SPSKKSVEVDIQRKN--NEIRALRSTVKDLEHELQDVTSNVSKLKENHKEEIQKLRKQVN 542

Query: 1246 PDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEK-QKMKQTTESALQ 1422
            PD+  ++  ++ K+    + + L  EL  I   KD+   E      K + ++++ E  LQ
Sbjct: 543  PDLPTDVLEEKSKL--QNRISLLQMELNSI---KDTKEKELAMWRRKYETIRRSNEELLQ 597

Query: 1423 TGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNE 1602
             G  Q        G++S +L         + +R N   T  N LL    +         E
Sbjct: 598  EGKDQ-------SGQLSNILNEKDKEILQLQSRFNSLLTEKNSLLNELSKVRSHKDDYKE 650

Query: 1603 WFKKRSHREEVWQRHF-----GSKETEVASDA 1683
              KK   R E   + F      SK+ E + DA
Sbjct: 651  ELKKNQSRLEFITKEFVKLKDASKQAENSEDA 682

>NDAI0B03210 Chr2 (819236..820156) [921 bp, 306 aa] {ON} Anc_2.356
           YDL099W
          Length = 306

 Score = 35.0 bits (79), Expect = 0.46
 Identities = 33/152 (21%), Positives = 67/152 (44%), Gaps = 5/152 (3%)
 Frame = +1

Query: 4   DDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFK-KPEDPNFEA 180
           +D  E + VD   ++T     E +I +++   E +  A+  + +  +D   KPE+    A
Sbjct: 44  EDENETVDVDTNEDLTP--APEVSINQDVPEAEAEDDAVATKEQENEDTSLKPEEEEVTA 101

Query: 181 VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQES--PSNTT--TYFMQKFQ 348
           V+  ++   +S VK  +   ++ I    SN+      Q+ +E+   SN T  + F++  Q
Sbjct: 102 VQETEADETESAVKSEKITGEEKIDETVSNVENISTGQKEEENLFDSNNTEPSDFLKTIQ 161

Query: 349 DAKRNEDKQIAKYEGMMNARVHTFGTDNKEYK 444
             K+ +          +N ++     +NK  K
Sbjct: 162 QEKKKDK------INQLNQKLEELTIENKRLK 187

>TDEL0C04520 Chr3 (814803..818744) [3942 bp, 1313 aa] {ON} Anc_2.235
            YIL126W
          Length = 1313

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 30/108 (27%), Positives = 47/108 (43%), Gaps = 1/108 (0%)
 Frame = +1

Query: 13   REILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVP 192
            R  + V    N   +  DE+  A E++  E+KK  L  +L  K D   PE+     V   
Sbjct: 1128 RRSVPVAEDQNGLDEAVDEEGTAAEVKEPEKKKPKLKIKLTLKNDPLTPEESETNGVANS 1187

Query: 193  Q-SPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYF 333
            +   +K+S  KK++ A  + + PV  N+   M  Q  +      TT F
Sbjct: 1188 KVDKSKQSKTKKTKKAQNELL-PVVENLLALMREQIDETDEHPRTTIF 1234

>ZYRO0G21318g Chr7 complement(1751145..1755509) [4365 bp, 1454 aa]
            {ON} some similarities with uniprot|P47035 Saccharomyces
            cerevisiae YJL076W NET1 Core subunit of the RENT complex
            which is a complex involved in nucleolar silencing and
            telophase exit stimulates transcription by RNA polymerase
            I and regulates nucleolar structure
          Length = 1454

 Score = 35.4 bits (80), Expect = 0.53
 Identities = 18/61 (29%), Positives = 35/61 (57%)
 Frame = +1

Query: 61   EDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDAL 240
            + E+   K+ EF E+KKQ  +ER +R+++ +K E+ N       +    +++ K+ Q+ L
Sbjct: 908  QQEELERKKREFHEKKKQEELERQRREEENRKREEENRRKEAEAEKKRIEALEKQRQEKL 967

Query: 241  K 243
            K
Sbjct: 968  K 968

>Skud_15.365 Chr15 complement(657763..659175) [1413 bp, 470 aa] {ON}
            YOR198C (REAL)
          Length = 470

 Score = 35.0 bits (79), Expect = 0.56
 Identities = 44/187 (23%), Positives = 85/187 (45%), Gaps = 15/187 (8%)
 Frame = +1

Query: 1114 ENQFNIVRSTRKGLSEEEERV--------KRNSHNFTNSNSAKAFFDEKFQNPDMLANLD 1269
            + + N + S  +G+ ++ + +        K+    ++     +A FD +F++    A LD
Sbjct: 190  QQKLNNIHSKTQGVYDKRQTLFNKRTALYKKRDELYSQIRQIRADFDNEFKS--FKAKLD 247

Query: 1270 SKRRKIIDTKKSTALSRELGKIMRRKD--SSGLEDKSEGEKQKMKQTTESALQTGLIQRL 1443
             +R K  +  K       L K++ +KD     L++K    K         A++  L   L
Sbjct: 248  KERLKREEDHK-------LSKLLEQKDVDMGKLQEKLTHAKIPAFTYEIGAIENSL---L 297

Query: 1444 GFDPTHGKISKVLKSSVPGG--ESMPNRINGKKTVINDLLQYKKEK---VILAPSKNEWF 1608
              DPT+ K  K + + +     E+ P R    K V +DL+    +K   V +APSK++ +
Sbjct: 298  VLDPTYVKPKKNILAELSDTALETKPAR----KVVADDLVLVSPKKDDFVNVAPSKSKKY 353

Query: 1609 KKRSHRE 1629
            KK++ ++
Sbjct: 354  KKKNQQK 360

>YOR198C Chr15 complement(718653..720065) [1413 bp, 470 aa] {ON}
            BFR1Component of mRNP complexes associated with
            polyribosomes; implicated in secretion and nuclear
            segregation; multicopy suppressor of BFA (Brefeldin A)
            sensitivity
          Length = 470

 Score = 35.0 bits (79), Expect = 0.56
 Identities = 43/189 (22%), Positives = 86/189 (45%), Gaps = 15/189 (7%)
 Frame = +1

Query: 1108 KGENQFNIVRSTRKGLSEEEERV--------KRNSHNFTNSNSAKAFFDEKFQNPDMLAN 1263
            + + + N + S  +G+ ++ + +        K+    ++     +A FD +F++    A 
Sbjct: 188  ENQQKLNDIHSKTQGVYDKRQTLFNKRAALYKKRDELYSQIRQIRADFDNEFKS--FRAK 245

Query: 1264 LDSKRRKIIDTKKSTALSRELGKIMRRKD--SSGLEDKSEGEKQKMKQTTESALQTGLIQ 1437
            LD +R K  + ++       L K++ +KD     L++K    K         A++  L  
Sbjct: 246  LDKERLKREEEQR-------LSKLLEQKDVDMGKLQEKLTHAKIPAFTYEIGAIENSL-- 296

Query: 1438 RLGFDPTHGKISKVLKSSVPGG--ESMPNRINGKKTVINDLLQYKKEK---VILAPSKNE 1602
             L  DPT+ K  K +   +     E+ P R    K V +DL+    +K   V +APSK++
Sbjct: 297  -LVLDPTYVKPKKNILPDLSSNALETKPAR----KVVADDLVLVTPKKDDFVNVAPSKSK 351

Query: 1603 WFKKRSHRE 1629
             +KK++ ++
Sbjct: 352  KYKKKNQQK 360

>TPHA0C03790 Chr3 complement(822142..823614) [1473 bp, 490 aa] {ON}
           Anc_2.369 YDL088C
          Length = 490

 Score = 35.0 bits (79), Expect = 0.57
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 13/88 (14%)
 Frame = +1

Query: 313 SNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELES------- 471
           SN +  F+Q  +D  + +  Q   Y  + N    ++   N + KP+  N+L+S       
Sbjct: 14  SNVSINFLQPSEDTSQQQGNQQKTYHQLQNNSQQSYIQLNNKNKPLFANDLQSQFDTNMK 73

Query: 472 ------FSNLWVKKRYIPEEDLKRALHE 537
                 F+N   KKR IP+  ++R ++E
Sbjct: 74  GQEPEWFNN--PKKRNIPQNVIRRNVNE 99

>Kpol_1052.26 s1052 complement(86331..87275) [945 bp, 314 aa] {ON}
            complement(86331..87275) [945 nt, 315 aa]
          Length = 314

 Score = 34.7 bits (78), Expect = 0.62
 Identities = 27/103 (26%), Positives = 45/103 (43%)
 Frame = +1

Query: 1108 KGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKI 1287
            K  N+  I+ + +    E +E+ K+  + F+N N      DE    P+ML    S   K 
Sbjct: 36   KKSNRKQIMDNCKNLQFELDEKHKKELNRFSNGNDGIENEDEDEITPEMLLAQLSIETKQ 95

Query: 1288 IDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESA 1416
             D  KS  LS        RK  +  +++    +QK+++  E A
Sbjct: 96   QDESKSDTLSSTANTNQPRKSRNRQKERLAKRQQKIEKIKEEA 138

>TDEL0H01310 Chr8 (224588..226165) [1578 bp, 525 aa] {ON} Anc_1.260
            YJL103C
          Length = 525

 Score = 34.7 bits (78), Expect = 0.77
 Identities = 32/121 (26%), Positives = 54/121 (44%), Gaps = 10/121 (8%)
 Frame = +1

Query: 1078 VDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVK----RNSHNFTN--SNSAKAFFDEKF 1239
            VDS P    + GEN+ +I     K   + EE+V        H+FTN  SN++ +F  +  
Sbjct: 91   VDSAPMCQESSGENEKSIGNLKLKSDDKVEEKVSVLPVPKMHSFTNLLSNNSNSFLHDPL 150

Query: 1240 QNPDMLANLDSKRR--KIIDTKKSTALSR--ELGKIMRRKDSSGLEDKSEGEKQKMKQTT 1407
                + +++D K    +I    +S          + M+  D +GL+DK   E  +   +T
Sbjct: 151  IPNMLSSSIDIKHSNPQIYHAHRSLDFDSMWTNDEYMKLNDITGLDDKKSAEHPEDPLST 210

Query: 1408 E 1410
            E
Sbjct: 211  E 211

>TPHA0C01930 Chr3 (438203..439906) [1704 bp, 567 aa] {ON} Anc_8.460
           YDL207W
          Length = 567

 Score = 34.7 bits (78), Expect = 0.78
 Identities = 42/186 (22%), Positives = 80/186 (43%), Gaps = 19/186 (10%)
 Frame = +1

Query: 58  EEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDA 237
           +E+EQ I KE E  ERK +    R K +++ K+ E+     +E      +K  ++  + A
Sbjct: 182 KEEEQRIRKEREDRERKIEEERRRKKAEEELKRKEEEERLRLEKEALDKQKKELELKEKA 241

Query: 238 LK--QAIRPVASNINESMLSQQSQESPSN------TTTYFMQKFQDAKR-------NEDK 372
            K  +A++     + E   +Q   +  +N      T  Y+  K ++ KR       N DK
Sbjct: 242 RKEEEALKTQQEKLAELKYNQNVGKEITNFKEINKTFLYYKDKIKEIKRDIIEPVKNGDK 301

Query: 373 Q----IAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALHEI 540
                ++K++  +N +   FG         +TN  +   N++        E+L + + E 
Sbjct: 302 NFKSILSKHKRKINPK---FGQ--------LTNSTQQLKNVY--------EELTKLVDET 342

Query: 541 KILRLN 558
           K  +L+
Sbjct: 343 KTNQLS 348

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 34.7 bits (78), Expect = 0.81
 Identities = 35/171 (20%), Positives = 70/171 (40%), Gaps = 13/171 (7%)
 Frame = +1

Query: 1045 NGGYALGAPTKVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHN----FTNSNS 1212
            N G   G   +  +   L  A  +++FN+++     L ++ +  K  S+N    F   NS
Sbjct: 164  NSGTQTGTEERAGANLILGNAVTKDKFNLLKRRVDRLQKDLDSAKEESYNAKLEFQKLNS 223

Query: 1213 -----AKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSE 1377
                  ++ F  K  N +++ N +     +    +   L   + +  R K +SG + +++
Sbjct: 224  KYNTVVESLFTFKTVNDNLMNNFNILCSVL--NNRGIELPPHIYQDPRLKQNSGTQQQAQ 281

Query: 1378 GEKQKMKQTTESALQT----GLIQRLGFDPTHGKISKVLKSSVPGGESMPN 1518
                   Q T SA  +      +Q   FDP +  ++ ++   VP   S+ N
Sbjct: 282  AATSAATQATTSASNSTAGMSPMQNKPFDPLNSAVNAMVPGPVPLSASLSN 332

>YNL167C Chr14 complement(319416..321359) [1944 bp, 647 aa] {ON}
           SKO1Basic leucine zipper transcription factor of the
           ATF/CREB family; forms a complex with Tup1p and Cyc8p to
           both activate and repress transcription; cytosolic and
           nuclear protein involved in osmotic and oxidative stress
           responses
          Length = 647

 Score = 34.7 bits (78), Expect = 0.81
 Identities = 27/92 (29%), Positives = 43/92 (46%)
 Frame = +1

Query: 40  NNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIV 219
           NNVT DE +EQ   K  EF+ER + A  +  KRK+++ K  + + +  E       + ++
Sbjct: 418 NNVTLDENEEQE-RKRKEFLERNRVAASKFRKRKKEYIKKIENDLQFYESEYDDLTQ-VI 475

Query: 220 KKSQDALKQAIRPVASNINESMLSQQSQESPS 315
            K    +  +      N+N S  S  S  S S
Sbjct: 476 GKLCGIIPSSSSNSQFNVNVSTPSSSSPPSTS 507

>NDAI0E01830 Chr5 complement(363691..367503) [3813 bp, 1270 aa] {ON}
            Anc_2.409
          Length = 1270

 Score = 34.7 bits (78), Expect = 0.90
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 13/118 (11%)
 Frame = +1

Query: 1318 RELGKIMRRKDSSGLEDKSEGEKQKMKQTT-------------ESALQTGLIQRLGFDPT 1458
            +EL K+  ++    +E++SE E  K    T             E +L+   +Q + F P 
Sbjct: 21   KELKKVRNKQFHREVEEESEEEDAKNTSITDTNAEILEPLTEEEKSLKKRKLQEI-FTPK 79

Query: 1459 HGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREE 1632
              KIS++ K  +        +   KKT+I  L  YK +  +L  SK     +++ +EE
Sbjct: 80   ESKISRLKKKRLDKFIDHQLKREEKKTIIEKLQDYKIDTSLLVSSKKLGEGRQTKKEE 137

>CAGL0C01265g Chr3 complement(129884..134389) [4506 bp, 1501 aa] {ON}
            weakly similar to uniprot|P40477 Saccharomyces cerevisiae
            YIL115c NUP159
          Length = 1501

 Score = 34.7 bits (78), Expect = 0.91
 Identities = 40/168 (23%), Positives = 67/168 (39%), Gaps = 14/168 (8%)
 Frame = +1

Query: 1081 DSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTN-SNS--AKAFFDEK----- 1236
            DS+P L +       N+   T   + +  E  + NS N  N SNS  AK+ F++      
Sbjct: 797  DSKPDLEKPVEVVDKNLKSDTASPIVDNIEAAQSNSSNILNLSNSPFAKSAFEKSTGQSP 856

Query: 1237 FQNPDMLANLDSKRRKIIDTKKSTALSR------ELGKIMRRKDSSGLEDKSEGEKQKMK 1398
            F N     N DSKR   +D   S+  ++      E  K+    +  G+ +    ++ +  
Sbjct: 857  FSNSFSNLNCDSKRESQVDNASSSPFAKLSTNTHEKSKVDNGSEKEGVHEVQNSDEAEFS 916

Query: 1399 QTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTV 1542
             +T    QT L      D + G+++       P   S+  RI  K  +
Sbjct: 917  DSTVE--QTPLAD---LDESKGQVAS------PSISSLTERIKQKAQI 953

>Suva_10.546 Chr10 (948276..954947) [6672 bp, 2223 aa] {ON} YLR430W
            (REAL)
          Length = 2223

 Score = 34.7 bits (78), Expect = 0.93
 Identities = 29/117 (24%), Positives = 52/117 (44%), Gaps = 8/117 (6%)
 Frame = +1

Query: 1249 DMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTG 1428
            D+ +N D+K+RKI++    T    +  K  + K     + K++ +K+K K+   S+  +G
Sbjct: 1889 DVESNKDAKKRKIVEESDETKKISKKKKKDKEKKKDKKKLKTDEKKKKEKEGESSSTSSG 1948

Query: 1429 LIQRLGFDPTHGKISKVLKSSVPGGESMPN--------RINGKKTVINDLLQYKKEK 1575
              +               KSS+ GG S+ N         +NG K    D+ + KK +
Sbjct: 1949 TKK---------------KSSIFGGTSVANIVVSKSSLDVNGSKKTTADVDKKKKNR 1990

>Kpol_1013.42 s1013 (96318..97610) [1293 bp, 430 aa] {ON}
            (96318..97610) [1293 nt, 431 aa]
          Length = 430

 Score = 34.3 bits (77), Expect = 0.95
 Identities = 36/104 (34%), Positives = 48/104 (46%), Gaps = 2/104 (1%)
 Frame = +1

Query: 1096 LYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSK 1275
            L RAK     N     ++ L +E+E  KRN+HN TNS + K     K  N D     DS+
Sbjct: 55   LIRAKFTEYLNRAEQLKEHLEKEDE-AKRNAHNNTNSGAQKV---SKNNNED-----DSE 105

Query: 1276 RRKIIDTKKSTALSRELGKIMRRKDSSGLEDKS--EGEKQKMKQ 1401
                 D K   ALS   G I+  K +   ED +  EG K  +K+
Sbjct: 106  -----DKKLKGALS---GAILTEKPNVKWEDIAGLEGAKAALKE 141

>Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {ON}
            complement(46606..47919) [1314 nt, 438 aa]
          Length = 437

 Score = 34.3 bits (77), Expect = 0.95
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +1

Query: 1138 STRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANL-DSKRRKIIDTKKSTAL 1314
            S+    SEEEE+ K++S +   S+S ++  DE   + +      DSK+RK+ ++++    
Sbjct: 98   SSSSSESEEEEKKKKSSSSSDESSSDESSSDESSSDEEEKEEAKDSKKRKLEESEE---- 153

Query: 1315 SRELGKIMRRKDSSGLEDKSEGE 1383
            S E  +  +    S  ED ++GE
Sbjct: 154  SEESEESEKESKKSKTEDSNDGE 176

 Score = 31.2 bits (69), Expect = 8.7
 Identities = 23/109 (21%), Positives = 49/109 (44%)
 Frame = +1

Query: 1084 SQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLAN 1263
            S  S   +  E   +   S+ +  SE+E++   +S +  + +S+    DEK +    +  
Sbjct: 27   SSSSSSSSSAEESSSSSSSSSESESEDEDKSSSSSSSSESDSSSDESEDEKKEEKKEVKK 86

Query: 1264 LDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTE 1410
             + K     D+  S++ S E  K  ++K SS  ++ S  E    + +++
Sbjct: 87   EEKKEESSSDSSSSSSESEEEEK--KKKSSSSSDESSSDESSSDESSSD 133

>Kpol_1010.23 s1010 (52012..52878) [867 bp, 288 aa] {ON}
            (52012..52878) [867 nt, 289 aa]
          Length = 288

 Score = 33.9 bits (76), Expect = 1.0
 Identities = 30/116 (25%), Positives = 57/116 (49%)
 Frame = +1

Query: 1201 NSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEG 1380
            +++ +K  F +  +   +L  L SKRR +I+ ++      +  K++  ++ S     S  
Sbjct: 97   DTDISKDQFADNDEYQGLLYKLASKRRLVIELREQLKSEEKELKLIE-EELSKFTLSSSN 155

Query: 1381 EKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVIN 1548
             KQ  K+T++S + T   Q   F    G +SK +  ++    + PN I GKK++ N
Sbjct: 156  NKQG-KETSKSPMNT---QNTDFI---GNLSKQIHKAIDDVNNSPNVIQGKKSISN 204

>Smik_10.280 Chr10 (435799..437574) [1776 bp, 591 aa] {ON} YJR002W
           (REAL)
          Length = 591

 Score = 34.3 bits (77), Expect = 1.0
 Identities = 39/159 (24%), Positives = 70/159 (44%), Gaps = 5/159 (3%)
 Frame = +1

Query: 7   DPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVE 186
           D  E   +D + +V SDEE+E+AI  E +F ++  +   E +K   D    ED +     
Sbjct: 206 DEGEDAEIDYFQDVPSDEEEEEAIYYE-DFFDKPGE---ESVKNNLDINDSEDDD----- 256

Query: 187 VPQSPAKKSIVKKSQDALKQAIR--PVASNINESMLSQQSQESPSNTTTYFMQKFQDAKR 360
                      +K  D++   ++    A   NES   +  ++S  N +T+  +K Q   R
Sbjct: 257 --------QTNEKEYDSVMDKVKLDLFADEENESSAEEMGEDSGKNLSTF--EKQQVEIR 306

Query: 361 NEDKQIAKYEGMMNARVHTFGTDNKEYKP---IITNELE 468
            + +Q+ K E +   +    G    + +P   ++T ELE
Sbjct: 307 KQIEQLEK-EAVAEKKWSLKGEVKAKDRPDDALLTEELE 344

>Smik_14.160 Chr14 complement(298499..300451) [1953 bp, 650 aa] {ON}
           YNL167C (REAL)
          Length = 650

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 26/89 (29%), Positives = 42/89 (47%)
 Frame = +1

Query: 40  NNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIV 219
           +NV  DE +EQ   K  EF+ER + A  +  KRK+++ K  + + +  E       K+ V
Sbjct: 418 SNVIIDETEEQE-RKRKEFLERNRVAASKFRKRKKEYIKKIESDLQFYESEYDDLTKA-V 475

Query: 220 KKSQDALKQAIRPVASNINESMLSQQSQE 306
            K    +  +      N+N S +S  S E
Sbjct: 476 GKLCGIIPSSSSNAQFNVNMSTISSSSSE 504

>Suva_14.171 Chr14 complement(315525..317483) [1959 bp, 652 aa] {ON}
           YNL167C (REAL)
          Length = 652

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 27/95 (28%), Positives = 45/95 (47%)
 Frame = +1

Query: 40  NNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIV 219
           NNV  DE +EQ   K  EF+ER + A  +  KRK+++ K  + + +  E        ++ 
Sbjct: 417 NNVIIDETEEQE-KKRKEFLERNRVAASKFRKRKKEYIKKIESDVQFYESEYDDLTHAVG 475

Query: 220 KKSQDALKQAIRPVASNINESMLSQQSQESPSNTT 324
           K        A    +S  + +M +  S  SPS+T+
Sbjct: 476 KFCGIVPSNA---SSSQFHMNMSTPSSSSSPSSTS 507

>SAKL0C04884g Chr3 complement(468461..471157) [2697 bp, 898 aa] {ON}
            some similarities with uniprot|P32591 Saccharomyces
            cerevisiae YJL176C SWI3 transcription factor
          Length = 898

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 38/148 (25%), Positives = 66/148 (44%), Gaps = 11/148 (7%)
 Frame = +1

Query: 55   DEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQ-------SPAKKS 213
            +E++E+   +E    E+      E+LK++      E+    ++E P+       S + K 
Sbjct: 628  EEKEEKGENQEEAQHEKLSDLPKEQLKKEFSEAHLEESKEASLEAPEGYPGESPSESPKE 687

Query: 214  IVKKS-QDALKQAIRPVASNINESMLSQQSQESPS---NTTTYFMQKFQDAKRNEDKQIA 381
             VK S +DA+K+A + V     E  L    +ES S    T+  +++K          +IA
Sbjct: 688  AVKDSVKDAVKEADQHVPKQTPEDSLQGTPRESTSAEPGTSQSYIKK--------GSEIA 739

Query: 382  KYEGMMNARVHTFGTDNKEYKPIITNEL 465
               G +  R H F T+ +     ITN+L
Sbjct: 740  L--GALGVRSHVFATNEERQISSITNQL 765

>YKL201C Chr11 complement(63930..67466) [3537 bp, 1178 aa] {ON}
            MNN4Putative positive regulator of mannosylphosphate
            transferase (Mnn6p), involved in mannosylphosphorylation
            of N-linked oligosaccharides; expression increases in
            late-logarithmic and stationary growth phases
          Length = 1178

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 26/111 (23%), Positives = 53/111 (47%)
 Frame = +1

Query: 58   EEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDA 237
            +E+E+   KE E  E+KK+   E+ K++++ KK ++   +  +  +   KK    + ++ 
Sbjct: 1053 KEEEEKKKKEEE--EKKKKEEEEKKKKEEEEKKKKEEEEKKKQEEEEKKKK----EEEEK 1106

Query: 238  LKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYE 390
             KQ       N +E     + +E   N      ++ +  K+NED++  K E
Sbjct: 1107 KKQEEGEKMKNEDEENKKNEDEEKKKNEEEEKKKQEEKNKKNEDEEKKKQE 1157

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 31/130 (23%), Positives = 56/130 (43%)
 Frame = +1

Query: 1    MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
            M D   I+  + Y      EE ++   K+ E  E+KK+   E+ K++++ KK ++   E 
Sbjct: 1016 MFDKDPIIVYEDYAYAKLLEERKRREKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEE-EK 1074

Query: 181  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKR 360
             +  +   KK   K+ ++  KQ          E    Q+  E   N         ++ K+
Sbjct: 1075 KKKEEEEKKK---KEEEEKKKQEEEEKKKKEEEEKKKQEEGEKMKNED-------EENKK 1124

Query: 361  NEDKQIAKYE 390
            NED++  K E
Sbjct: 1125 NEDEEKKKNE 1134

>YNL005C Chr14 complement(621313..622428) [1116 bp, 371 aa] {ON}
            MRP7Mitochondrial ribosomal protein of the large subunit
          Length = 371

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 35/153 (22%), Positives = 69/153 (45%), Gaps = 1/153 (0%)
 Frame = +1

Query: 1159 EEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIM 1338
            +EEER+K    ++TN   +++   +  +  D+L +  S   K+   +    +S +  + +
Sbjct: 223  KEEERLKARRESWTNEKLSESL-SKIDECSDLLNSSTSFNNKL---ELHQYISEQEKQAL 278

Query: 1339 RRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPN 1518
            + K    LE     E +K K   ++  +         +  H +  K LKS  P  +S   
Sbjct: 279  KAKLLEDLEKSQHLETKKDKNYIKALFKDACNFLTLSEEVHLR-RKYLKSVFPETDSTVE 337

Query: 1519 RINGKKTVINDLLQYKKEKV-ILAPSKNEWFKK 1614
              +GKK++++    Y K KV ++A S+  +  K
Sbjct: 338  TKSGKKSIVSRRFDYTKNKVEVIARSRRAFLSK 370

>TBLA0I02620 Chr9 complement(605456..614956) [9501 bp, 3166 aa] {ON}
           
          Length = 3166

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 29/128 (22%), Positives = 58/128 (45%), Gaps = 15/128 (11%)
 Frame = +1

Query: 46  VTSDEEDEQAIAKELE-----------FMERKKQALMERLKRKQDFKKPEDPNFEAVEV- 189
           +TSDEEDE   + E +           F  ++K    + L  ++  +K  DP    +   
Sbjct: 334 LTSDEEDEDPYSNEFKNFEENNIDESNFNNQRKATTTKSLYMER--RKSMDPGLPIINTE 391

Query: 190 PQSPAKKSIVKKSQDALKQAIR---PVASNINESMLSQQSQESPSNTTTYFMQKFQDAKR 360
           P  P++K  +K+S+ A KQ IR   P+A  + +  ++       S++   ++ +   +  
Sbjct: 392 PAYPSEKKSLKQSKYASKQKIRNEIPLAIALTQKKVTDNDSIKVSDSIVNYVNEVVHSHL 451

Query: 361 NEDKQIAK 384
           ++D +  K
Sbjct: 452 DDDFEFNK 459

>Kpol_1072.53 s1072 (122356..123771) [1416 bp, 471 aa] {ON}
            (122356..123771) [1416 nt, 472 aa]
          Length = 471

 Score = 33.9 bits (76), Expect = 1.3
 Identities = 39/186 (20%), Positives = 82/186 (44%), Gaps = 14/186 (7%)
 Frame = +1

Query: 1114 ENQFNIVRSTRKGLSEEEERV--------KRNSHNFTNSNSAKAFFDEKFQNPDMLANLD 1269
            + + N ++S  +G+ ++ + +        K+    ++     +  FD +F++      ++
Sbjct: 191  QKRLNDLQSKTQGVYDKRQALFTKRTVLYKKRDEVYSQIRKIRTDFDNEFKS--FKQKME 248

Query: 1270 SKRRKIIDTKKSTALSRELGKIMRRKDSS--GLEDKSEGEKQKMKQTTESALQTGLIQRL 1443
            ++R K  + +K       L K++  KD++   L++K    K         A++  L    
Sbjct: 249  TERIKREEEQK-------LSKLLEEKDNALGKLQEKLNHSKVPAFTFEIEAIENSLT--- 298

Query: 1444 GFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEK----VILAPSKNEWFK 1611
              DPT+ K  K L +      ++ NR   K+   +DL+   K+        APSK++ FK
Sbjct: 299  ALDPTYVKPKKALFTDSDDPLNVDNRTAVKQVENDDLVPVAKKDDDVFTNTAPSKSKKFK 358

Query: 1612 KRSHRE 1629
            K+S  +
Sbjct: 359  KKSQNK 364

>Suva_6.249 Chr6 (444869..447082) [2214 bp, 737 aa] {ON} YJL168C
           (REAL)
          Length = 737

 Score = 33.9 bits (76), Expect = 1.4
 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 12/99 (12%)
 Frame = +1

Query: 22  LAVDPYNNVTSDEEDEQAIAKELEF----MERKKQALMERLKRKQDFKKPEDPNFEAV-- 183
           +A+D   +  SDEE E+   K LE+    +ER KQ  +E LK+K   +       E +  
Sbjct: 535 IALDLKKHKLSDEEYERKKRKRLEYERNALERAKQEELESLKQKLKLENERKSVLEDIIA 594

Query: 184 ------EVPQSPAKKSIVKKSQDALKQAIRPVASNINES 282
                 EV +  AKK +  K    LK+     +  +  S
Sbjct: 595 EANKQKEVQKEEAKKLVEAKEAKRLKRKTASQSQRLEHS 633

>SAKL0B10758g Chr2 complement(931458..934418) [2961 bp, 986 aa] {ON}
           similar to uniprot|P39730 Saccharomyces cerevisiae
           YAL035W FUN12 GTPase required for general translation
           initiation by promoting Met-tRNAiMet binding to
           ribosomes and ribosomal subunit joining homolog of
           bacterial IF2
          Length = 986

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 30/120 (25%), Positives = 55/120 (45%), Gaps = 5/120 (4%)
 Frame = +1

Query: 49  TSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAV-----EVPQSPAKKS 213
           T   E E A A E +FM   K++     K+KQ+ K+ E+P    +     +  +   K+ 
Sbjct: 48  TPGVEAEGAEAIEADFMSTLKKS-----KKKQETKETEEPKKPVLKSKKEKEKEKKEKEK 102

Query: 214 IVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEG 393
            +KK Q A K+A +      N+ +  QQ++ +         +  +D+ +N D + A  +G
Sbjct: 103 QMKKEQAAKKKAQQQAQKEKNKELNKQQAEAAAK------AKAEKDSNKNSDSKPATKKG 156

>Kwal_23.4343 s23 (675819..678914) [3096 bp, 1031 aa] {ON} YGR258C
           (RAD2) - homolog of xeroderma pigmentosum group G (XPG)
           protein, copufurifies with transcription factor, TFIIH,
           mRNA is cell cycle regulated and induced by DNA damage
           and by meiosis (different cis-sites utilized in damage
           and meiotic induction [contig 1] FULL
          Length = 1031

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 34/172 (19%), Positives = 67/172 (38%), Gaps = 7/172 (4%)
 Frame = +1

Query: 22  LAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKP-------EDPNFEA 180
           ++ +P  N    EED+        FME  K+  M    RK + KKP        D     
Sbjct: 395 ISEEPVQNDEDGEEDD--------FMELTKELKMMENVRKSNIKKPSTVYIGSSDVEEGD 446

Query: 181 VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKR 360
           +E  + P++K  V+ + + +       A + N   L + ++      T     +  D   
Sbjct: 447 IEAERQPSRKGEVESNSEKMNDVDNTKALSDNHLDLEKSAERKQRLETKKSESEQYDPVH 506

Query: 361 NEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEED 516
            +D++        +A++ +F T +   K   T++ E   +     +Y+ E +
Sbjct: 507 EQDEE--------SAQITSFVTPSYPDKSTQTHDFEDQHDRGDSVKYVTESE 550

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
            Anc_8.279
          Length = 1049

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 10/111 (9%)
 Frame = +1

Query: 157  PEDPNFEAVEVPQSPAKKSIVKK--------SQDALKQAIRPVASNINESML--SQQSQE 306
            P DP++   +  +S +KKS + K        S D   + I PV  +IN+S++   Q    
Sbjct: 923  PGDPDYSLTQQKRSGSKKSPLSKDTASFGTDSIDMGPENISPVEGSINDSVVITPQVQNI 982

Query: 307  SPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITN 459
            S + + T     F      EDK + K+E +   RV   G     +K +  N
Sbjct: 983  SENKSLTSLGYGFDGLTSAEDKHLLKFE-IHIVRVRIVGLAGVHFKKVSGN 1032

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 28/117 (23%), Positives = 47/117 (40%)
 Frame = +1

Query: 1114 ENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIID 1293
            + QF  V   RKG    E+    N H+   S + K   D +     M +N D+   +   
Sbjct: 723  KKQFKEVH-VRKGTEIIEDIGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQEEI 781

Query: 1294 TKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHG 1464
            TK++TA +  + K  R ++ S  +D S           ++   +   + LG D   G
Sbjct: 782  TKRNTAANENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNKALGSDDDEG 838

>NCAS0A04110 Chr1 complement(829352..833095) [3744 bp, 1247 aa] {ON}
            Anc_2.409
          Length = 1247

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 13/118 (11%)
 Frame = +1

Query: 1318 RELGKIMRRKDSSGLEDKSEGEKQKMKQTT-------------ESALQTGLIQRLGFDPT 1458
            +EL K+  ++    +ED+S+      KQ               E AL+   +Q L F P 
Sbjct: 21   KELKKVRNKQFYREVEDESDDRVPDDKQDLDTNSELLKPVTEEEKALKKRKLQEL-FTPK 79

Query: 1459 HGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREE 1632
              K+S++ K  +        +   KKT+I  L  YK +  +L  SK     +++ REE
Sbjct: 80   ESKVSRLKKKRLDKFIEHQLKREEKKTIIEKLQGYKIDTSLLTSSKRLGEGRQTKREE 137

>KLTH0E09218g Chr5 (835647..839408) [3762 bp, 1253 aa] {ON} similar to
            uniprot|Q04217 Saccharomyces cerevisiae YMR128W ECM16
            Essential DEAH-box ATP-dependent RNA helicase specific to
            the U3 snoRNP predominantly nucleolar in distribution
            required for 18S rRNA synthesis
          Length = 1253

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 2/100 (2%)
 Frame = +1

Query: 1339 RRKDSSG--LEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESM 1512
            ++KDS+   +E   + EK+  K+  E            F P   KIS++ K  +      
Sbjct: 48   QKKDSNAEVIEPMDDEEKELKKRKLEEL----------FKPQESKISRIKKKRLDKFIEH 97

Query: 1513 PNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREE 1632
              +   KK +I  L  YK +  IL  SKN    +++ +EE
Sbjct: 98   QLKREEKKVIIEKLQDYKIDTSILTSSKNLGHGRQTKKEE 137

>TBLA0H00300 Chr8 complement(51145..54972) [3828 bp, 1275 aa] {ON}
            Anc_2.409 YMR128W
          Length = 1275

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 27/94 (28%), Positives = 41/94 (43%)
 Frame = +1

Query: 1351 SSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRING 1530
            +S L   S  E  +     E AL+   +Q L F P   KIS++ K  +        +   
Sbjct: 48   TSNLPKDSNAELLEPVTAEEKALKKRKLQEL-FTPKESKISRLKKKRLDKFIEHQLKREE 106

Query: 1531 KKTVINDLLQYKKEKVILAPSKNEWFKKRSHREE 1632
            K T+I  L  YK +  IL  SK     +++ +EE
Sbjct: 107  KTTIIKKLQDYKMDTSILVSSKRLGHGRQTKKEE 140

>Smik_5.336 Chr5 (504898..509304) [4407 bp, 1468 aa] {ON} YER164W
           (REAL)
          Length = 1468

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 33/144 (22%), Positives = 60/144 (41%), Gaps = 13/144 (9%)
 Frame = +1

Query: 37  YNNVTSDEEDEQAIAK------------ELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
           Y N + DE+DE+ I +            E EF + + Q   E  + ++DF++ ED     
Sbjct: 32  YFNDSDDEDDEENIKQSRRKRKTTIEDEEDEFEDEEGQDDSEEGEAEEDFEEDEDYYGSP 91

Query: 181 VEVPQSPAKKSIVKKSQDALK-QAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAK 357
            +V ++ AK     KSQ  LK Q+ +  A+ I     ++Q++     T  Y +    D  
Sbjct: 92  KKVNRTKAKSRTTPKSQSKLKSQSTKQSAAKIPTRFSNRQNK-----TINYNVDYSDDDL 146

Query: 358 RNEDKQIAKYEGMMNARVHTFGTD 429
              +      +G+     +   T+
Sbjct: 147 LESEDDYGSEDGLSEENTYEVSTN 170

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 10/118 (8%)
 Frame = +1

Query: 157  PEDPNFEAVEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQES-------PS 315
            PE  N E+   P S   K++  K   AL  + R   +N + S+ S+ S+++       PS
Sbjct: 1303 PEATNSESTNGPPSKRMKAL-PKGPAALINSTRSSPNNSSPSLKSKSSRDNAARQTSNPS 1361

Query: 316  NTTTYFMQKFQDAKRNED---KQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSN 480
            N + +  +K  D+   ED      A    +   R    G D KE+  I+ NEL +  N
Sbjct: 1362 NGSAH--EKEYDSMDEEDCRHTMSAIRTSLKRLRRGGKGLDRKEWAKILKNELTTIGN 1417

>YLR430W Chr12 (993434..1000129) [6696 bp, 2231 aa] {ON}  SEN1Presumed
            helicase and subunit of the Nrd1 complex
            (Nrd1p-Nab3p-Sen1p); complex interacts with the exosome
            to mediate 3' end formation of some mRNAs, snRNAs,
            snoRNAs, and CUTs; homolog of Senataxin which causes
            Ataxia-Oculomotor Apraxia 2 and a dominant form of
            amyotrophic lateral sclerosis
          Length = 2231

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 29/123 (23%), Positives = 54/123 (43%), Gaps = 3/123 (2%)
 Frame = +1

Query: 1240 QNPDML-ANLDSKRRKIID--TKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTE 1410
            Q PD + +N D+K+R+++D   +   A+ ++  +  + K  S  +DK +  K+    +T 
Sbjct: 1896 QGPDEVKSNKDTKKRRVVDEGEEADKAVKKKKKEKKKEKKKSKADDKKKNNKKAESPSTS 1955

Query: 1411 SALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAP 1590
            S  +                    KSS+ GG S+P+ +  K     D+   KK   ++  
Sbjct: 1956 SGTKK-------------------KSSIFGGMSVPSAVVPK--TFPDVDSNKKAAAVVGK 1994

Query: 1591 SKN 1599
             KN
Sbjct: 1995 KKN 1997

>ZYRO0G03498g Chr7 (275243..276802) [1560 bp, 519 aa] {ON} weakly
            similar to uniprot|Q6B1X3 Saccharomyces cerevisiae
            YPL181W CTI6 Protein that relieves transcriptional
            repression by binding to the Cyc8p-Tup1p corepressor and
            recruiting the SAGA complex to the repressed promoter
            contains a PHD finger domain
          Length = 519

 Score = 33.5 bits (75), Expect = 1.7
 Identities = 41/223 (18%), Positives = 79/223 (35%), Gaps = 20/223 (8%)
 Frame = +1

Query: 1051 GYALGAPTKVDS----------QPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFT 1200
            GY +G     DS          +P L+R    +    +RS  + + E+   ++RNS    
Sbjct: 69   GYCVGISDGEDSYLEKYWCEQCKPELHRLYTVDSAGTLRSLYQPIQEKRRHIRRNSRQRP 128

Query: 1201 NSNSAKAFFDEKFQNPDMLANL----------DSKRRKIIDTKKSTALSRELGKIMRRKD 1350
            NSN       E  Q+    ++L          DS+  +   ++   +L + +G  +R  D
Sbjct: 129  NSNPTSGSQLEDSQHDSSNSSLRETPEKNPTDDSRESRSRSSRSRRSLEKSIGNDIREAD 188

Query: 1351 SSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRING 1530
                 D + G          +   + L  RLG  P       + +  +  G+    ++  
Sbjct: 189  QDQENDGNNGHNNTNDNGKRNNSNSEL-DRLGESP-------LSEDPIEDGDEDDKKLQD 240

Query: 1531 KKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSK 1659
            +K       + K  + +L  +  E  +   H ++      G K
Sbjct: 241  RKRATFSAREEKHYQWMLEKAIRESRRTSKHEDDSHDAGDGQK 283

>KLLA0F11396g Chr6 complement(1048734..1049333) [600 bp, 199 aa]
           {OFF} no similarity
          Length = 199

 Score = 32.7 bits (73), Expect = 1.8
 Identities = 26/114 (22%), Positives = 59/114 (51%), Gaps = 3/114 (2%)
 Frame = +1

Query: 61  EDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSI---VKKSQ 231
           E+E   A+E E  + ++ A  E   ++++  + E+P  E   V +   ++S+   +++S+
Sbjct: 46  EEEDKPAQEEEPAQEEEPAQEEEPAQEEEPAQEEEPAQETEPVVKEVIEESVKEEIEESE 105

Query: 232 DALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEG 393
             +++    VA   NE   +++++E+P  +     +   +AK   DK  A++EG
Sbjct: 106 PVIEENSEDVAE--NEPTKAEEAEETPEASAEASAEAKDEAK---DKDEAEHEG 154

>Ecym_1091 Chr1 complement(191292..192146) [855 bp, 284 aa] {ON}
            similar to Ashbya gossypii AFR664W
          Length = 284

 Score = 33.1 bits (74), Expect = 1.8
 Identities = 30/99 (30%), Positives = 47/99 (47%), Gaps = 11/99 (11%)
 Frame = +1

Query: 1354 SGLEDKSEGEKQKMKQTTESALQTGLIQR----------LGFDPTHGKISKVLKSSVPGG 1503
            SGL D +  E + + +TTES   + L  R          LG D     + K  K+S    
Sbjct: 184  SGLNDSTAEECKDLTETTESIADSELGDRKPILALDNDELGDDEHPITVKKPRKNS---- 239

Query: 1504 ESMPNRINGKKTVINDL-LQYKKEKVILAPSKNEWFKKR 1617
            E++  ++   K++  D+ + +KKEKV L   + E  KKR
Sbjct: 240  ETLDKKLAIPKSIAKDVKVSHKKEKVSLVSDELEDLKKR 278

>Kwal_56.22646 s56 complement(218373..220415) [2043 bp, 680 aa] {ON}
           YDR485C (VPS72) -  [contig 184] FULL
          Length = 680

 Score = 33.5 bits (75), Expect = 1.9
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
 Frame = +1

Query: 58  EEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQ--SPAKKSIVKKSQ 231
           +EDE+   +ELE  ERKK+ L +  KRK    K   P  E    PQ   P  +S++  S+
Sbjct: 82  DEDEEEGERELEQQERKKRKLAQ--KRKIPLVKQRPPKVEEATKPQYEQPKAESLLLDSR 139

Query: 232 DALKQA 249
              K++
Sbjct: 140 RTSKRS 145

>YJL168C Chr10 complement(102227..104428) [2202 bp, 733 aa] {ON}
           SET2Histone methyltransferase with a role in
           transcriptional elongation, methylates a lysine residue
           of histone H3; associates with the C-terminal domain of
           Rpo21p; histone methylation activity is regulated by
           phosphorylation status of Rpo21p
          Length = 733

 Score = 33.5 bits (75), Expect = 1.9
 Identities = 33/112 (29%), Positives = 50/112 (44%), Gaps = 4/112 (3%)
 Frame = +1

Query: 10  PREILAVDPYNNVTSDEEDEQAIAKELEF----MERKKQALMERLKRKQDFKKPEDPNFE 177
           P+   A+D   +  SDEE E+   K LE+    +ER KQ  +E LK+K    K E+    
Sbjct: 529 PKTPGALDSKKHKLSDEEYERKKQKRLEYERIALERAKQEELESLKQK---LKLENERKS 585

Query: 178 AVEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYF 333
            +E   + A K    + ++A K      A  +    +S QSQ    N   +F
Sbjct: 586 VLEDIIAEANKQKELQKEEAKKLVEAKEAKRLKRKTVS-QSQRLEHNWNKFF 636

>Kpol_499.15 s499 (44708..47899) [3192 bp, 1063 aa] {ON}
           (44708..47899) [3192 nt, 1064 aa]
          Length = 1063

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 38/172 (22%), Positives = 74/172 (43%), Gaps = 3/172 (1%)
 Frame = +1

Query: 97  MERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDALKQAIRPVASNIN 276
           + RK++   ERL +K   +KP+    EA    ++   K+ +  ++ A++  I    +N N
Sbjct: 46  LSRKEKRKQERLAKKHKAQKPD----EATLPRKNEKSKNAITSNKKAVRFEIENKKANKN 101

Query: 277 ESMLSQQSQESPSNTTTYFMQKFQDAKRNED--KQIAKYEG-MMNARVHTFGTDNKEYKP 447
            + L   S +  S+       +F+D   NE+  +Q+ + EG   +A V +      EY  
Sbjct: 102 PTELLFSSDDELSSGD---FDEFEDDDLNEEEWEQLKELEGEESDAEVASDKGSGSEYDS 158

Query: 448 IITNELESFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPD 603
               + E   N    +    E   +  ++++K L+  KL       + QE +
Sbjct: 159 EDFEDFEEEDNDSDAEDVESEMTAEETMNKLKALKEKKLRKSANREELQEEE 210

>TBLA0B04900 Chr2 (1154499..1155536) [1038 bp, 345 aa] {ON} Anc_7.536
            YPR180W
          Length = 345

 Score = 33.1 bits (74), Expect = 2.0
 Identities = 31/130 (23%), Positives = 57/130 (43%), Gaps = 8/130 (6%)
 Frame = +1

Query: 1198 TNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSE 1377
            +N  SA  F D        L   DS+     DTK  + +  +LGK+ + +  + +E K +
Sbjct: 154  SNGLSAYCFID--------LIQFDSQ-----DTKLQSQIPTKLGKVSKNRTITNIEIKED 200

Query: 1378 GEKQKMKQ---TTESALQ--TGLIQRLGFDPTHGKISKVLKSSVP---GGESMPNRINGK 1533
                  KQ   TT    +  + L++   F+  H +  K + + VP      ++P  +N +
Sbjct: 201  SNNNDKKQEIITTRHIYKSFSELLKTFTFEGLHRRQIKRMSNMVPLTLALLTIPEELNNE 260

Query: 1534 KTVINDLLQY 1563
            +  I+ L +Y
Sbjct: 261  QLTIDQLKEY 270

>SAKL0A00352g Chr1 complement(38015..39487) [1473 bp, 490 aa] {ON}
           some similarities with uniprot|P53741 YNR051C
           Saccharomyces cerevisiae BRE5 Ubiquitin protease
           cofactor
          Length = 490

 Score = 33.1 bits (74), Expect = 2.3
 Identities = 27/130 (20%), Positives = 61/130 (46%), Gaps = 1/130 (0%)
 Frame = +1

Query: 7   DPREILAVDPYNNVTS-DEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAV 183
           +P+ ++     N VT  ++ED++   KE +  E+K++   E+ + K++ KK E    E  
Sbjct: 173 EPKTMVENGGENQVTKINDEDKKDDVKEEKKEEKKEEKKEEKKEEKKEEKKEEKK--EEK 230

Query: 184 EVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRN 363
           +  +   K    KK ++  KQA +       +   S++ ++   +      ++ +   R 
Sbjct: 231 KEEKKEEKNEERKKEEELKKQAKKEELKKQEKKEESKKEEKKEESKKQEKKEEIKKDDRK 290

Query: 364 EDKQIAKYEG 393
           E++   K++G
Sbjct: 291 EEQVDEKFQG 300

>ZYRO0B01320g Chr2 (111463..112269) [807 bp, 268 aa] {ON} highly
           similar to gnl|GLV|CAGL0K02783g Candida glabrata
           CAGL0K02783g and similar to YKL007W uniprot|P28495
           Saccharomyces cerevisiae YKL007W CAP1 Alpha subunit of
           the capping protein (CP) heterodimer (Cap1p and Cap2p)
           which binds to the barbed ends of actin filaments
           preventing further polymerization localized
           predominantly to cortical actin patches
          Length = 268

 Score = 32.7 bits (73), Expect = 2.3
 Identities = 35/141 (24%), Positives = 55/141 (39%), Gaps = 13/141 (9%)
 Frame = +1

Query: 343 FQDAKRNED-----KQIAKY-----EGMMNARVHTFGTDNKEYKPIITNELESFSNLWV- 489
           FQ +K NE      K++ KY      G ++  V+    +  +   II +   +  N W  
Sbjct: 98  FQGSKLNETQQEYLKELNKYVEKDFTGQVSVAVYPVPQEESKTAIIIVSTKYNPGNFWNG 157

Query: 490 --KKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTS 663
             K  Y+ +  LK+    I +                +  Y     VG  S K D++ T 
Sbjct: 158 AWKSEYVYDSHLKQLKGFIDV----------------QVHYYEDGNVGFKS-KKDVEITD 200

Query: 664 SEKPVKFFMFTITDFQHSLDV 726
           SE P+K      T F++ LDV
Sbjct: 201 SESPIKSIQQVETSFENDLDV 221

>KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {ON}
           Anc_8.787 YOR310C
          Length = 523

 Score = 33.1 bits (74), Expect = 2.3
 Identities = 18/68 (26%), Positives = 37/68 (54%)
 Frame = +1

Query: 31  DPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKK 210
           D  ++ +SDEE+E+   ++ E  E+K++   +  K K+D K+  D + +  ++ QS   K
Sbjct: 442 DDSDDESSDEEEEEVKEEKKEKKEKKEKKEKKEKKEKKDKKRKRDEDEDEEKLKQSKKDK 501

Query: 211 SIVKKSQD 234
              K  ++
Sbjct: 502 KEKKDKKE 509

>Skud_10.46 Chr10 complement(76968..79172) [2205 bp, 734 aa] {ON}
           YJL168C (REAL)
          Length = 734

 Score = 33.1 bits (74), Expect = 2.5
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 7/91 (7%)
 Frame = +1

Query: 31  DPYNNVTSDEEDEQAIAKELEF----MERKKQALMERLKRKQDFKKPEDPNFEAVEVPQS 198
           DP  +  SDEE E+   K LE+    +ER KQ  +E LK+K   +       E + + ++
Sbjct: 537 DPKKHKLSDEEYERKKQKRLEYERIALERAKQEELESLKQKLKLENERKIVLEDI-IAEA 595

Query: 199 PAKKSIVKKSQDAL---KQAIRPVASNINES 282
             +K + K+    L   K+A R    N+++S
Sbjct: 596 NKQKELQKEEAKKLVEAKEAKRLKRRNVSQS 626

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 28/116 (24%), Positives = 50/116 (43%)
 Frame = +1

Query: 16  EILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQ 195
           EI   + Y  +  ++++      EL+  E K +  +ER KRKQ+ K          E  +
Sbjct: 549 EIFEYEKYEKIRKEKKE-----LELKVREAKAREELERRKRKQEEK----------EHSR 593

Query: 196 SPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRN 363
              +K  +K+ Q  LK+ I    S++ E  LS+  +E P           +  ++N
Sbjct: 594 KVLEKEELKRKQQELKKQIEIDISDL-EHELSKHKEEKPDGNIRSISAPMESEEKN 648

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 51/208 (24%), Positives = 82/208 (39%), Gaps = 43/208 (20%)
 Frame = +1

Query: 1099 YRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNS---------------NSAKAFFDE 1233
            Y  + ENQ  +V  T+K   +E E +  N + F  S               +S  +  +E
Sbjct: 364  YVKQFENQLKVVSKTKKSFEKELENIHANLNKFNLSEEDLKQYELLKEKYLSSGGSHIEE 423

Query: 1234 K---FQNPDMLANLDSK---------RRKIIDTKK--STALSRELGKIMRR--------- 1344
            K    +N +   N +S+         R +I D  +    AL  +L ++ +R         
Sbjct: 424  KLAILKNDEFELNEESELINKRLKTTRERISDELQVDVDALEADLNEVTQRLNDKNSIAA 483

Query: 1345 ---KDSSGLEDKSEGEKQKMKQTTESALQTGL-IQRLGFDPTHGKISKVLKSSVPGGESM 1512
               K+  G++   E  K K  +   S     L I  L  D    K  + L+ +V    SM
Sbjct: 484  AKSKEWKGIQTNLESLKNKEYELNFSLRDVLLKIDDLNADQRETKKERKLRENV----SM 539

Query: 1513 PNRI-NGKKTVINDLLQYKKEKVILAPS 1593
              R+  G K +++DL   KKEK  +A S
Sbjct: 540  LKRLYPGVKGLVHDLCHPKKEKYAIAVS 567

>CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 aa]
            {ON} similar to uniprot|Q12019 Saccharomyces cerevisiae
            YLR106c
          Length = 4880

 Score = 33.1 bits (74), Expect = 2.9
 Identities = 42/162 (25%), Positives = 66/162 (40%), Gaps = 6/162 (3%)
 Frame = +1

Query: 1138 STRKGLSEEEERVKRNSHNFTNS---NSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKST 1308
            ST K LS E++ +  N   F      N      DE  +  ++ A +D  +R + +     
Sbjct: 4543 STMKDLSIEDKEIYENDGLFKREDYENELDQLMDEIDKETNLKAEIDKPQRDLTE----- 4597

Query: 1309 ALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKS 1488
              SREL +            KSE E      T E + + G   RL  +PT       L +
Sbjct: 4598 --SRELWR------------KSEIE------TVELSARLGEQLRLILEPT-------LAT 4630

Query: 1489 SVPGGESMPNRINGKKTVINDLLQYKKEKVIL---APSKNEW 1605
             + G      R+N K+ +     QY+K+K+ L    PSK ++
Sbjct: 4631 KLRGDYKTGKRLNMKRIIPYIASQYRKDKIWLRRTKPSKRQY 4672

>ZYRO0G06402g Chr7 (505987..507273) [1287 bp, 428 aa] {ON} some
           similarities with uniprot|P53919 Saccharomyces
           cerevisiae YNL124W
          Length = 428

 Score = 32.7 bits (73), Expect = 2.9
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 15/86 (17%)
 Frame = +1

Query: 52  SDEEDEQAIAKELEFMERKKQALMERLKRKQDFK-----KPEDP----------NFEAVE 186
           S+  DE+   +E EF + +K+A+ +++K++Q+ K     KP+ P          N ++++
Sbjct: 199 SNGYDEELPEEEQEFSDDEKEAISKKMKKEQNKKKKENGKPKQPRSGGVDKIPNNLQSMK 258

Query: 187 VPQSPAKKSIVKKSQDALKQAIRPVA 264
           VPQ+    S   ++     Q   P A
Sbjct: 259 VPQAMTSVSYRSRNSRQAPQQSPPAA 284

>AEL344W Chr5 (5878..7500) [1623 bp, 540 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YAL013W (DEP1)
          Length = 540

 Score = 25.8 bits (55), Expect(2) = 2.9
 Identities = 13/34 (38%), Positives = 22/34 (64%)
 Frame = +1

Query: 55  DEEDEQAIAKELEFMERKKQALMERLKRKQDFKK 156
           D+E+E+   +E E  E ++ +L+ER K +QD  K
Sbjct: 285 DDEEEEEDDEEEEEEEEEEPSLIEREKLRQDALK 318

 Score = 25.4 bits (54), Expect(2) = 2.9
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = +3

Query: 222 EIPRCLEAGHKACSFQYQRINAI 290
           E+  CLE  H A    YQ+I++I
Sbjct: 345 ELQMCLEGSHPALQTYYQKIDSI 367

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
            (REAL)
          Length = 458

 Score = 32.7 bits (73), Expect = 2.9
 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 9/100 (9%)
 Frame = +1

Query: 1147 KGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKK-----STA 1311
            K + E    +  +S +FT+ +S   F D  F   ++  N  SKRR +I   K     S  
Sbjct: 6    KSIGELPINLNSDSTSFTDDSSDNFFMDNSFDEDEIDDNDGSKRRSVIVDSKVSNFPSDC 65

Query: 1312 LSRELGKIMRRKDSSG----LEDKSEGEKQKMKQTTESAL 1419
            LS     +   K+ +     L D+S  E    + TT+  L
Sbjct: 66   LSSPSSSLDNEKNVASQANILPDRSSTENVNAEHTTKPKL 105

>Klac_YGOB_F11386g Chr6
           complement(1047731..1048744,1048746..1049333) [1602 bp,
           533 aa] {ON} ANNOTATED BY YGOB -
          Length = 533

 Score = 32.7 bits (73), Expect = 3.1
 Identities = 26/114 (22%), Positives = 59/114 (51%), Gaps = 3/114 (2%)
 Frame = +1

Query: 61  EDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSI---VKKSQ 231
           E+E   A+E E  + ++ A  E   ++++  + E+P  E   V +   ++S+   +++S+
Sbjct: 46  EEEDKPAQEEEPAQEEEPAQEEEPAQEEEPAQEEEPAQETEPVVKEVIEESVKEEIEESE 105

Query: 232 DALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEG 393
             +++    VA   NE   +++++E+P  +     +   +AK   DK  A++EG
Sbjct: 106 PVIEENSEDVAE--NEPTKAEEAEETPEASAEASAEAKDEAK---DKDEAEHEG 154

>Kpol_1052.10 s1052 (32230..34155) [1926 bp, 641 aa] {ON}
           (32230..34155) [1926 nt, 642 aa]
          Length = 641

 Score = 32.7 bits (73), Expect = 3.2
 Identities = 22/76 (28%), Positives = 39/76 (51%)
 Frame = +1

Query: 61  EDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDAL 240
           E EQAI KELE ++ ++Q   E  + K+D K+ E    +A  +  +    S+   S+D  
Sbjct: 563 EVEQAIRKELEVVKERQQMDKEIQQAKKDMKRGEGKILDASSISNAQNLNSL---SEDQR 619

Query: 241 KQAIRPVASNINESML 288
           K+ +R   +   E+ +
Sbjct: 620 KRLMREQRARAAEARM 635

>ZYRO0C14036g Chr3 (1101220..1103205) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06644 Saccharomyces cerevisiae YDR307W
           Hypothetical ORF
          Length = 661

 Score = 32.7 bits (73), Expect = 3.2
 Identities = 25/111 (22%), Positives = 48/111 (43%), Gaps = 17/111 (15%)
 Frame = +1

Query: 274 NESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQ--------------IAKYEGMMNARV 411
           N  MLS  +Q+SP   + +    F+   R   +Q              +    G +++  
Sbjct: 267 NTLMLSHWTQDSPE-FSRFMSSNFKSFLRGPIEQPVGLNYGSVVTLRHLESLGGYLHSHN 325

Query: 412 HTFGTDNKEYKPIITNELESFSNLWVKKRYIPEED---LKRALHEIKILRL 555
           +T+ T + E +  +T E   F N W+ +   P+ED   + + +H+   +RL
Sbjct: 326 YTYETGSFEQQVTLTQEENDFDNEWIVEYKFPDEDKVMINKKIHDGDEIRL 376

>SAKL0H22858g Chr8 (1988530..1990740) [2211 bp, 736 aa] {ON} similar
           to uniprot|P53202 Saccharomyces cerevisiae YGR003W
          Length = 736

 Score = 32.7 bits (73), Expect = 3.3
 Identities = 22/88 (25%), Positives = 45/88 (51%), Gaps = 2/88 (2%)
 Frame = +1

Query: 250 IRPVASNINESMLSQ--QSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFG 423
           +RP+ + I ESML +   ++E+ S    Y + K         + +A  E +++   + + 
Sbjct: 146 VRPLCTKIQESMLHEINMARENKSTPVNYSLLK---------EIVAMMETLVDVNDNYYL 196

Query: 424 TDNKEYKPIITNELESFSNLWVKKRYIP 507
           T   E++P +  E E++ N +V+K  +P
Sbjct: 197 T---EFEPYLLKETENYYNTFVQKHSLP 221

>CAGL0H05357g Chr8 complement(514513..516825) [2313 bp, 770 aa] {ON}
           similar to uniprot|P40328 Saccharomyces cerevisiae
           YPL074w YTA6
          Length = 770

 Score = 32.7 bits (73), Expect = 3.3
 Identities = 33/132 (25%), Positives = 61/132 (46%)
 Frame = +1

Query: 46  VTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKK 225
           V S  E+E+   KELE +ER+++   ERL R++  K+ E+   + +E  +   K+  V++
Sbjct: 198 VASKLEEEELKRKELELLERERE---ERLAREKALKEQEEAKLKEMEEQERLRKE--VQR 252

Query: 226 SQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNA 405
             +  K+  R       E     + Q+    T+     K Q +  N+   I     +MN 
Sbjct: 253 QIELHKEQER----KERERQEKLERQKEVELTSVSNRGKKQVSSSNDRSDI-----VMNR 303

Query: 406 RVHTFGTDNKEY 441
           R    G+ N+++
Sbjct: 304 RSIDMGSANRDH 315

>Kwal_47.17781 s47 (552713..556534) [3822 bp, 1273 aa] {ON} YMR128W
            (ECM16) - (putative) involved in cell wall biogenesis
            [contig 204] FULL
          Length = 1273

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 2/98 (2%)
 Frame = +1

Query: 1342 RKDSSG--LEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMP 1515
            +KDS+   LE  SE E +  K+  E            F P   K+S++ K  +       
Sbjct: 50   QKDSNAEILEPLSEKETELKKRKLEEL----------FKPQESKVSRIKKKRLDKFIEHQ 99

Query: 1516 NRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHRE 1629
             +   KK +I  L +YK +  IL  SKN    +++ +E
Sbjct: 100  LKREEKKAIIEKLQEYKVDTSILTSSKNLGHGRQTKKE 137

>CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some
           similarities with uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 359

 Score = 32.3 bits (72), Expect = 3.5
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 10/126 (7%)
 Frame = +1

Query: 4   DDPREILAVDPYNNVTS----DEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPE--D 165
           D  +++L   P N  T     DEE+E+       F  R+K    + L  +   K+ +   
Sbjct: 231 DFDKDVLESKPKNRYTEEPLEDEEEEEEEMGGHPFFGRQKIPSFKPLDTENTNKQDQCIK 290

Query: 166 PNFEAVEVPQSPAKKSIVKKSQ----DALKQAIRPVASNINESMLSQQSQESPSNTTTYF 333
            N     VP   +++S +        +A  Q+++      N+ ++S+QSQ S    TT +
Sbjct: 291 KNSADQHVPPLDSEQSSMNLDYLLEFEAGTQSVKNPLPRFNKDVISKQSQRSLEEYTTLY 350

Query: 334 MQKFQD 351
            + F+D
Sbjct: 351 TEYFKD 356

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] {ON}
            Anc_3.491 YPR148C
          Length = 452

 Score = 29.3 bits (64), Expect(2) = 3.8
 Identities = 39/176 (22%), Positives = 70/176 (39%), Gaps = 4/176 (2%)
 Frame = +1

Query: 901  SRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPTKV 1080
            ++D G   I+N+    + G  +  + ++  D   + + RGT  K              KV
Sbjct: 119  TQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEK--------------KV 164

Query: 1081 DSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDM-L 1257
              +     A+ E++ +      +   EEEE +  N     N  SA   +   ++N D   
Sbjct: 165  KREEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMN-----NMISAFGLWSNCYKNIDQSK 219

Query: 1258 ANLDSKRRKIIDTKKSTALS---RELGKIMRRKDSSGLEDKSEGEKQKMKQTTESA 1416
            A +DS   K  + K +  L    + + K+  R   S LE  +   K K+K+  + A
Sbjct: 220  AEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRHKLKLKELEKEA 275

 Score = 21.6 bits (44), Expect(2) = 3.8
 Identities = 14/46 (30%), Positives = 21/46 (45%)
 Frame = +2

Query: 1532 RKRLSTISYSTRRRKSSWHPQRTNGSKKEATVKKSGKGTLDPRKLK 1669
            RKR S    +   RKS+        + +  + KKSGK +   +K K
Sbjct: 296  RKRKSRAHGAQGGRKSTTEEAEKTSASENDSSKKSGKASGKSKKGK 341

>KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some
           similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre- rRNA
           processing and ribosome biogenesis
          Length = 505

 Score = 32.3 bits (72), Expect = 4.0
 Identities = 23/90 (25%), Positives = 42/90 (46%)
 Frame = +1

Query: 49  TSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKS 228
           +SD E+EQ + K+ +   +K      +   K+D KK               AKK  VK++
Sbjct: 72  SSDSEEEQEVKKDTKKDTKKDTKKEAKKDSKKDSKK--------------EAKKETVKEA 117

Query: 229 QDALKQAIRPVASNINESMLSQQSQESPSN 318
           +   K+A+ P + + + S    +S +S S+
Sbjct: 118 KKGSKKAVAPESDSESGSESDTESSDSESS 147

>NCAS0G02000 Chr7 complement(360567..362222) [1656 bp, 551 aa] {ON}
           Anc_2.86 YNL167C
          Length = 551

 Score = 32.3 bits (72), Expect = 4.1
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +1

Query: 28  VDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDF--KKPEDPNFEAVE 186
           ++  +N   D EDEQ   K  EF+ER + A  +  KRK+++  K   D NF  VE
Sbjct: 355 INDNDNTNYDNEDEQD-RKRKEFLERNRVAASKFRKRKKEYIKKIENDLNFYEVE 408

>KLTH0G10274g Chr7 complement(868108..869787) [1680 bp, 559 aa] {ON}
            similar to uniprot|P46678 Saccharomyces cerevisiae
            YNL039W BDP1 Essential subunit of RNA polymerase III
            transcription factor (TFIIIB) which is involved in
            transcription of genes encoding tRNAs 5S rRNA U6 snRNA
            and other small RNAs
          Length = 559

 Score = 32.3 bits (72), Expect = 4.1
 Identities = 33/148 (22%), Positives = 55/148 (37%), Gaps = 16/148 (10%)
 Frame = +1

Query: 1135 RSTRKGLSEEEERV------------KRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKR 1278
            +ST KGL EE                +R S    + + A   F   F  P   A      
Sbjct: 70   QSTTKGLDEEIGSTQASPPASLPPGQRRRSSRLDSLSGANNMFKSGFMEPSQTAAPSGA- 128

Query: 1279 RKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEG----EKQKMKQTTESALQTGLIQRLG 1446
                +T K+  LS   G   ++K  S + +        +K++M   +  + +TG  QR+ 
Sbjct: 129  ----ETAKNRRLSTITGNQGKKKRMSSISESDTSFQAIKKRRMSSRSSISRKTGSAQRIS 184

Query: 1447 FDPTHGKISKVLKSSVPGGESMPNRING 1530
                   + + L S+    E++ N  NG
Sbjct: 185  ILSHMNNMDEHLASADADDENLKNETNG 212

>NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa]
           {ON} Anc_5.591
          Length = 957

 Score = 32.3 bits (72), Expect = 4.5
 Identities = 15/50 (30%), Positives = 29/50 (58%)
 Frame = +1

Query: 439 YKPIITNELESFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPK 588
           Y P++ N  + + + + K R + EED KR + ++K ++L+    K + PK
Sbjct: 692 YDPLVVNREKGWVDCFFKARQLIEEDEKRVVDKVKGIKLSPPAEKSKIPK 741

>Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {ON}
            complement(71225..74242) [3018 nt, 1006 aa]
          Length = 1005

 Score = 32.3 bits (72), Expect = 4.5
 Identities = 39/195 (20%), Positives = 81/195 (41%), Gaps = 10/195 (5%)
 Frame = +1

Query: 1117 NQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQ--NPDMLANLDSKRRKII 1290
            N+ NI  +  +     +++ K+N    +N+N+A    D+  Q  +P + + LD+   K  
Sbjct: 337  NETNIPTNNVQSTGGGKKKNKKNKKKISNNNNAANSNDDSLQIISPSVESGLDANSSKFT 396

Query: 1291 DTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKI 1470
              K +  L        +  +   L+ + E EK+K +  T + ++   + +   D     +
Sbjct: 397  SEKYNDLLKEYNEFKEKHTECDKLKFEYETEKEKYETETTNNIKDLEVVKKELDSAKEAL 456

Query: 1471 SKVLKSSVPGGESMPNRINGKKTVINDLLQYK--------KEKVILAPSKNEWFKKRSHR 1626
            S    S       +    +  + V N+L++ K        K+   +   K +  K  S +
Sbjct: 457  SVSNSSLKQKSTELEEVKDMLRDVGNELVEAKDQLKQAGSKQGEEIEILKKDLMKLTSEK 516

Query: 1627 EEVWQRHFGSKETEV 1671
            E++ Q  F SK+ E+
Sbjct: 517  EKL-QAEFESKQKEL 530

>ZYRO0G12716g Chr7 complement(1009177..1012215) [3039 bp, 1012 aa]
           {ON} similar to uniprot|P38249 Saccharomyces cerevisiae
           YBR079C RPG1 Subunit of the core complex of translation
           initiation factor 3(eIF3) essential for translation part
           of a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates
           binding of mRNA and tRNA(i)Met to ribosomes
          Length = 1012

 Score = 32.3 bits (72), Expect = 4.5
 Identities = 28/138 (20%), Positives = 61/138 (44%)
 Frame = +1

Query: 61  EDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDAL 240
           E E  +     F+  K   L ERL+ ++DFK  +    E V+V    A++S++K++Q+ +
Sbjct: 540 EPEPVVITRNTFIRNKLAQLSERLQEEEDFK--DGSYLEKVKV----ARESLIKQTQEII 593

Query: 241 KQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTF 420
             A +       +S   +Q   + +        + +  +  E+K + + +   +A+    
Sbjct: 594 DNAKKYAEERAKKSHEQRQKTLASAAENAEQDAELRQQRMLEEKAVIEAKMEEDAQRRLV 653

Query: 421 GTDNKEYKPIITNELESF 474
               +E + +   EL+ F
Sbjct: 654 ERKKRELEALKEVELKKF 671

>SAKL0E04730g Chr5 complement(381559..384942) [3384 bp, 1127 aa] {ON}
            similar to uniprot|P40395 Saccharomyces cerevisiae
            YLR039C RIC1 Subunit of a Golgi membrane exchange factor
            (Ric1p-Rgp1p) that catalyzes nucleotide exchange on Ypt6p
            involved in transcription of ribosomal protein genes and
            ribosomal RNA
          Length = 1127

 Score = 32.3 bits (72), Expect = 4.5
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 3/61 (4%)
 Frame = +1

Query: 1063 GAPTKVDSQPSLYRAKGENQFNIVR---STRKGLSEEEERVKRNSHNFTNSNSAKAFFDE 1233
            G PT++D+Q    +A G N+ N  R   S +K   + ++R  +   +  NS+ AK   DE
Sbjct: 1011 GDPTEIDAQEQSKKANGSNKSNGNRKKNSNKKKKKKNDKRKAKKLPSHLNSSVAKVLTDE 1070

Query: 1234 K 1236
            +
Sbjct: 1071 E 1071

>KNAG0A06020 Chr1 complement(905792..909550) [3759 bp, 1252 aa] {ON}
            Anc_2.409 YMR128W
          Length = 1252

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 32/133 (24%), Positives = 57/133 (42%), Gaps = 16/133 (12%)
 Frame = +1

Query: 1279 RKIIDTKKSTALSRELGKIMR-RKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDP 1455
            RK  + K  +     L ++ R R      +++ E + +  K+TT++     ++Q    D 
Sbjct: 5    RKRFNEKARSGHMARLKELKRVRNKQFHRDEEKESDHEGSKETTQADPNAEILQPQTRDE 64

Query: 1456 THGKISKVLKSSVPGGESMPNRINGK---------------KTVINDLLQYKKEKVILAP 1590
               K  K+ +  VP  ES  +R+  K               KT+I+ +  YK +  +L  
Sbjct: 65   IEQKKRKLEELFVPK-ESKVSRLKKKRLDKFIEHQLKREERKTIIDKMQDYKMDTSVLTS 123

Query: 1591 SKNEWFKKRSHRE 1629
            SKN    KR+ +E
Sbjct: 124  SKNLGHGKRTKKE 136

>SAKL0E04532g Chr5 (364158..367979) [3822 bp, 1273 aa] {ON} similar to
            uniprot|Q04217 Saccharomyces cerevisiae YMR128W ECM16
            Essential DEAH-box ATP-dependent RNA helicase specific to
            the U3 snoRNP predominantly nucleolar in distribution
            required for 18S rRNA synthesis
          Length = 1273

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 28/119 (23%), Positives = 53/119 (44%), Gaps = 14/119 (11%)
 Frame = +1

Query: 1318 RELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLG--------------FDP 1455
            +EL K+  ++    +ED ++ +++++++   +A    LIQ L               F P
Sbjct: 21   KELKKVRNKQFLRHMEDGADVDEEEVQEHDSNA---ELIQPLSKEEKELKKRKLELLFTP 77

Query: 1456 THGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREE 1632
               KIS+  K  +        +   KKT+I  L  YK +  +L  SK     +++ +EE
Sbjct: 78   EETKISRTKKKRLDKFIEQQLKREEKKTIIEKLQDYKVDTSLLTSSKKLGHGRQTKKEE 136

>TBLA0D00810 Chr4 complement(213322..217836) [4515 bp, 1504 aa] {ON}
            Anc_8.777
          Length = 1504

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 41/198 (20%), Positives = 71/198 (35%), Gaps = 13/198 (6%)
 Frame = +1

Query: 1132 VRSTRKGLSEEEERVKRNSHN-----FTNSNSAKAFFDEKFQNPDMLANL-----DSKRR 1281
            +    + L +++E +  ++ N       ++N  K +  EK Q     +N      D    
Sbjct: 1286 INEKEQKLEQQQEVINHDNKNTVSKIINHTNDKKKYKKEKIQGNYKPSNSPPSSKDGNSN 1345

Query: 1282 KIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTH 1461
               D+ K    SR +      K   G  +K     +K K + +                 
Sbjct: 1346 NSPDSSKGNKTSRSVSDKNTAKHKEGSFEKKNNIGKKNKSSNKP---------------- 1389

Query: 1462 GKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHR--EEV 1635
             KI + LK  +P   S  N  NG    ++     +K+ +  A    +WF   S R  +++
Sbjct: 1390 -KIKETLKKELPDKNSNDNSRNGNIVHVHKPSNQQKDDIDPAKEFEKWFALESARIQQQM 1448

Query: 1636 WQR-HFGSKETEVASDAS 1686
             QR H  S E E    +S
Sbjct: 1449 DQRDHSISNELEAIYSSS 1466

>Suva_2.327 Chr2 (575454..575972) [519 bp, 172 aa] {ON} YDR163W
           (REAL)
          Length = 172

 Score = 31.2 bits (69), Expect = 4.8
 Identities = 21/88 (23%), Positives = 41/88 (46%)
 Frame = +1

Query: 43  NVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVK 222
           N+   E+D++ + KEL  ++  K     RL++K++ K  E P+  +     +  +  I K
Sbjct: 80  NLEESEDDQEDLLKELAKIQEAKLDKKIRLQQKEEIK--EQPSKRSWRQSTAFGRHKITK 137

Query: 223 KSQDALKQAIRPVASNINESMLSQQSQE 306
                   A  P++  +N+   S+  QE
Sbjct: 138 SRNSNDDGAKTPLSGYVNDMTKSKYHQE 165

>Ecym_6410 Chr6 (795710..797173) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii AFR025C
          Length = 487

 Score = 32.0 bits (71), Expect = 5.2
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +1

Query: 55  DEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQS 198
           DEE+E+   K  EF+ER + A  +  KRK+++ K  + + +  E   S
Sbjct: 310 DEEEEERERKRKEFLERNRLAASKFRKRKKEYIKKIETDLQFYETEYS 357

>TPHA0C03220 Chr3 complement(707955..708705,708802..708818) [768 bp,
           255 aa] {ON} Anc_2.261 YNL050C
          Length = 255

 Score = 31.6 bits (70), Expect = 5.2
 Identities = 25/109 (22%), Positives = 47/109 (43%), Gaps = 13/109 (11%)
 Frame = +1

Query: 301 QESPSNTTT------YFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNKEYKPII--- 453
           + SP  T T      YF    +D KRN +K   +++ +   +        K++K I+   
Sbjct: 116 EPSPEITNTERPDSYYFATYTEDDKRNFEKSAIEFDAIFEDKAININRPGKKHKIIVLED 175

Query: 454 ----TNELESFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPK 588
                NEL   +N+  K+R   ++ + + L + KI    +L   ++  K
Sbjct: 176 YNKKINELNERANILRKRRPGKKQRVAKKLAKEKIKEREQLLKTLKKEK 224

>TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON}
           Anc_5.274 YHR030C
          Length = 492

 Score = 32.0 bits (71), Expect = 5.2
 Identities = 36/188 (19%), Positives = 72/188 (38%), Gaps = 22/188 (11%)
 Frame = +1

Query: 7   DPREILAVD-----PYNNVTSDEEDEQAIAKELEFMERKKQALMERLKR---------KQ 144
           DP++ + VD     PY ++  D  DE   +++ EF   +    ME LKR         +Q
Sbjct: 307 DPQKRITVDEALEHPYLSIWHDPADEPICSEKFEFSSFESVNEMEELKRMVIEEVHDFRQ 366

Query: 145 DFKKPEDPNFEAVEVPQSPAKKSIVKKSQD--------ALKQAIRPVASNINESMLSQQS 300
             ++P      A++  Q   ++   ++  D         + Q+   +   + +S +   S
Sbjct: 367 FVRQPIIDEQRALQEQQQQQQQQQQQQQMDERDFSQQVMMNQSQANIPEELQDSFVGIHS 426

Query: 301 QESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSN 480
           Q  P++  + F  K Q+        +    G +     +   +N  Y      +LE    
Sbjct: 427 QGLPNHQDSDFPPKPQENFLASPNDLRNSSGSLIPGAQSTNNNNTAYDDFF--DLEKELE 484

Query: 481 LWVKKRYI 504
             + ++YI
Sbjct: 485 FGLDRKYI 492

>Kpol_1028.103 s1028 (227568..228023) [456 bp, 151 aa] {ON}
            (227568..228023) [456 nt, 152 aa]
          Length = 151

 Score = 30.8 bits (68), Expect = 5.4
 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 4/96 (4%)
 Frame = +1

Query: 1276 RRKIIDTKKSTALSRELGKIM---RRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLG 1446
            R+ +  T      +R  G ++   ++  ++  +  +EG++  M        +T +++   
Sbjct: 22   RQNVARTNAQINAARRTGNVLSVDKKYGTTNAKGNNEGQRLTMVDR-----ETDIVKLKK 76

Query: 1447 FDPTHGK-ISKVLKSSVPGGESMPNRINGKKTVIND 1551
             DP  GK ISK         + +  +IN K TVIND
Sbjct: 77   LDPAVGKAISKARTEKKLSQKDLATKINEKPTVIND 112

>Suva_4.93 Chr4 complement(169009..170826) [1818 bp, 605 aa] {ON}
           YDL153C (REAL)
          Length = 605

 Score = 32.0 bits (71), Expect = 5.5
 Identities = 26/141 (18%), Positives = 65/141 (46%), Gaps = 15/141 (10%)
 Frame = +1

Query: 4   DDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPN---- 171
           ++  E+LA+D  +  +SD+E+E+   ++L+  E  K+     L+  Q  ++ E+      
Sbjct: 59  EEEEEVLAMDDADE-SSDDEEEEEEEEKLDGAEAYKKIFGRNLETDQPLEEDEEHGMLDN 117

Query: 172 -----------FEAVEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQESPSN 318
                      + A ++    A K I K++    K+ +  +  N+N+ +   + +E   N
Sbjct: 118 ENAWGSTKGEYYGADDLDDEEAAKEIEKEALRQQKKHLEEL--NMNDYLDEAEEEEWVKN 175

Query: 319 TTTYFMQKFQDAKRNEDKQIA 381
              + M +F+ + +  + +++
Sbjct: 176 AKEFDMGEFKSSTKQPETKVS 196

>KLTH0A00858g Chr1 (88180..90123) [1944 bp, 647 aa] {ON} similar to
           uniprot|Q06623 Saccharomyces cerevisiae YPR179C
          Length = 647

 Score = 32.0 bits (71), Expect = 5.5
 Identities = 23/105 (21%), Positives = 49/105 (46%)
 Frame = +1

Query: 58  EEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDA 237
           EE+ + +A  +E ++   + L E+     DF K  D   E  +V +   K+  +K S++ 
Sbjct: 482 EEEHKKVASSMEELDTYTETLREK---SPDFSKLIDCLLEIAKVQEEIEKQQKLKVSRNN 538

Query: 238 LKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDK 372
               +       NE++   Q++++P    T  +++  + K  ED+
Sbjct: 539 EHTYMTEELRRANEALAGFQAEKAPIAEETQQLEQKIEEKLAEDR 583

>KLLA0F13354g Chr6 complement(1231619..1233577) [1959 bp, 652 aa]
           {ON} weakly similar to uniprot|Q7LIF4 Saccharomyces
           cerevisiae YLR219W MSC3 Protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cell periphery msc3 mutants are defective in
           directing meiotic recombination events to homologous
           chromatids potential Cdc28p substrate
          Length = 652

 Score = 32.0 bits (71), Expect = 5.5
 Identities = 19/79 (24%), Positives = 35/79 (44%)
 Frame = +1

Query: 130 LKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQES 309
           L +KQ  ++ ++   + +   Q+   KS+ +KS  + +  +R   +   E       Q +
Sbjct: 315 LVQKQGVQQQQEVQHQGISQVQNTEAKSVGRKSTMSKRMTLRDTPNAQLEPEKDTTDQAT 374

Query: 310 PSNTTTYFMQKFQDAKRNE 366
           P N  T     F+  KRNE
Sbjct: 375 PDNNATKRKSIFKSKKRNE 393

>Kpol_1055.89 s1055 (228896..231154) [2259 bp, 753 aa] {ON}
            (228896..231154) [2259 nt, 753 aa]
          Length = 753

 Score = 32.0 bits (71), Expect = 5.7
 Identities = 22/60 (36%), Positives = 30/60 (50%)
 Frame = +1

Query: 1096 LYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSK 1275
            L++A  EN  N       G+    ER      N TN  +A A FDEKF  PD+L+  ++K
Sbjct: 672  LFQAPIENILNWDSQKIVGI----ERWLNKLINLTNQITALASFDEKFSTPDVLSGPNAK 727

>Smik_15.423 Chr15 (734506..735420) [915 bp, 304 aa] {ON}  YOR239W
           (REAL)
          Length = 304

 Score = 31.6 bits (70), Expect = 5.7
 Identities = 33/137 (24%), Positives = 62/137 (45%), Gaps = 4/137 (2%)
 Frame = +1

Query: 34  PYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKS 213
           P NN    +  E+ +AKE E +   KQ   E  + K++  +P+       EV  + + +S
Sbjct: 130 PANNTVESDAIEENLAKETEGIAGSKQ---EENEEKEEHVEPK-------EVSSNNSSES 179

Query: 214 IVKKSQDALKQAIRPVASNINESMLSQ----QSQESPSNTTTYFMQKFQDAKRNEDKQIA 381
           I + S+      I    SN  E   S+    Q+ ++ + +TT   +K ++ K+N+ K+ A
Sbjct: 180 IEEGSESEEDADIE--QSNSEEPQNSENNTLQANDASTCSTTSKNRKKKNKKKNKKKKNA 237

Query: 382 KYEGMMNARVHTFGTDN 432
                 +    T  ++N
Sbjct: 238 NANANADIEASTSTSNN 254

>Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar to
            Ashbya gossypii ABL193C
          Length = 850

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 22/188 (11%)
 Frame = +1

Query: 46   VTSDEEDEQAIAKELEFME----RKKQALMERLKRKQDFKKPEDPNF-EAVEVPQSPAKK 210
            +TSDEE    I  ELE ++    + K+ L  +LK  +D    ++ N  E ++  Q   K 
Sbjct: 527  LTSDEELLNNIKSELEPLKALNLKLKEELESKLKDTKDHYVTKESNMKENIKELQEDVKV 586

Query: 211  SI--VKKSQDALKQAIRPVASNINE---------------SMLSQQSQESPSNTTTYFMQ 339
             +  +KKSQD ++   + +A+ I E               S L +   +   +T     +
Sbjct: 587  HLANIKKSQDVIESLHKDIAALIKEKEELLNKNAELSKRISELQESQLQRDRSTFLDLCE 646

Query: 340  KFQDAKRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDL 519
            K QD  ++  + I K   +    V      N  Y+ + +   E  S L  K++ I   DL
Sbjct: 647  KNQDLLQSNHELITKSRDLEAELV----AANSNYQELESKISEKDSLLKDKQQTI--SDL 700

Query: 520  KRALHEIK 543
            +  L++++
Sbjct: 701  QLNLNQLR 708

>TBLA0D03220 Chr4 complement(785837..789256) [3420 bp, 1139 aa] {ON}
           Anc_8.834 YML111W
          Length = 1139

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 36/133 (27%), Positives = 63/133 (47%), Gaps = 2/133 (1%)
 Frame = +1

Query: 397 MNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALHEIKI-LRLNKLFAK 573
           +++ + TF T    ++    ++L    N+++ K Y     L R    I+I +RL K   K
Sbjct: 286 ISSNLSTFNTHQVPFE----DDLNDSDNIFIDKLYT----LPRLSTPIEIDIRLTKYATK 337

Query: 574 IRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTIT-DFQHSLDVYIFGKKGV 750
               K Q+       T G + H   +    S+KP+KF MF +T +   S+     GK+ +
Sbjct: 338 PHE-KPQDESLLKEYTSGDLIHGYCVIQNKSKKPIKFEMFYVTLEAYTSIIDRSIGKRTI 396

Query: 751 ERYYNLRLGDVIA 789
           +R+  LR+ D+ A
Sbjct: 397 KRF--LRMVDLSA 407

>Smik_12.526 Chr12 (922417..929100) [6684 bp, 2227 aa] {ON} YLR430W
            (REAL)
          Length = 2227

 Score = 32.0 bits (71), Expect = 6.3
 Identities = 32/125 (25%), Positives = 54/125 (43%)
 Frame = +1

Query: 1249 DMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTG 1428
            D+  N   K+RKI+D       + +  K  + K+    + KS+ +K+K  +   S+  +G
Sbjct: 1895 DVKLNKGPKKRKIVDDDGEADKTVKKKKKEKEKNKEKKKLKSDNKKKKHTEGESSSTSSG 1954

Query: 1429 LIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWF 1608
              +               KSS+ GG S+PN +  K     D+   KK+ ++ A  K    
Sbjct: 1955 TKK---------------KSSIFGGMSVPNAVVPKS--FADINSEKKD-IVAADKK---- 1992

Query: 1609 KKRSH 1623
            KK  H
Sbjct: 1993 KKNKH 1997

>NCAS0I00520 Chr9 complement(83655..85001) [1347 bp, 448 aa] {ON}
           Anc_7.93 YOL041C
          Length = 448

 Score = 31.6 bits (70), Expect = 6.7
 Identities = 27/98 (27%), Positives = 42/98 (42%)
 Frame = +1

Query: 235 ALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVH 414
           +LK+      S   E   +Q+ +E P+       +K  DA  NED +   Y  +M++   
Sbjct: 51  SLKRKTNDNESKKTEKPETQKQEEEPALKKQKKQKKKADADANEDLEGNYYAKLMDS--D 108

Query: 415 TFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRA 528
               D KE K     E  S      KK  + EE+L++A
Sbjct: 109 EKDEDTKEIKEDSEKEFVSTPEQVAKKTDLKEEELEKA 146

>KNAG0G02560 Chr7 (582049..583431) [1383 bp, 460 aa] {ON} Anc_8.673
           YOR244W
          Length = 460

 Score = 31.6 bits (70), Expect = 6.7
 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 7/92 (7%)
 Frame = +1

Query: 421 GTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEP 600
           G DN+E  P I  +LES   L VK +   E+D +    EI  +   ++     PPKF   
Sbjct: 2   GGDNEETLPGIPRKLESVEELMVKCQCWVEKDGEERFAEILSINTRRV-----PPKFY-V 55

Query: 601 DYAN-------WATVGLISHKSDIKFTSSEKP 675
            Y N       W T   I    D+ F   ++P
Sbjct: 56  HYLNFNKRLDEWITSERIDLDKDVVFPRPKEP 87

>ZYRO0G20922g Chr7 (1718986..1720479) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38351 Saccharomyces cerevisiae YBR279W PAF1
           RNA polymerase II-associated protein defines a large
           complex that is biochemically and functionally distinct
           from the Srb-Mediator form of Pol II holoenzyme and is
           required for full expression of a subset of cell
           cycle-regulated genes
          Length = 497

 Score = 31.6 bits (70), Expect = 6.9
 Identities = 23/116 (19%), Positives = 50/116 (43%)
 Frame = +1

Query: 31  DPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKK 210
           +P N     E+ EQ+ +K  E   + ++      K ++   KPE+P  +    P+ P  K
Sbjct: 392 EPNNESQQPEQSEQSESKPEESQSKPEEPEEPESKPEEPENKPEEPESK----PEEPESK 447

Query: 211 SIVKKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQI 378
                S+    ++    + ++ +S    +S+E  ++         Q+ K  +DK++
Sbjct: 448 LEEPASKSEEPESKPEESEDVGQSKKGSESKEPEASEN-------QEEKSQDDKEL 496

>TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa]
           {ON} Anc_8.716 YOR267C
          Length = 590

 Score = 31.6 bits (70), Expect = 7.1
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 2/81 (2%)
 Frame = +1

Query: 40  NNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIV 219
           NNVT  E  E    KE +  E    +  E++   +   KP +PN       + PAK   +
Sbjct: 410 NNVTKQENKETEKEKESK-PEEANHSQSEKVGESEKESKPNEPNHPHSGKAEEPAKDVHI 468

Query: 220 KKSQD--ALKQAIRPVASNIN 276
           +  +D    K+  + VA  +N
Sbjct: 469 QDKEDNQTSKEPEKSVAEKVN 489

>NDAI0G03560 Chr7 complement(855635..857566) [1932 bp, 643 aa] {ON}
           Anc_8.121 YPR018W
          Length = 643

 Score = 31.6 bits (70), Expect = 7.3
 Identities = 40/177 (22%), Positives = 72/177 (40%), Gaps = 16/177 (9%)
 Frame = +1

Query: 82  KELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDALKQAIRPV 261
           KEL+  ER+K    E+LKR+Q  ++ E    E ++  +   K+   +   +A KQ     
Sbjct: 188 KELKKQEREKIRADEKLKREQKLQE-EKRKKEELKQKREEEKRKRDEAKLEAKKQKELEK 246

Query: 262 ASNINESMLSQQSQESPSNTTTYFMQKFQDAKR--NEDKQIAKYEGMMNARVHTFGTDNK 435
                E +  Q+++         F +K  D+ R  +E     K+     AR      +N 
Sbjct: 247 QQREQEKLKKQEAEAKAQLRIGNFFKKVNDSNRTISEKSDYEKHFLPFYARDGVEVCNNY 306

Query: 436 EYKPIITNELES------------FSNL--WVKKRYIPEEDLKRALHEIKILRLNKL 564
           +  P +  + +S            F N+  W++ +YI      R  +E+K   +N L
Sbjct: 307 KLSPKLLEKSKSSLDSSLKNKDADFENIDSWLRSKYI------RRGYEVKCSAINVL 357

>Kwal_26.9468 s26 complement(1230777..1232780) [2004 bp, 667 aa] {ON}
            YGR276C (RNH70) - ribonuclease H [contig 73] FULL
          Length = 667

 Score = 31.6 bits (70), Expect = 7.3
 Identities = 35/140 (25%), Positives = 58/140 (41%), Gaps = 6/140 (4%)
 Frame = +1

Query: 1144 RKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRE 1323
            R  L E+EE   R  ++   + S     DE   N     N   KRR+    ++S+AL   
Sbjct: 53   RLSLCEDEESRARIRNSLQRTESDDIIVDETSSNAQKAGN---KRRR----RRSSALGGP 105

Query: 1324 LGKIMRRKDSSGLEDKSEGEKQKMKQTTESAL----QTGLIQRLGFDPTHGKISKVLKSS 1491
                +++       + S    +K K++T  AL    Q  L +R+        +  +L+ S
Sbjct: 106  AVGKLKKTPEDLPSNLSIAVPKKKKKSTHPALLTVGQKALQKRISMKDIRDVVLYILQDS 165

Query: 1492 --VPGGESMPNRINGKKTVI 1545
               PG   + NR + KK V+
Sbjct: 166  NNAPGWIQVENRASIKKVVV 185

>SAKL0C09746g Chr3 (880534..882699) [2166 bp, 721 aa] {ON} weakly
           similar to uniprot|Q03388 Saccharomyces cerevisiae
           YDR485C VPS72 Protein of unknown function component of
           the Swr1p complex that incorporates Htz1p into chromatin
           required for vacuolar protein sorting
          Length = 721

 Score = 31.6 bits (70), Expect = 7.4
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 6/72 (8%)
 Frame = +1

Query: 52  SDEEDEQAIAKELEFMERKKQALMERLK------RKQDFKKPEDPNFEAVEVPQSPAKKS 213
           +DE+DE+    ELE  ERK++ L  R K      R +  +KP+ P +E       P+ +S
Sbjct: 88  ADEDDEE---HELERQERKRRKLASRKKIPVIRRRAEKEEKPKKPQYE------QPSAES 138

Query: 214 IVKKSQDALKQA 249
           ++ +S+   K++
Sbjct: 139 LLLRSRRTSKRS 150

>TPHA0J01440 Chr10 (334822..337212) [2391 bp, 796 aa] {ON} Anc_5.677
            YOR073W
          Length = 796

 Score = 31.6 bits (70), Expect = 7.5
 Identities = 49/204 (24%), Positives = 86/204 (42%), Gaps = 22/204 (10%)
 Frame = +1

Query: 1153 LSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGK 1332
            ++EEE++ K+N+ N  N NS       KF N +  A L  KRRK    ++S   + E   
Sbjct: 242  ITEEEKKNKKNNDN-NNDNSNDDSNINKFINNENTATLPKKRRK-SSRRESFVFTDEQEF 299

Query: 1333 IMRRKDSSGLE-----DKSEGEKQKMKQTTESALQTGLIQRLGFDP--THGKISKVLKSS 1491
            +     ++ LE     + S  E ++++     +L+  +I+++  +P  T+  I+  L SS
Sbjct: 300  LDAADHNNNLENNNIIEDSIKEIRQIEFENNKSLKGCVIEKINEEPELTNTTITHDLISS 359

Query: 1492 VPGGESMPNRINGKK-----TVINDLLQY----------KKEKVILAPSKNEWFKKRSHR 1626
                ES+   I+        T  N +++Y          +    I A SK E   K S  
Sbjct: 360  --ESESIEQEIDNNPPENSFTFTNSIIEYSIPEEATSGQESNSNIFANSKEESASKNSSA 417

Query: 1627 EEVWQRHFGSKETEVASDASGSDL 1698
                +    +  TE     + +DL
Sbjct: 418  SSSQKLQIFNDSTEDNKSENINDL 441

>NDAI0G02390 Chr7 complement(547355..550252) [2898 bp, 965 aa] {ON}
            Anc_8.359 YLR148W
          Length = 965

 Score = 31.6 bits (70), Expect = 7.7
 Identities = 19/63 (30%), Positives = 31/63 (49%)
 Frame = +1

Query: 1081 DSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLA 1260
            DS  S+      N+  ++ S  +G  +  + VK     F N +  + FF EKF++PD + 
Sbjct: 173  DSSSSIDGILYHNEKLLIASGNQGTIKIWKNVK-----FMNQHDMETFFKEKFKSPDEME 227

Query: 1261 NLD 1269
            N D
Sbjct: 228  NFD 230

>YNL215W Chr14 (244468..245430) [963 bp, 320 aa] {ON}  IES2Protein
            that associates with the INO80 chromatin remodeling
            complex under low-salt conditions; essential for growth
            under anaerobic conditions
          Length = 320

 Score = 31.2 bits (69), Expect = 7.8
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = +1

Query: 1474 KVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFG 1653
            +  + SVP G     RI  K+  +     Y +E+ +L+PSK    K+  H   + +R   
Sbjct: 45   RTARRSVPKGVRTSKRIRDKELSVEVDEDYDEEEDVLSPSK----KRHLHTRSMDKRQVA 100

Query: 1654 SKETEVA--SDASGSDLEI 1704
            +  +E +   D+ G+D EI
Sbjct: 101  ATASEKSDIGDSKGNDGEI 119

>Suva_15.354 Chr15 (611006..614695) [3690 bp, 1229 aa] {ON} YHR155W
           (REAL)
          Length = 1229

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 31/142 (21%), Positives = 55/142 (38%), Gaps = 10/142 (7%)
 Frame = +1

Query: 118 LMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDALKQA----------IRPVAS 267
           L E LK   D+ +     FEA+    S AK++I+K +   LK +          I+ +  
Sbjct: 235 LTETLKEWSDWIENNLQTFEALSSKSSEAKRAILKLTLARLKPSRLLQDYDLNVIQNLKF 294

Query: 268 NINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNKEYKP 447
           N  +S   +   E    +   +M+       +  K++           + FGT +     
Sbjct: 295 NSPKSASDKAIHEQKGISGWLYMRT---TVGHNPKRVVWVRRWCFLHNNVFGTFSLSPNK 351

Query: 448 IITNELESFSNLWVKKRYIPEE 513
               E + F  LW+   Y+P+E
Sbjct: 352 TFVEETDKFGILWITVEYLPKE 373

>ZYRO0A08888g Chr1 complement(707590..711390) [3801 bp, 1266 aa] {ON}
            similar to uniprot|Q04217 Saccharomyces cerevisiae
            YMR128W ECM16 Essential DEAH-box ATP-dependent RNA
            helicase specific to the U3 snoRNP predominantly
            nucleolar in distribution required for 18S rRNA synthesis
          Length = 1266

 Score = 31.6 bits (70), Expect = 7.9
 Identities = 27/107 (25%), Positives = 45/107 (42%), Gaps = 11/107 (10%)
 Frame = +1

Query: 1345 KDSSGLEDKSEGEKQKMKQTT-----------ESALQTGLIQRLGFDPTHGKISKVLKSS 1491
            +D+   E+  E  K+     T           E AL+   +Q L F P   K+S++ +  
Sbjct: 39   EDAEDAEEVPEASKESQGPDTNAEILPPMSQEEKALKKRKLQEL-FTPKETKVSRLKRKR 97

Query: 1492 VPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREE 1632
            +        R   KK ++N L  YK +  +L  SK     K++ +EE
Sbjct: 98   LDKFIEHQLRKEEKKDIMNKLQDYKIDTSLLTSSKKLGHGKQTKKEE 144

>NCAS0G02720 Chr7 (487110..491003) [3894 bp, 1297 aa] {ON} Anc_2.199
           YNL091W
          Length = 1297

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 21/90 (23%), Positives = 41/90 (45%)
 Frame = +1

Query: 106 KKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDALKQAIRPVASNINESM 285
           +KQA + RLK  ++ +  +    E  E  Q   +K   KK Q  L +        + +  
Sbjct: 643 EKQADVNRLKLLKELEDEKLRQKEREEKKQKKKEKEKEKKRQQQLAKEEEKKRKELEQER 702

Query: 286 LSQQSQESPSNTTTYFMQKFQDAKRNEDKQ 375
           L ++S++          +K ++AKR +D++
Sbjct: 703 LRKESEQRELERREAQRKKVEEAKRKKDEE 732

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 48/207 (23%), Positives = 88/207 (42%), Gaps = 8/207 (3%)
 Frame = +1

Query: 1105 AKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRK 1284
            A+ EN F I   T + ++ E +R++           AK   D    N  +  NL  ++ K
Sbjct: 846  AERENNFKIAHDTLQEMNNELKRLQDKEPEI-ELEIAKLLMDVDSLNDQL--NLKEQQLK 902

Query: 1285 IIDTKKSTALSR-------ELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRL 1443
             ++   +  +++       E      R +   LED+S+ +K+K+    E  ++ G     
Sbjct: 903  ELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIG----- 957

Query: 1444 GFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSH 1623
                  GK  ++  S V    S+  RI     ++N   ++KK+K  +         KR+ 
Sbjct: 958  ------GKELQIQNSKV---SSLTERIG----IVN--AKHKKDKATI---------KRTE 993

Query: 1624 RE-EVWQRHFGSKETEVASDASGSDLE 1701
            +E +  QR F  K+ E+ + A  +DLE
Sbjct: 994  KELQKVQRLF--KQAELDNTACVNDLE 1018

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 32/147 (21%), Positives = 61/147 (41%), Gaps = 7/147 (4%)
 Frame = +1

Query: 85   ELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDAL-------K 243
            E+E+ E + + L+ +LK KQ+    E  N + ++V     K   +KK   +L       K
Sbjct: 912  EIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADD--KLQALKKEYYSLNDQTKVTK 969

Query: 244  QAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFG 423
            Q I  +   I ++   +   ++   T+     K  ++K+  DK   K    +  ++    
Sbjct: 970  QEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKKNNNILKKLQNEL 1029

Query: 424  TDNKEYKPIITNELESFSNLWVKKRYI 504
               K+      N LE  +NL   K+ +
Sbjct: 1030 NTTKD------NSLEFKTNLENSKKKV 1050

>TPHA0G00490 Chr7 (93383..98659) [5277 bp, 1758 aa] {ON} Anc_8.753
           YOR290C
          Length = 1758

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 24/121 (19%), Positives = 56/121 (46%)
 Frame = +1

Query: 70  QAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDALKQA 249
           + +  +   +E  + A+   +K + DF+K      + ++V     K+  + +SQ   ++ 
Sbjct: 214 KCLVNKQPILETYQVAINNSIKNQPDFRKLLKSLSDHLKV--KTIKQQSLSQSQTEGQEQ 271

Query: 250 IRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTD 429
           ++ + S   ++ +SQQ+ ++PSN   Y       A  ++ + ++K  G      +  G D
Sbjct: 272 LQ-IQSKAQQNQVSQQNLQTPSNIPAY------QAPPHQQENVSKPAGKRAQNTNNGGVD 324

Query: 430 N 432
           N
Sbjct: 325 N 325

>Smik_11.346 Chr11 complement(586369..586770) [402 bp, 133 aa] {ON}
            YKR083C (REAL)
          Length = 133

 Score = 30.0 bits (66), Expect = 8.2
 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 7/88 (7%)
 Frame = +1

Query: 1465 KISKVLKSSVPGGESMPNRINGKKTVIND-------LLQYKKEKVILAPSKNEWFKKRSH 1623
            +++K +K      ES+   +N   ++IN+       LLQY +    + P K+    KRS 
Sbjct: 34   ELNKRVKEMGTNAESVAELMNNWDSIINNISQASLGLLQYAEGDYEIGPWKDF---KRSE 90

Query: 1624 REEVWQRHFGSKETEVASDASGSDLEIV 1707
             E   +   G++ T+  S+++G D ++V
Sbjct: 91   PEPSGETDPGTQRTDKNSESNGDDEDLV 118

>SAKL0H09570g Chr8 (813906..820970) [7065 bp, 2354 aa] {ON} weakly
            similar to uniprot|P48415 Saccharomyces cerevisiae
            YPL085W SEC16 COPII vesicle coat protein required for ER
            transport vesicle budding and autophagosome formation
            Sec16p is bound to the periphery of ER membranes and may
            act to stabilize initial COPII complexes interacts with
            Sec23p Sec24p and Sec31p
          Length = 2354

 Score = 31.6 bits (70), Expect = 8.3
 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 3/46 (6%)
 Frame = +1

Query: 28   VDPYNNVT---SDEEDEQAIAKELEFMERKKQALMERLKRKQDFKK 156
            V+ Y++V    SDEE+E+   K+ E  E KK+   E  KRKQ+ KK
Sbjct: 2125 VEYYDDVVEDESDEENEEEQEKKREEEEEKKRKEEETKKRKQEEKK 2170

>TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.349
           YDR318W
          Length = 373

 Score = 31.2 bits (69), Expect = 8.3
 Identities = 24/114 (21%), Positives = 49/114 (42%)
 Frame = +1

Query: 61  EDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDAL 240
           +D  A+ KELE++  KK+AL   +       K E+P  +   V  +         S++ +
Sbjct: 9   QDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLFELLSKEKI 68

Query: 241 KQAIRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMN 402
           K++           ML +  ++    T     ++ Q    N+D  + ++E ++N
Sbjct: 69  KRS----------EMLGKHHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILN 112

>TDEL0H01210 Chr8 complement(208056..209342) [1287 bp, 428 aa] {ON}
           Anc_1.239 YKR044W
          Length = 428

 Score = 31.2 bits (69), Expect = 8.7
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)
 Frame = +1

Query: 16  EILAVDPYNNVTSDEED-EQAIAKELE--FMER--KKQALMERLKRKQDFKKPEDPNFEA 180
           +IL+V+       D++D     AKE+E  F++   +K AL E  +++    K + P +E 
Sbjct: 308 DILSVETNEFHLKDKDDTSNDFAKEIELYFIQEYNEKIALEEDSEQRWKMSKSQ-PRYEV 366

Query: 181 VEVPQSPAKKSIVKKSQ 231
            E+ + PAKK +  KSQ
Sbjct: 367 NEINEMPAKKQVHGKSQ 383

>NCAS0C05190 Chr3 complement(1056868..1058202) [1335 bp, 444 aa] {ON}
            Anc_2.636 YKL082C
          Length = 444

 Score = 31.2 bits (69), Expect = 8.8
 Identities = 33/131 (25%), Positives = 57/131 (43%), Gaps = 10/131 (7%)
 Frame = +1

Query: 1039 ELNGGYALGAPTKVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAK 1218
            ELNG  AL    K +         GE +F   +  +K  +E+EE ++          S K
Sbjct: 68   ELNGS-ALDVMKKREVNAVPVVLPGE-KFKKFQQQKKNAAEKEEELEEEDEE---EESIK 122

Query: 1219 AFFDEKFQN---PDMLANLDSKRRKI-------IDTKKSTALSRELGKIMRRKDSSGLED 1368
              FD++       D ++N + +  +        ++TK+ T L  E  KI ++K    L +
Sbjct: 123  VVFDDEGNEMPISDEISNAEEEDEEESSVDEPKLETKEKTNLEDEQEKIEKQKKLDALRE 182

Query: 1369 KSEGEKQKMKQ 1401
            K + + Q +KQ
Sbjct: 183  KLQQKIQTLKQ 193

>NCAS0H01090 Chr8 complement(205335..206717) [1383 bp, 460 aa] {ON}
            Anc_6.173 YPL181W
          Length = 460

 Score = 31.2 bits (69), Expect = 8.9
 Identities = 38/129 (29%), Positives = 51/129 (39%), Gaps = 7/129 (5%)
 Frame = +1

Query: 1330 KIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSS--VPGG 1503
            KI+ ++ +S    K E EKQ  K++   +  T  I  L   PTH   SK  KSS     G
Sbjct: 288  KIIGKESNS----KEEEEKQSSKESISPSASTTTISSLEEKPTH-TFSKPRKSSRITKPG 342

Query: 1504 ESMPNRINGKKT-----VINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETE 1668
               P R N  KT       ND+   K  K  L P +    + R  R           + E
Sbjct: 343  RRGPYRNNRNKTANDNKTQNDIDITKPVKPRLPPQRTSLNEMR-RRVAAILEFISRTQWE 401

Query: 1669 VASDASGSD 1695
            ++ D  G D
Sbjct: 402  LSQDQKGRD 410

>Skud_14.208 Chr14 (383074..384528) [1455 bp, 484 aa] {ON} YNL124W
           (REAL)
          Length = 484

 Score = 31.2 bits (69), Expect = 9.0
 Identities = 31/136 (22%), Positives = 56/136 (41%), Gaps = 27/136 (19%)
 Frame = +1

Query: 13  REILAVDPYNNVTSD-EEDEQAIA---KELEFMERKKQALMERLKRKQDFKKPEDPNFEA 180
           R I   D  N    +  E+EQ  +   KE  F + KKQ   ++ K++ + K+P D +   
Sbjct: 220 RRIKGTDASNGYDEELPEEEQEFSDDEKEALFKKMKKQQQQQQRKKRDNRKQPNDSDNVK 279

Query: 181 VEVPQSPAKKSIVK-----------------KSQDALKQAIRPVASNINES------MLS 291
            + P+ P   ++ K                 KS++A +   R   +  +++      M  
Sbjct: 280 SKKPRQPKPANLPKLVPPVGMSSNASLQRGYKSRNARENTKRETGTVFDQNRSLQIPMGQ 339

Query: 292 QQSQESPSNTTTYFMQ 339
           QQ  + P+N   Y +Q
Sbjct: 340 QQQPQFPANNYPYQLQ 355

>Kwal_14.1428 s14 (319817..321427) [1611 bp, 536 aa] {ON} YGR041W
           (BUD9) - involved in bud-site selection [contig 242]
           FULL
          Length = 536

 Score = 31.2 bits (69), Expect = 9.2
 Identities = 25/110 (22%), Positives = 54/110 (49%), Gaps = 2/110 (1%)
 Frame = +1

Query: 4   DDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAV 183
           D  R  +  +P+ N   ++  E++     E+    K ++ + +K  +  +    P+ + V
Sbjct: 218 DGERSPILTEPHRNQLHNKIAEESEGDTSEYENHSKPSIEQAVKLFKQ-EASTQPSAKLV 276

Query: 184 E-VPQSPAKKSIV-KKSQDALKQAIRPVASNINESMLSQQSQESPSNTTT 327
           E V  +P  +S+  KKSQ +LK  +    S  +++  S++  ++PS  T+
Sbjct: 277 EQVFPAPNSRSVAPKKSQGSLKSHLSSQNSRYSQTRRSRRGPKNPSLLTS 326

>TPHA0E02790 Chr5 complement(583642..585318) [1677 bp, 558 aa] {ON}
           Anc_6.226 YGL063W
          Length = 558

 Score = 31.2 bits (69), Expect = 9.3
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 4/60 (6%)
 Frame = +1

Query: 46  VTSDEEDEQAIAKELEFMERKKQALMERLKRKQD----FKKPEDPNFEAVEVPQSPAKKS 213
           V S+EE ++   +   F +R+ +A  +  K  Q     F+K E  +   VE  +SPAKKS
Sbjct: 492 VLSNEEIDKIAKQNTNFQKREAKANKKDKKNNQSNNKKFQKQEKKDEAKVETKESPAKKS 551

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score = 31.2 bits (69), Expect = 9.6
 Identities = 31/112 (27%), Positives = 45/112 (40%), Gaps = 10/112 (8%)
 Frame = +1

Query: 13  REILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQD-FKKPEDPNFEAVEV 189
           REI ++ P N V   E  E  + K +E +E +       L+R  D FK+ E  +      
Sbjct: 37  REINSIAPENEV---EYFENTMEKTMENLEYEGDRKASHLRRFIDSFKRAEGSH------ 87

Query: 190 PQSPAKKSIV---------KKSQDALKQAIRPVASNINESMLSQQSQESPSN 318
           P SP   + +           S   L   + P  S + ES + Q SQE   N
Sbjct: 88  PNSPDSSNSIGGGATPISTNDSSSQLDNELNPKGSFVTESGIKQPSQEQDQN 139

>KLLA0F12892g Chr6 complement(1187526..1189853) [2328 bp, 775 aa]
           {ON} highly similar to uniprot|P54861 Saccharomyces
           cerevisiae YLL001W DNM1 Dynamin-related GTPase required
           for mitochondrial fission and the maintenance of
           mitochondrial morphology assembles on the cytoplasmic
           face of mitochondrial tubules at sites at which division
           will occur also participates in endocytosis
          Length = 775

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 25/112 (22%), Positives = 52/112 (46%)
 Frame = +1

Query: 70  QAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDALKQA 249
           +A+A+ +E  + KKQ   ERL+++++++K      E  +  +   K   V +++  LK  
Sbjct: 545 EAMAEIVEARKNKKQT--ERLQKQREYEK--QLLLEQQQAEREMKKSDSVDETEQDLKLD 600

Query: 250 IRPVASNINESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNA 405
               A++ ++S      ++S  +   YF  K Q +   +      Y G  N+
Sbjct: 601 SDSTATSEHDSEEENDMKQSKDSFLNYFFGKEQKSSNTKLSSRIDYNGSDNS 652

>TPHA0G01240 Chr7 (252228..252683) [456 bp, 151 aa] {ON} Anc_8.770
            YOR298C-A
          Length = 151

 Score = 30.0 bits (66), Expect = 9.9
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 2/94 (2%)
 Frame = +1

Query: 1276 RRKIIDTKKSTALSRELGKIMR-RKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFD 1452
            R  +  T+     +R  G ++   K   G   K   E Q++   T+   +T +++    D
Sbjct: 22   RANVARTQGQINAARRQGLVLSVDKKYGGSNAKGNNEGQRL---TKIDRETDIVKLQKLD 78

Query: 1453 PTHGK-ISKVLKSSVPGGESMPNRINGKKTVIND 1551
            P  G+ ISK         + +  +IN K TVIND
Sbjct: 79   PAVGRAISKARTEKKMSQKDLATKINEKPTVIND 112

>KAFR0A02280 Chr1 complement(473811..476303) [2493 bp, 830 aa] {ON}
           Anc_2.590 YKL050C
          Length = 830

 Score = 31.2 bits (69), Expect = 10.0
 Identities = 39/155 (25%), Positives = 62/155 (40%), Gaps = 21/155 (13%)
 Frame = +1

Query: 271 INESMLSQQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNKEY--- 441
           ++E +L+++ ++          Q    A+ N DK+I   E   N     FG  N+EY   
Sbjct: 283 VDEELLTKEQEKKIYLKQLTSQQVLARARANVDKEIQALEEQ-NYEQRLFG--NEEYNRA 339

Query: 442 -----KPIITNELESFSN-------LWVKKRYIPE---EDLKRALHEIKILRLNKLFAKI 576
                K   TN    +SN       LW+K   I +   + L   L+EI     ++  A I
Sbjct: 340 AVAVAKANYTNNKSQYSNMINLGGGLWLKPEEIEKISHDMLNPVLNEINKKADDQRAADI 399

Query: 577 R---PPKFQEPDYANWATVGLISHKSDIKFTSSEK 672
                 KF   D +NW  +     K+D ++T   K
Sbjct: 400 EIAEKTKFYSQDLSNWNRLNSEKVKNDEQYTVDAK 434

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 162,846,760
Number of extensions: 3784446
Number of successful extensions: 14002
Number of sequences better than 10.0: 145
Number of HSP's gapped: 13839
Number of HSP's successfully gapped: 150
Length of query: 570
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 455
Effective length of database: 40,294,809
Effective search space: 18334138095
Effective search space used: 18334138095
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 35 (18.1 bits)