Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.375.706ON1117111759320.0
YIL151C5.706ON1118111852070.0
Skud_9.175.706ON1118111851900.0
Smik_9.185.706ON1118111850780.0
TDEL0B021405.706ON1147119126810.0
ZYRO0B16412g5.706ON137298426570.0
KAFR0H001805.706ON124197925320.0
KNAG0C066305.706ON1281102225010.0
Smik_11.3605.706ON118095324820.0
CAGL0G02541g5.706ON129594624790.0
Skud_11.3365.706ON118895924720.0
Suva_11.3335.706ON118795824460.0
SAKL0E15004g5.706ON1196119224210.0
NCAS0A031705.706ON1319103024030.0
YKR096W5.706ON119594323950.0
Kpol_1043.735.706ON126097423880.0
CAGL0H06611g5.706ON1282126023080.0
KLTH0E00968g5.706ON114896522640.0
TPHA0E001905.706ON136199422790.0
Kwal_55.196785.706ON117896222500.0
AFR290W5.706ON121797922320.0
Ecym_40155.706ON125797222180.0
KLLA0A00528g5.706ON122997321430.0
NDAI0E050705.706ON155638011921e-140
TBLA0E017105.706ON152640910521e-121
TPHA0D046405.706ON9629313661e-34
NCAS0H012606.152ON540159910.047
Kpol_1025.243.409ON20632715.5
TPHA0F026206.70ON918120728.7
YOR326W (MYO2)7.68ON1574123728.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.37
         (1117 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...  2289   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...  2010   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...  2003   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...  1960   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1037   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1028   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...   979   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   967   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   960   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   959   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   956   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   946   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...   937   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   930   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   927   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   924   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   893   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   876   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   882   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   871   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   864   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   858   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   830   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   463   e-140
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   409   e-121
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   145   1e-34
NCAS0H01260 Chr8 (238877..240499) [1623 bp, 540 aa] {ON} Anc_6.152     40   0.047
Kpol_1025.24 s1025 (57304..57924) [621 bp, 206 aa] {ON} (57304.....    32   5.5  
TPHA0F02620 Chr6 complement(577529..580285) [2757 bp, 918 aa] {O...    32   8.7  
YOR326W Chr15 (925721..930445) [4725 bp, 1574 aa] {ON}  MYO2One ...    32   8.8  

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score = 2289 bits (5932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1103/1117 (98%), Positives = 1103/1117 (98%)

Query: 1    MVDIMAQVNDDPSNETDYSRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPESSFAK 60
            MVDIMAQVNDDPSNETDYSRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPESSFAK
Sbjct: 1    MVDIMAQVNDDPSNETDYSRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPESSFAK 60

Query: 61   RRVPGVVEPVGKGFIDGITTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSSNSAM 120
            RRVPGVVEPVGKGFIDGITTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSSNSAM
Sbjct: 61   RRVPGVVEPVGKGFIDGITTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSSNSAM 120

Query: 121  DIPKSPYYVNRTAITRNMEVVSKESHDENGPQTRADDSLTTSTGIYANSQPQSQITLSDT 180
            DIPKSPYYVNRTAITRNMEVVSKESHDENGPQTRADDSLTTSTGIYANSQPQSQITLSDT
Sbjct: 121  DIPKSPYYVNRTAITRNMEVVSKESHDENGPQTRADDSLTTSTGIYANSQPQSQITLSDT 180

Query: 181  RAAPIVANSLPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELK 240
            RAAPIVANSLPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELK
Sbjct: 181  RAAPIVANSLPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELK 240

Query: 241  SLWAIYKLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDV 300
            SLWAIYKLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDV
Sbjct: 241  SLWAIYKLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDV 300

Query: 301  LKSFSNFMDPEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFID 360
            LKSFSNFMDPEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFID
Sbjct: 301  LKSFSNFMDPEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFID 360

Query: 361  WRLSAEYWYTESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLL 420
            WRLSAEYWYTESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLL
Sbjct: 361  WRLSAEYWYTESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLL 420

Query: 421  IENIYQSAFIDRSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKD 480
            IENIYQSAFIDRSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKD
Sbjct: 421  IENIYQSAFIDRSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKD 480

Query: 481  KFGKDFNGNDVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLP 540
            KFGKDFNGNDVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLP
Sbjct: 481  KFGKDFNGNDVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLP 540

Query: 541  XXXXXXXXXXXXXXSGAAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDS 600
                          SGAAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDS
Sbjct: 541  KHLKFKKDKREKKKSGAAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDS 600

Query: 601  LNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHF 660
            LNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHF
Sbjct: 601  LNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHF 660

Query: 661  LRRTMPWNSMVTFSNVLVCYMLDNLHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKC 720
            LRRTMPWNSMVTFSNVLVCYMLDNLHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKC
Sbjct: 661  LRRTMPWNSMVTFSNVLVCYMLDNLHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKC 720

Query: 721  WGSLWFDAVKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIA 780
            WGSLWFDAVKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIA
Sbjct: 721  WGSLWFDAVKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIA 780

Query: 781  KKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEIN 840
            KKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEIN
Sbjct: 781  KKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEIN 840

Query: 841  ELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVGN 900
            ELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVGN
Sbjct: 841  ELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVGN 900

Query: 901  GVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLRHFA 960
            GVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLRHFA
Sbjct: 901  GVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLRHFA 960

Query: 961  HIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRFT 1020
            HIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRFT
Sbjct: 961  HIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRFT 1020

Query: 1021 GNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFAVLVTD 1080
            GNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFAVLVTD
Sbjct: 1021 GNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFAVLVTD 1080

Query: 1081 DDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117
            DDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN
Sbjct: 1081 DDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score = 2010 bits (5207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/1118 (84%), Positives = 1018/1118 (91%), Gaps = 1/1118 (0%)

Query: 1    MVDIMAQVNDDPSNETDYSRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPESSFAK 60
            MVD+M   NDDPSNETDYSRS+NN T +V+DMRPT+AAFLHQKRHSSSSHNDTPESSFAK
Sbjct: 1    MVDLMVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAK 60

Query: 61   RRVPGVVEPVGKGFIDGITTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSSNSAM 120
            RRVPG+V+PVGKGFIDGIT SQIS QN P K +D SRRPSISRK ME+TPQ+ TSS   M
Sbjct: 61   RRVPGIVDPVGKGFIDGITNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTM 120

Query: 121  DIPKSPYYVNRTAITRNMEVVSKESHDENG-PQTRADDSLTTSTGIYANSQPQSQITLSD 179
            D+PKSPYYVNRT + RNM+VVS++++++N  PQ RAD+ L  S GIY+NSQPQSQ+TLSD
Sbjct: 121  DVPKSPYYVNRTMLARNMKVVSRDTYEDNANPQMRADEPLVASNGIYSNSQPQSQVTLSD 180

Query: 180  TRAAPIVANSLPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 239
             R AP+VA S P + RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL
Sbjct: 181  IRRAPVVAASPPPMIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240

Query: 240  KSLWAIYKLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 299
            KSLWAIY+LNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD
Sbjct: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300

Query: 300  VLKSFSNFMDPEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 359
            VLK+FSNFMDPEVCCQFI YAFI +SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360

Query: 360  DWRLSAEYWYTESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 419
            DWRLSAEYWYTESMKYIYGCGKLYYHIAT+QQNSLEAFVNLGKSVFCQDPFTPSQQTLQL
Sbjct: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420

Query: 420  LIENIYQSAFIDRSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFK 479
            LIENIYQSAFIDRSSG+ NNNE AHRNSQLIDYLKHTEVMLLPSFLEN+DLQHVVL+YFK
Sbjct: 421  LIENIYQSAFIDRSSGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480

Query: 480  DKFGKDFNGNDVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQL 539
            DKFGKDFNGNDVF TKDMFCQNPESLRYYFRHAPAFAESQ+LQLIGFGNPKNPFALLFQL
Sbjct: 481  DKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540

Query: 540  PXXXXXXXXXXXXXXSGAAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLD 599
            P              S A E   Y DPFD Q SSESYFQNID LNS FND PTN+ IWLD
Sbjct: 541  PKYLKLKKDKREKKRSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLD 600

Query: 600  SLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIH 659
            SLN+INMTSIQCSI VLTKFLHAPL VALPHFL WLHFI+A+LKKLE +NS+QV AFWIH
Sbjct: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIH 660

Query: 660  FLRRTMPWNSMVTFSNVLVCYMLDNLHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWK 719
            FLRRTMPWNS+VT  NVLVCYMLDNLHPFL+K+LEKFYSLELDDLIEY+NENENLPE+WK
Sbjct: 661  FLRRTMPWNSIVTLGNVLVCYMLDNLHPFLKKELEKFYSLELDDLIEYYNENENLPEIWK 720

Query: 720  CWGSLWFDAVKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGI 779
            CWG+LWFDA+KKCDVMEIPGVQDHLFFDSPLDGIVFD+KDE+GEKFW+RSVR +L LKGI
Sbjct: 721  CWGTLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGI 780

Query: 780  AKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEI 839
            AKKFPDLGLKV+FQASVFCRRNDI PDYFLKNLTFKLD Y+ED +NDNNELD+LYDTIEI
Sbjct: 781  AKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDTIEI 840

Query: 840  NELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVG 899
            NE IE VN+D QATP LSVVSGESIFEYTGYTRL  DYHCFDKNGGFNSAFIY+QWSNVG
Sbjct: 841  NEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 900  NGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLRHF 959
            NGVTLDVS ES+YD   N+LSLHW KI FDK+    K +D++ +C++YFVIDATSWLRHF
Sbjct: 901  NGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATSWLRHF 960

Query: 960  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRF 1019
            AHIFKLAKNN LKFAICLTTFQELRYLRGSKDD VVEAATRSVITIRQLYDEKKIIPMRF
Sbjct: 961  AHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRF 1020

Query: 1020 TGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFAVLVT 1079
            TGNIATH+EENLEFEEQITWKTHVDEFVIDAIAKLNQ FQ ER  D+NK + KEFAVLVT
Sbjct: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEFAVLVT 1080

Query: 1080 DDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117
            DDDNMNQKAKD+MIKTCNTKYLFSLGSKLGINSGLCTN
Sbjct: 1081 DDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score = 2003 bits (5190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 948/1118 (84%), Positives = 1026/1118 (91%), Gaps = 1/1118 (0%)

Query: 1    MVDIMAQVNDDPSNETDYSRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPESSFAK 60
            MVD MA VNDDPSN+TDY R +++  SVVNDMRPTT A LHQKRHSSSSHNDTPESSF K
Sbjct: 1    MVDPMAPVNDDPSNKTDYLRFNDSNASVVNDMRPTTVALLHQKRHSSSSHNDTPESSFVK 60

Query: 61   RRVPGVVEPVGKGFIDGITTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSSNSAM 120
            RRVPGVVEPVGKGFIDGI + Q+S+QN P K +DISRRPSISRKAMETTP+++T+S S +
Sbjct: 61   RRVPGVVEPVGKGFIDGIASGQVSVQNTPSKTDDISRRPSISRKAMETTPKVNTASISTI 120

Query: 121  DIPKSPYYVNRTAITRNMEVVSKESHDENG-PQTRADDSLTTSTGIYANSQPQSQITLSD 179
            D+PKSPYY+N++AITRNMEVVS+ ++ EN   Q R D+S+ TS GIY+NSQPQSQ+TLSD
Sbjct: 121  DVPKSPYYMNKSAITRNMEVVSRGNYAENTTSQMRTDESMATSNGIYSNSQPQSQVTLSD 180

Query: 180  TRAAPIVANSLPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 239
             R AP  A S P VTRQLPSAQPNQTFIKKLQEIY+IIVVQETELQQRCL+LTTSQTTEL
Sbjct: 181  FRTAPAFATSPPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTEL 240

Query: 240  KSLWAIYKLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 299
            KSLWAIY+LNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD
Sbjct: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300

Query: 300  VLKSFSNFMDPEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 359
            VLK+FSNFMDPEVCCQFI YAFI +S+MLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 301  VLKNFSNFMDPEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360

Query: 360  DWRLSAEYWYTESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 419
            DWRLSAEYWYTESMKYIYGCGKLYYHIAT+QQNSLEAFVNLGKSVFCQD FTPSQQTLQL
Sbjct: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQL 420

Query: 420  LIENIYQSAFIDRSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFK 479
            LIENIYQSAFIDRSS  TNNNETAHRNSQLIDYLKHTEVMLLPSFLEN+DLQHVVL+YFK
Sbjct: 421  LIENIYQSAFIDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480

Query: 480  DKFGKDFNGNDVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQL 539
            DKFGKDFNGND+F TKDMFCQNPESLRYYFRHAPAFAESQ+LQLIGFGNPKNPFALLFQL
Sbjct: 481  DKFGKDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540

Query: 540  PXXXXXXXXXXXXXXSGAAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLD 599
            P              SGA E+P YRDPFDDQ SSESYFQNID+L S+F+D PTN+ IWLD
Sbjct: 541  PKYLKLKRHKREKKKSGATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLD 600

Query: 600  SLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIH 659
            SLN+INMTSIQCSI VLTKFLHAPL VALPHFL WLHFI+A+LKKLET+NS+ V+ FWIH
Sbjct: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIH 660

Query: 660  FLRRTMPWNSMVTFSNVLVCYMLDNLHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWK 719
            FLRRTMPWNSMV  +NVLVCYMLDN+HPFLE++LE+FYSLELDDLIEYFNENENLPE+WK
Sbjct: 661  FLRRTMPWNSMVNLANVLVCYMLDNIHPFLERELERFYSLELDDLIEYFNENENLPEIWK 720

Query: 720  CWGSLWFDAVKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGI 779
            CWGSLWFDA+KKCDVMEIPGVQDHLFFDSPLDGIVFD+KDEIGE+FWIRS+RTIL LKG+
Sbjct: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGV 780

Query: 780  AKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEI 839
            AKKFPDLGLKVNFQA VFCRRNDISPDYFLKN TFKLD YEE+  NDNNELDELYDTIEI
Sbjct: 781  AKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELYDTIEI 840

Query: 840  NELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVG 899
            NE IE VN DL+ATP LSVVSGE+IFEYTGYTRLT DYHCFDKNGGFNSAFIY+QWSNVG
Sbjct: 841  NEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 900  NGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLRHF 959
            NG+ LDVSSES+YD+  N+LS HW KI FD++ T G N D +G+CSVYFVIDATSWLRHF
Sbjct: 901  NGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATSWLRHF 960

Query: 960  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRF 1019
            AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIP+RF
Sbjct: 961  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRF 1020

Query: 1020 TGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFAVLVT 1079
            TGNIAT++EENLEFEEQITW+THVDEFVIDAIAKLNQNFQTER IDKNK ++  +AVLVT
Sbjct: 1021 TGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYAVLVT 1080

Query: 1080 DDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117
            DDDNM+ KAKDKMIKTCNTKYLFSLGSK+GINSGLCTN
Sbjct: 1081 DDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score = 1960 bits (5078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1118 (83%), Positives = 1011/1118 (90%), Gaps = 1/1118 (0%)

Query: 1    MVDIMAQVNDDPSNETDYSRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPESSFAK 60
            MVD+M  VNDDPSNETDY RS+NN +  V DMRPTT AFLHQKRHSSSSHNDTPESSFAK
Sbjct: 1    MVDLMVPVNDDPSNETDYPRSNNNYSQTVTDMRPTTTAFLHQKRHSSSSHNDTPESSFAK 60

Query: 61   RRVPGVVEPVGKGFIDGITTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSSNSAM 120
            RRVPGVVEPVGKGFIDG+T  QIS QN P K +D+SRRPSISRK ME+TPQ  T+S S M
Sbjct: 61   RRVPGVVEPVGKGFIDGVTNGQISAQNTPSKVDDVSRRPSISRKVMESTPQAKTASISTM 120

Query: 121  DIPKSPYYVNRTAITRNMEVVSKESHDENG-PQTRADDSLTTSTGIYANSQPQSQITLSD 179
            D+PKSPYYVNRTA+ RNMEVVSKES+DEN  PQ R D+SL  S GIY NSQPQSQ+TL D
Sbjct: 121  DVPKSPYYVNRTAVARNMEVVSKESYDENANPQMRIDESLVASNGIYNNSQPQSQVTLPD 180

Query: 180  TRAAPIVANSLPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 239
             R AP+VA+S P V RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL
Sbjct: 181  IRKAPVVASSPPPVVRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240

Query: 240  KSLWAIYKLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 299
            KSLWAIY+LNTELIKNYINFIITALLTTQPINDLIMGQEILDIY +EKRLWVYGIITFLD
Sbjct: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLD 300

Query: 300  VLKSFSNFMDPEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 359
            VLK+FSNFMDPEVCCQFI YAFI +SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360

Query: 360  DWRLSAEYWYTESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 419
            DWRLSAEYWYTESMKYIYGCGKLYYHIAT+QQNSLEAFVNLGKSVFCQDPFTPSQQTLQL
Sbjct: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420

Query: 420  LIENIYQSAFIDRSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFK 479
            LIENIYQSAFIDR S  TNNNETAH+NSQLIDYLKHTEVMLLPSFLEN+DLQHVVL+YFK
Sbjct: 421  LIENIYQSAFIDRGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480

Query: 480  DKFGKDFNGNDVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQL 539
            +KFGKDFNGNDVF TKDMFCQNPESLRYYFRHAPAFAESQ+LQLIGFGNPKNPFALLFQL
Sbjct: 481  NKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540

Query: 540  PXXXXXXXXXXXXXXSGAAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLD 599
            P              S A E P YRDPF D+ S ESYFQNID L+S+F+D PTN+ IWL+
Sbjct: 541  PKYLKLKKDKREKKRSSATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLE 600

Query: 600  SLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIH 659
            SLN+INMTSIQCSI VLTKFLHAP  +ALPHFL WL+F++A+LK+LETINS+QV AFWIH
Sbjct: 601  SLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIH 660

Query: 660  FLRRTMPWNSMVTFSNVLVCYMLDNLHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWK 719
            FLRRTMPWNSMV+ +NVLVCYMLDNLHPFL+K+LE FYS ELDDLIE+FNENENLPE+WK
Sbjct: 661  FLRRTMPWNSMVSLANVLVCYMLDNLHPFLKKELESFYSFELDDLIEHFNENENLPEIWK 720

Query: 720  CWGSLWFDAVKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGI 779
            CWGSLWFDA+KKCDVMEIPGVQDHLFFDSPLDGIVFD+KDEIGE+FW+RSVR I  LKGI
Sbjct: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGI 780

Query: 780  AKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEI 839
            AKKFPDLGLKVNFQA VFCRRNDI  DYFL+  TFKLD Y+E   NDNNELDELY+TIEI
Sbjct: 781  AKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYETIEI 840

Query: 840  NELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVG 899
            NE I+ VN+DL+ATP LSVV GESIFEYTGYTRL  DYHCFDKNGGFNSAFIY+QWSNVG
Sbjct: 841  NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 900  NGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLRHF 959
            NGV +DVS+E +YD T NDLSLHW KI FD++    KN D++ +C++YFV+DATSWLRHF
Sbjct: 901  NGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATSWLRHF 960

Query: 960  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRF 1019
            AHIFKLAKN+IL FAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDE+KIIPMRF
Sbjct: 961  AHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRF 1020

Query: 1020 TGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFAVLVT 1079
            TGNIATH+EENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTER I +NK ++K+FAVLVT
Sbjct: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQFAVLVT 1080

Query: 1080 DDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117
            DDDNMN+KAKDKMIKTCNTKYLFSLGSKLGINSGLCTN
Sbjct: 1081 DDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1037 bits (2681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/1191 (47%), Positives = 741/1191 (62%), Gaps = 118/1191 (9%)

Query: 1    MVDIMAQVNDDPSNETDY----SRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPES 56
            M++     +D  +  TDY     R    P  +   +    A+   QKRHSS+ +N + ES
Sbjct: 1    MIETFNHTSDRLTKNTDYIEQEKRPMCQPRHLNGPLDEIPASAGRQKRHSSNPYN-SAES 59

Query: 57   SFAKRRVPGVVEPVGKGFIDGITTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTS- 115
            +  KRRV    + + +   +G      ++ N P K    SRRPS +R+ +  TP+  TS 
Sbjct: 60   TGVKRRVANHDDGITQFLDNG------AIPNTPCKEPVSSRRPSATRRTVNRTPRSTTSY 113

Query: 116  -------------SNSAMDIPKSPYYVNRTAIT-----RNMEVVSKESHDENGPQTRADD 157
                         +NS + I      VN + ++     R+   +SKE+H  +  Q     
Sbjct: 114  VADASASPYCYSPNNSNLRIDHLSRMVNSSGVSIPNVCRDPSFLSKEAHIVSDGQDTGTI 173

Query: 158  SLTTSTGIYANSQPQSQITLSDTR-----------------------AAPIVANSLPSVT 194
            S+ +      N Q Q      + R                              ++PSV 
Sbjct: 174  SINSGE---VNDQSQDNSANDEGRDDNNENDSIRNKNSNNDNDNNRENNKDNNGNVPSVV 230

Query: 195  RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIK 254
              +PS + +Q  ++KLQ+IYK+IV QE ELQ+RC  LT SQTTELK LW IYK+N++LI 
Sbjct: 231  --VPSKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLIN 288

Query: 255  NYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCC 314
            NY+ FI TALL  Q   DL +GQEI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEVC 
Sbjct: 289  NYVTFITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCA 348

Query: 315  QFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMK 374
            QFIT+ FI ISNML DIP +Y+I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK
Sbjct: 349  QFITHVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMK 408

Query: 375  YIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSS 434
            YIYG GKLYYH++T+QQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ AF++R++
Sbjct: 409  YIYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNN 468

Query: 435  GNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFST 494
            GN       HRNSQLI+YLKH+EVMLLPSFLE+ DLQ VVL+YF+DKFG D N N++F T
Sbjct: 469  GN-------HRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDT 521

Query: 495  KDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLP-----------XXX 543
            + MF QNP+ L+Y+FRHAPAFAES ILQL+GFG+PKNPFALLF+LP              
Sbjct: 522  RQMFDQNPDQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRK 581

Query: 544  XXXXXXXXXXXSGAAEIPHYRD-PFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLN 602
                       + A +   Y D  F      + +F NID+L S +  PP+ + +W  SL 
Sbjct: 582  TKSSVTTETSSAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPS-LEVWNCSLK 640

Query: 603  YINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLR 662
            Y+N+TS+ CS+ VL KFL  P+ VALPH L W +FIIAV+ K++ I       FW+  + 
Sbjct: 641  YLNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVN 700

Query: 663  RTMPWNSMVTFSNVLVCYMLDNLHPFL--EKQLEKFYSLELDDLIEYFNENENLPEVWKC 720
            R  PWN++V F NVL+ Y LDN+HP L  +   E+  ++ LD L+E+FN NE+LPEVWKC
Sbjct: 701  RIFPWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKC 760

Query: 721  WGSLWFDAV-----KKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILT 775
            WG LWFDA+      + D  E  G++DH+F D P+DGI FD+ DE G KFW R+ R I  
Sbjct: 761  WGLLWFDAICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFL 820

Query: 776  LKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYD 835
             K IA+ F    L V+ QA V CRR D   ++ LK+  FKL     D F ++N +  L +
Sbjct: 821  FKRIAENF-QTRLVVSSQAQVHCRRTD-PMNHVLKSFCFKL----RDTFYNSNSV--LQN 872

Query: 836  TIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW 895
            TIE+ E     N D+Q TP+LSV+  ESIF Y GY RL  D  C+D+ G F S  +YT W
Sbjct: 873  TIEVFEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSW 932

Query: 896  SNVGNGVTLDVSSESLYDSTTNDL---------SLHWAKILFDKVFTIGKNTDDDGSCSV 946
             N  +   +   SE     T N+          SL    I F +    GK+T        
Sbjct: 933  GNETSKNEIP-QSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDT-------- 983

Query: 947  YFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIR 1006
            +FV+DATSWLRHFAH++KLA N +L+FAICLTTFQELR+LR SKD+NVVEAATR+VIT+R
Sbjct: 984  FFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVR 1043

Query: 1007 QLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDK 1066
            QLY E +I+P+RFTGN+ATHIEE+LEFEEQITW++HVDEFV +AI K       E     
Sbjct: 1044 QLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQE----- 1098

Query: 1067 NKGRSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117
               R     VLVTDD NM +KA+   I T +T+++F+  + +G    +CTN
Sbjct: 1099 --NRDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1028 bits (2657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/984 (52%), Positives = 681/984 (69%), Gaps = 68/984 (6%)

Query: 189  SLPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKL 248
            ++PSV   +PS + +Q  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTTELK+LW IYK+
Sbjct: 402  AVPSVV--VPSKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKI 459

Query: 249  NTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFM 308
            N++LI NY+ F+ TALL +Q   D+++G+EI++IYRIE+RLWVYG ITFLD+ K+FSNFM
Sbjct: 460  NSDLINNYVTFLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFM 519

Query: 309  DPEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYW 368
            DPEVCCQFIT+ FI ISNML DIP KY I W QRLGDLSRMAI+LYPSGFIDW+LSAE+W
Sbjct: 520  DPEVCCQFITHVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHW 579

Query: 369  YTESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSA 428
            Y E+MK+ Y  GKLYYH++T+QQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ A
Sbjct: 580  YMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRA 639

Query: 429  FIDRSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNG 488
            F++R++GN       HRN+QLI+YLKH+EVMLLPSFLE+ DLQ VVL+YFK KFG D N 
Sbjct: 640  FVERNNGN-------HRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNN 692

Query: 489  NDVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPX------- 541
             ++F T+ MFCQNP+ LRY+FRHAPAFAES ILQL+GFG+PKNPFALLF+LP        
Sbjct: 693  VNIFDTRKMFCQNPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKD 752

Query: 542  --XXXXXXXXXXXXXSGAAEIPHYRDPFDDQGSS-ESYFQNIDTLNSDFNDPPTNIGIWL 598
                           S    I    D   D+ S+ E +F NI+TL   ++  P+N+ IW 
Sbjct: 753  KKEKRRTKSTTVTETSSTMAIDDLEDEQSDRMSTPEGFFGNIETLRFPYS-VPSNLEIWN 811

Query: 599  DSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWI 658
            +SLNYINMTS++CS+ VL KFL  PL VALPHF+ W +FII++  K++ +N E    FW+
Sbjct: 812  ESLNYINMTSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWV 871

Query: 659  HFLRRTMPWNSMVTFSNVLVCYMLDN--LHPFLEKQLEKFYSLELDDLIEYFNENENLPE 716
             F+ R  PWN++V+F NVL+ YMLDN      ++    ++ S+ L+DL++YFN NE LPE
Sbjct: 872  EFVDRIFPWNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPE 931

Query: 717  VWKCWGSLWFDAV-----KKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVR 771
            VWKCWG+LWFD +        + +E  G+++H+F D+P+DGI FD  DE GE FW R+ R
Sbjct: 932  VWKCWGTLWFDTICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACR 991

Query: 772  TILTLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNN--- 828
             I   KG+A+ FP +G+ ++  A V+CRRND+SP + LK+ +FKL    +      N   
Sbjct: 992  IIFLFKGLAENFP-IGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQ 1050

Query: 829  ------ELDELYDTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDK 882
                  +LD L +T+EI E     NI +   P LSV+ GESIF+Y GY RL  DY  +DK
Sbjct: 1051 PSTTAIDLDHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDK 1110

Query: 883  NGGFNSAFIYTQW--SNVGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFT---IGKN 937
            NG F SA +YT W  +N  N   +  +  S  DS  + +       +F+++      G  
Sbjct: 1111 NGEFLSASLYTSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGF 1170

Query: 938  TDD----------DGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLR 987
             DD            S + YFV+D T+WLRHF HI+KLA + +LKFAICLTTF ELR+LR
Sbjct: 1171 ADDLFLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLR 1230

Query: 988  GSKDDNVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFV 1047
              KD+NVVEAATR++IT+RQLY E K++P+RFTGN+ATHIEE+LEFEE+ITW++HVDEFV
Sbjct: 1231 KPKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFV 1290

Query: 1048 IDAIAKLNQNFQ--------------TERTIDKNKGRSKEFAVLVTDDDNMNQKAKDKMI 1093
            I+A+ K    FQ                R  D   G   +F VLVTDD NM +KA+D+ +
Sbjct: 1291 IEAVYKAQSKFQEMNQLQLEQEEQQHQLRAHDDRSGL--KFVVLVTDDSNMRKKAQDQDV 1348

Query: 1094 KTCNTKYLFSLGSKLGINSGLCTN 1117
            +T +TK++FSL + +G+ S +CTN
Sbjct: 1349 RTFSTKFVFSLCNSIGLRSKICTN 1372

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 42/73 (57%), Gaps = 8/73 (10%)

Query: 43  KRHSSSSHNDTPESSFAKRRVPGVVE--PVGKGFID----GITTSQISMQNIPFKAEDIS 96
           KR SS+++N    ++F KRR+P   E  P    F+D    G     IS+ N P KA   S
Sbjct: 102 KRSSSNTYNYV-SANFVKRRLPNQEEIFPQQSQFLDTSLTGAINQSISVPNTPSKAP-TS 159

Query: 97  RRPSISRKAMETT 109
           RRPS+ +KA++T+
Sbjct: 160 RRPSLPKKAIDTS 172

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score =  979 bits (2532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/979 (51%), Positives = 662/979 (67%), Gaps = 74/979 (7%)

Query: 199  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYIN 258
            + + ++  I+KLQ IYKIIV QE ELQQRC  LTTSQTTELK+LW+IYKLNT+LI NYI 
Sbjct: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336

Query: 259  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFIT 318
            FI TALL +Q + D+ +G+EI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEVC QFIT
Sbjct: 337  FITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396

Query: 319  YAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 378
            + FI +S ML D+P K+SI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y 
Sbjct: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456

Query: 379  CGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTN 438
             GKLYYH++T+QQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR   N N
Sbjct: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDR---NKN 513

Query: 439  NNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMF 498
             N    RNS LIDYLKH+EVMLLPSFLEN DLQ VVL YF D+FG D+N N++F T+DMF
Sbjct: 514  GNV---RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMF 570

Query: 499  CQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPX--------XXXXXXXXX 550
             Q P SLR+YFRHAPAFAES ILQL+GFGNPKNPFALLF LP                  
Sbjct: 571  FQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSS 630

Query: 551  XXXXSGAAEIPHYRDP------FDDQGS-SESYFQNIDTLNSDFNDPPTNIGIWLDSLNY 603
                + + +    R P      + ++G+    YF NID+L    + P  NI +WL SL +
Sbjct: 631  TEISTMSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP--NILVWLKSLEH 688

Query: 604  INMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRR 663
            +NMTS++CS+ VL KFL  PL +ALPH L W +FIIA   K ++  +     FW   +RR
Sbjct: 689  LNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRR 748

Query: 664  TMPWNSMVTFSNVLVCYMLDNLH--PFLEKQLEKFYSLE-LDDLIEYFNENENLPEVWKC 720
             +PWN++ +F NVL+ Y+LDN +    + K  E + + E   +L++YFN NENLPE+WKC
Sbjct: 749  ILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKC 808

Query: 721  WGSLWFDAVK-----KCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILT 775
            WG+LWFD +        D     G++DH+F D PLDGI FD+ DE GE FW R++R +  
Sbjct: 809  WGTLWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFL 868

Query: 776  LKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYD 835
             KGIA+     GL+V+  A V CRR+DI P++ LK+ +FK++ ++E +++       +  
Sbjct: 869  FKGIAENL-QTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYS-GQPFSTINK 926

Query: 836  TIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW 895
             + + E I+  N+D  A P LSVV GE+IFEY GY +L  + H FD+NG   S+ IYT W
Sbjct: 927  LLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAW 986

Query: 896  SNVGNGVTLDVSSESLYDSTTNDLSLHWAKIL------FD-KVFTIGKNTDDDGSCSV-- 946
              + N  +L+ S  + Y S    ++    ++L      F  + F   ++T+DD +  +  
Sbjct: 987  V-IDNDNSLNNSQGNQYTSNM-QMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYM 1044

Query: 947  ---------------------------YFVIDATSWLRHFAHIFKLAKNNILKFAICLTT 979
                                       YFV DATSWLRHFAHI+KL+ NN+L FA+CLTT
Sbjct: 1045 NPEKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTT 1104

Query: 980  FQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITW 1039
            FQELR+LR SKD+NVV AA R++IT+RQLY E K++P+RFTGN+AT IEE+LEFEEQITW
Sbjct: 1105 FQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITW 1164

Query: 1040 KTHVDEFVIDAIAKLNQNF-QTERTIDKNKGRSKEFAVLVTDDDNMNQKAKDKMIKTCNT 1098
            ++HVDEFVI+A+ K    F     ++   KG +    VLVTDD NM +KA+++ IKT  T
Sbjct: 1165 RSHVDEFVIEAVVKAQNKFISANESVTLRKGFNH--VVLVTDDINMKRKAQEQGIKTFTT 1222

Query: 1099 KYLFSLGSKLGINSGLCTN 1117
             ++FS+  KLGI   +CTN
Sbjct: 1223 HFIFSVCRKLGIQDNVCTN 1241

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 62/123 (50%), Gaps = 9/123 (7%)

Query: 19  SRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGI 78
           ++ +NN   +   + P+ A  L QKRH S+S+    +   A+     +   +   +ID  
Sbjct: 25  TQDNNNNIDIFRPISPSAA--LRQKRHGSNSYIYKNQKRIARPDDKILNANININYIDH- 81

Query: 79  TTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSSNSAMDIPKSPYYVNRTAITRNM 138
             S ++    P K+  +SRRPS+S+K+   TPQ    S    + PKSP+YV   + T N+
Sbjct: 82  -NSIVNENATPVKSV-LSRRPSLSKKSNNVTPQ---PSFLVTEPPKSPFYVTNQSYT-NI 135

Query: 139 EVV 141
           +V 
Sbjct: 136 DVA 138

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score =  967 bits (2501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/1022 (49%), Positives = 660/1022 (64%), Gaps = 118/1022 (11%)

Query: 192  SVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTE 251
            SVTR+      +Q  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTTELK+LW IYK+NT+
Sbjct: 282  SVTRK-----SSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTD 336

Query: 252  LIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPE 311
            LI NY  FI TALL +QP  D+++G+EI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPE
Sbjct: 337  LINNYTTFITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPE 396

Query: 312  VCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTE 371
            VC QFIT+ FI +S +L DIP K++I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E
Sbjct: 397  VCSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYME 456

Query: 372  SMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFID 431
            +MK+ Y  GKLYYH++T+QQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+D
Sbjct: 457  AMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVD 516

Query: 432  RSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDV 491
            R++G        +RN  LIDYLKH+EVMLLPSFL + DLQ VVL YF+D+FG D++ N++
Sbjct: 517  RNTGGN------YRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNI 570

Query: 492  FSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXXXX 551
            F T+DMF Q P  LR++FRHAPAFAES ILQL+GFGNPKNPFALLF+LP           
Sbjct: 571  FDTQDMFFQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKE 630

Query: 552  XXXSGAAEIPHYRD----PFDDQG------------------SSESYFQNIDTLNSDFND 589
               S +              DDQ                   S   Y  NI+TL      
Sbjct: 631  KNKSKSTSTADVSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIET 690

Query: 590  PPTNIGIWLDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETIN 649
            P  +I  W+ SL++INMTS++CS+ VL KFLH PL +ALPHFL W  FIIA   K+  + 
Sbjct: 691  P--DICTWIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELE 748

Query: 650  SEQVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLDNLH--PFLEKQLEKFYSLELDDLIEY 707
            +E+   FW   ++R  PW+++ +F NVL+ Y+LDN      +E+   ++  ++LDD++ +
Sbjct: 749  NEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAH 808

Query: 708  FNENENLPEVWKCWGSLWFDAV-----KKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIG 762
            FN++E+LPEVWKCWG+LW+DA+        D     G+ DH+F D P+DGI FD +DE G
Sbjct: 809  FNKSEDLPEVWKCWGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETG 868

Query: 763  EKFWIRSVRTILTLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEED 822
             KFW R++R I   KGI+KKF D GLK++ +A V+C RN+ + D  L+  TFKL+ Y+E 
Sbjct: 869  AKFWKRALRVIFLFKGISKKF-DFGLKISHEAGVYC-RNEKAADSPLRRFTFKLESYDEP 926

Query: 823  AFNDNNELDELYDTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDK 882
              +  NE       I + E +  +N D  ATP LSVV GE+IFEY GY  L  D + FDK
Sbjct: 927  TSSKFNEF------IPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDK 980

Query: 883  NGGFNSAFIYTQW-------------------------SNVGNGVTLDVSSESLYDSTTN 917
            NG   S+ IYT W                             NG  +  S  +   +TT+
Sbjct: 981  NGEIVSSSIYTSWMIDTGEAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTTTS 1040

Query: 918  ------DLSLHWAKILFDKVFTIG------------------------KNTDDDGSCSVY 947
                  D  L+    LF K  ++G                         + D+      +
Sbjct: 1041 HVTDDQDPGLN-ENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTF 1099

Query: 948  FVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQ 1007
            F+ DATSWLRHFAHI+K+A N +LKF +CLTTFQELR+LR SKD+NVVEAA R++IT+RQ
Sbjct: 1100 FIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQ 1159

Query: 1008 LYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKN 1067
            LY E +++P+RFTGN+A  IEE+LEFEEQITW++HVDEFVI+A+ K    F T     + 
Sbjct: 1160 LYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQP 1219

Query: 1068 K------------GRSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLC 1115
            +            G+   +  LVT+D NM +KA+D+ IKT +T ++FSL SKLG++  LC
Sbjct: 1220 EEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLC 1279

Query: 1116 TN 1117
            TN
Sbjct: 1280 TN 1281

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/953 (50%), Positives = 648/953 (67%), Gaps = 67/953 (7%)

Query: 205  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITAL 264
              I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IYK+NTEL+ NY+ FI TAL
Sbjct: 255  ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314

Query: 265  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFICI 324
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEVCCQFIT+ FI +
Sbjct: 315  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374

Query: 325  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 384
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY Y  GKLYY
Sbjct: 375  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434

Query: 385  HIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETAH 444
            H++T+QQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++GN        
Sbjct: 435  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 487

Query: 445  RNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFCQNPES 504
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++F+ +DMF QNP+ 
Sbjct: 488  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDF 547

Query: 505  LRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSG-------A 557
             +Y+FRH P+FA+S ILQ++GFG PKNPFA+LF+LP              +         
Sbjct: 548  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTE 607

Query: 558  AEIPHYRDPFDDQGSSES-------------YFQNIDTLNSDFNDPPTNIGIWLDSLNYI 604
            +   + R+  +D   + S             +F +IDTL             WL++L ++
Sbjct: 608  SSTGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPILPSMLTNEAWLETLKFL 667

Query: 605  NMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRT 664
            NMTS++C + VL KFLH PL VALPH L W++FII++  K   +N      FWI  ++R 
Sbjct: 668  NMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRM 727

Query: 665  MPWNSMVTFSNVLVCYMLDN--LHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWG 722
             PW++MVTF NVL+ Y+LDN   +  +     ++  L L +L+  FNENE+LPE+W CWG
Sbjct: 728  FPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWG 787

Query: 723  SLWFDAVKKCDVMEIP--------GVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTIL 774
            +LWFDA+ + +   I         G++D++  DSP DGI+FD KDE GEKFW R+ R I 
Sbjct: 788  TLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIF 847

Query: 775  TLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELY 834
              + +++ FP LG+ V     V C  + +  +  L++L +KL+P   +  +    L  L 
Sbjct: 848  LFREVSRSFP-LGVIVRHDPLVNC--SSLQSNNILRDLVYKLEPL-TNIRSSVPVLSTLE 903

Query: 835  DTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQ 894
               +I+E    +N DL A P+LSV++G++IF Y GY +L  DY CFDKNG F SA +YT 
Sbjct: 904  SIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTS 963

Query: 895  W--SNVGNGVTLDVS------SESLYDSTTNDL--SLHWAKILFDKVFTIGKNTDDDGSC 944
            W   N  N +  ++S      +E+L+      +   + + +I F                
Sbjct: 964  WYVPNCNNNLETNISYANERENEALFLECMKSVHPEIAYPEIDFK--------------- 1008

Query: 945  SVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVIT 1004
            + YFV DATSWLRH A IFKLA+N +L+FAICLTTFQELR+LR SKD+NV+EAATR +IT
Sbjct: 1009 TTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIIT 1068

Query: 1005 IRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTI 1064
            IRQLY E K++P+RFTGN+ATHIEENLEFEEQITW+THVDEFVI++I K  +  +  +  
Sbjct: 1069 IRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQP 1128

Query: 1065 DKNKGRSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117
            + +  R   + VL++DDD M +KA++K I+T +T+++FSL +KLG    LCT+
Sbjct: 1129 NISSHRFN-YVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/946 (51%), Positives = 655/946 (69%), Gaps = 40/946 (4%)

Query: 199  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYIN 258
            S +P Q  ++KLQ+IYK IV QE ELQ++C  LT+SQTT+L S+W+IY++N EL+ NY+ 
Sbjct: 363  SNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVT 422

Query: 259  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFIT 318
            FI TALL++Q   DL++GQEI++ YRI +RLWVYG ITFLDVLK+FS+FMDPEVC QFIT
Sbjct: 423  FISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFIT 482

Query: 319  YAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 378
            + FI IS ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LS+EYWY +++KY YG
Sbjct: 483  HVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYG 542

Query: 379  CGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTN 438
             GKLYYH++TIQQN+LEAFVNLGKSVFCQD F PS Q +QL+I+NIYQ AFI+R S NT 
Sbjct: 543  YGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNT- 601

Query: 439  NNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMF 498
                  RNSQLI+YLKH+EVMLLP+F+ N +LQ VV+ YF+ KFG D +  ++F  +D+F
Sbjct: 602  ------RNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIF 655

Query: 499  CQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSGAA 558
             QNPE+L+Y+FRHAPAFAES ILQ +GFG+ KNPFALLF LP              + ++
Sbjct: 656  LQNPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSS 715

Query: 559  EIPHYRDPF--------DDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQ 610
              P   +          D   SS+ YF N++++   +  PP    IWL SL+Y+N+T++Q
Sbjct: 716  GEPTSNESVMSLDNISTDSLISSDQYFSNLESMQHPY-LPPPRYDIWLKSLSYLNLTAVQ 774

Query: 611  CSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSM 670
            C + VL KFLH P  VALPH ++W +FII+V  K ET+  E+   FW  F+RR +P NS+
Sbjct: 775  CGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSI 834

Query: 671  VTFSNVLVCYMLDNLH--PFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDA 728
            V+F NVL+ Y LDN +    +    E+  S++L +L+  FN NE LPEVWKCWG+LWFDA
Sbjct: 835  VSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDA 894

Query: 729  V-----KKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKF 783
            +        +  E  GV DHLFFDSP+DGIVFD KDE GEKFW R++R I   K IA+ F
Sbjct: 895  ITDKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETF 954

Query: 784  PDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDT----IEI 839
             D+G+ ++  A V+CRR+D+  ++ L + +FK+   E+   N N    E+ +     IE+
Sbjct: 955  -DIGITLSHTAPVYCRRDDVELNHILGSFSFKI---EQHLLNGNTVQVEIENCLGAIIEM 1010

Query: 840  NELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVG 899
             E+   VNI + ATP +S+   E+IFEYTGY R+  +   FDKNG   SA  YT W +  
Sbjct: 1011 TEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQ 1070

Query: 900  NGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSC--------SVYFVID 951
              V    +S     + ++      ++ + + +F++  N +++ +         +  FV+D
Sbjct: 1071 EIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTSFVLD 1130

Query: 952  ATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDE 1011
            ATSWLRH AHI+KLA N+ L F+ICLTTFQELR+LR SKD+NV+EAA R++I IRQLY +
Sbjct: 1131 ATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQLYSD 1190

Query: 1012 KKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRS 1071
             K+IP+RFTGNIATHIEE+LEFEEQITW++HVDEFVI++I+K  + F  +  +       
Sbjct: 1191 GKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF-LQPFVQNPVDND 1249

Query: 1072 KEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117
              F VLV+DD+NM +KA +K I+T  T+++F+L S++G    +CTN
Sbjct: 1250 SRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/959 (51%), Positives = 655/959 (68%), Gaps = 64/959 (6%)

Query: 195  RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIK 254
            R   S + +   I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IY++NTELI 
Sbjct: 258  RSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELIN 317

Query: 255  NYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCC 314
            NY+ FI TALL +QP++DL++GQEI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEVCC
Sbjct: 318  NYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 377

Query: 315  QFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMK 374
            QFIT+ F+ +S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MK
Sbjct: 378  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 437

Query: 375  YIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSS 434
            YIY  GKLYYH++T+QQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++
Sbjct: 438  YIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 497

Query: 435  GNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFST 494
            GN        RNS LI+YLKH+E MLLPSFLE+ DLQ+VV+ YF +KFG D NG ++F+ 
Sbjct: 498  GNL-------RNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNP 550

Query: 495  KDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXX 554
            +DMF QNP+  +Y+FRHAP+FA+S ILQ++GFG PKNPFA+LF+LP              
Sbjct: 551  EDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKK 610

Query: 555  SG--------------------AAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNI 594
            S                       EI        D      +F +IDTL           
Sbjct: 611  SSNNDSSVTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLTS 670

Query: 595  GIWLDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVT 654
              WL++L ++NMTS++C + VL KFLH PL +ALPH L W++FIIA   K   ++     
Sbjct: 671  EAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSK 730

Query: 655  AFWIHFLRRTMPWNSMVTFSNVLVCYMLDN--LHPFLEKQLEKFYSLELDDLIEYFNENE 712
             FW+  ++R  PW+++VTF NVL+ Y+LDN  L+P + +   K+ +L L  L+E FNE+E
Sbjct: 731  DFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESE 790

Query: 713  NLPEVWKCWGSLWFDAVKKCDVMEIP--------GVQDHLFFDSPLDGIVFDKKDEIGEK 764
             LPE+W CWG+LWFD + + +   I         G++D++  D+P DGI+FD KDE GEK
Sbjct: 791  ELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEK 850

Query: 765  FWIRSVRTILTLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAF 824
            FW R+ R I   + +++ FP +G+ V+    + C  +  S    L+NL +KL+P   +  
Sbjct: 851  FWKRACRIIFLFRELSRTFP-IGVIVSNDPLIKCSSSQSS--IILRNLVYKLEPL-SNIR 906

Query: 825  NDNNELDELYDTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNG 884
            ++   L  L ++++I+E     NIDL A P+LSV SG++IF YTGY +L  DY CFD+NG
Sbjct: 907  SNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNG 966

Query: 885  GFNSAFIYTQWSNVGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSC 944
             F SA +YT+W  + NG  +   SE+L +S   D+      +  + +       D +   
Sbjct: 967  EFLSASLYTRWY-LPNGNNI---SEALVNS---DIEKGDEDLFLECMKPDCPGIDFE--- 1016

Query: 945  SVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVIT 1004
            + YFV DATSWLRH A IFKLA+N +LKFAICLTTFQELR+LR SKD+NV+EAATR +IT
Sbjct: 1017 TTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIIT 1076

Query: 1005 IRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTI 1064
            IRQLY E K++P+RFTGN+ATHIEENLEFEEQITW+THVDEFVI++I K  +  +     
Sbjct: 1077 IRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLE----- 1131

Query: 1065 DKNKG------RSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117
              N G      R   + VL++DDD M +KA++K IKT +TK++FSL +KLG    LCT+
Sbjct: 1132 --NAGQPHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  946 bits (2446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/958 (50%), Positives = 649/958 (67%), Gaps = 56/958 (5%)

Query: 192  SVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTE 251
            +V R   + + +   I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IY++NTE
Sbjct: 254  NVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTE 313

Query: 252  LIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPE 311
            L+ NY+ FI TALL +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPE
Sbjct: 314  LVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPE 373

Query: 312  VCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTE 371
            VCCQFIT+ F+ +S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE
Sbjct: 374  VCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTE 433

Query: 372  SMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFID 431
            +MKY+Y  GKLYYH++T+QQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++
Sbjct: 434  AMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVE 493

Query: 432  RSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDV 491
            R++GN        RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++
Sbjct: 494  RNNGNL-------RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNI 546

Query: 492  FSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXXXX 551
            F+ +DMF QNP+  +Y+FRHAP+FA+S ILQ++GFG PKNPFA+LF+LP           
Sbjct: 547  FNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKE 606

Query: 552  XXXSGAA--------------------EIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPP 591
               S                       EI        ++ S   +F +IDTL        
Sbjct: 607  RKKSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSM 666

Query: 592  TNIGIWLDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSE 651
                 WL+SL ++NMTS++C + VL KFLH PL +ALPHFL W++FII++  K   ++  
Sbjct: 667  LTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDP 726

Query: 652  QVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLDN--LHPFLEKQLEKFYSLELDDLIEYFN 709
                FWI  ++R  PW++MVTF N+L+  +LDN    P +    +++  L L +L++ F 
Sbjct: 727  ISKEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFK 786

Query: 710  ENENLPEVWKCWGSLWFD--------AVKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEI 761
            E E LPE+W CWG+LWFD        ++   D  E  G++D++  DSP+DGI+FD  DE 
Sbjct: 787  EKEELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDEN 846

Query: 762  GEKFWIRSVRTILTLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEE 821
            GEKFW R+ RTI   + +++ F  +G+ +N ++S+   R+ +  +  L NL++KL+P   
Sbjct: 847  GEKFWKRACRTIFLFRELSRSF-QIGVIINNESSI--NRSSLQSNNILGNLSYKLEPLST 903

Query: 822  DAFNDNNELDELYDTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFD 881
               +    L+ L   I++ E     NIDL A P+LSV+ G SIF YTGY +L  +Y CFD
Sbjct: 904  LG-SSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFD 962

Query: 882  KNGGFNSAFIYTQW--SNVGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTD 939
            KNG F SA +YT W   N  N    +++S    ++        + + L      I  NT 
Sbjct: 963  KNGEFLSASLYTSWYVPNGSNNPETNINSNCEKENEG-----QFLECLKSDDREIDLNT- 1016

Query: 940  DDGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAAT 999
                   YFV DATSWLRH A IFKLA+N +LKFAICLTTFQELR+LR SKD+NV+EAAT
Sbjct: 1017 ------TYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAAT 1070

Query: 1000 RSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQ 1059
            R +ITIRQLY E K++P+RFTGN+ATHIEENLEFEEQITW+THVDEFVI++I K  +  +
Sbjct: 1071 RGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1130

Query: 1060 TERTIDKNKGRSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117
                +  +  R   + +L++DDD M +KA++K IKT +T+++FSL +KLG    LCT+
Sbjct: 1131 NANQLPVSSCRFN-YVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score =  937 bits (2421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/1192 (44%), Positives = 736/1192 (61%), Gaps = 139/1192 (11%)

Query: 40   LHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGITTSQISMQN---IPFKAEDIS 96
            LHQKRH+S+S+ D  +S +AKRR   + + V +   D +  S     +    P K ++ +
Sbjct: 30   LHQKRHNSNSY-DYYDSGYAKRRPNTLSQNVSQN--DELAASAACFLDSNLTPSKHQECT 86

Query: 97   RRPSISRKAMETTPQLHTSSNSAMDIPKSPYYVNRTAITRNMEVVS-------------- 142
              PS  ++A + TPQ    +    D P+SP+Y+  T+ + N+E  S              
Sbjct: 87   --PSSFQRATDETPQPFYPA----DTPQSPFYLPTTS-SSNLEAASKVITNDNSSVQLPD 139

Query: 143  -------------------KESHDE-----NGPQTRADDSLTTS-TGIYANSQPQSQITL 177
                               + +HD+     N       +S+T    G       QS  T 
Sbjct: 140  ICIDNKQQPERRQQQRLEKRVNHDDKKITRNAANGEQKESITDELQGTDNTPHEQSSNTH 199

Query: 178  SDTRAAPIVANSLPSVTR------------------QLPSAQPNQTFIKKLQEIYKIIVV 219
            +DT       NS+   +                    +P    +Q  ++KLQ+IY+ IV 
Sbjct: 200  ADTNQQSDQHNSVQQGSSGGSDDGENNRENSGIPIVNVPPKHTSQALVQKLQDIYRSIVK 259

Query: 220  QETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITALLTTQPINDLIMGQEI 279
            QE ELQ+RC  LT SQTT++K+LW IYK+N ELI NYI+FI TALL +QP  DL++GQEI
Sbjct: 260  QEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITTALLPSQPEQDLLIGQEI 319

Query: 280  LDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFICISNMLEDIPLKYSILW 339
            ++IYR+E+RLWVYG ITFLDVLK+FSNFMDPEVCCQFI++ F+ ISNML D+P +YSI W
Sbjct: 320  VEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFMSISNMLGDVPPRYSIPW 379

Query: 340  RQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYHIATIQQNSLEAFVN 399
             +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++ Y YG GKLYYH++T+QQN+LEAFVN
Sbjct: 380  LERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKLYYHMSTVQQNTLEAFVN 439

Query: 400  LGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETAHRNSQLIDYLKHTEVM 459
            LGKSVFCQD F PSQQ +QL+I+NIYQ AF +RS G++       RN  +++YLKH+EVM
Sbjct: 440  LGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSS-------RNFPIVEYLKHSEVM 492

Query: 460  LLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFCQNPESLRYYFRHAPAFAESQ 519
            LLPSFLE+ +LQ VVL +F+ +FG   N  D F  K +F Q+ E LRY+F HAPAFAES 
Sbjct: 493  LLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYFFSHAPAFAESH 552

Query: 520  ILQLIGFGNPKNPFALLFQLPX-XXXXXXXXXXXXXSGAAEIPHYRDPFDDQGSS----E 574
            ILQL+GFG+P+NPFA+LF+LP                 +  +P   D  D  GSS    +
Sbjct: 553  ILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTNLD--DGNGSSSISVD 610

Query: 575  SYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIW 634
             YF+NID+    ++  P +I IW  SL+Y+N+TS++CS+ VL KFLHAPL  ALPH L W
Sbjct: 611  HYFENIDSHRVPYSF-PQDIQIWQQSLSYLNLTSMECSMSVLKKFLHAPLLTALPHLLPW 669

Query: 635  LHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLDNLHPF--LEKQ 692
             HF+++V  ++ +++S+ +  FW+ F+RR  PWNS+V+F N L+ ++LDN      +EK 
Sbjct: 670  AHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNMSSVEKL 729

Query: 693  LEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAVK-----KCDVMEIPGVQDHLFFD 747
             E++  ++L  L+E+F  +E LPEVWKCWG+LWFD +      K   ++  G++DHLF D
Sbjct: 730  CEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQSTGIRDHLFLD 789

Query: 748  SPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDLGLKVNFQASVFCRRNDISPDY 807
            +P+DGI FD+ DE G KFW R+ R I   KG+AK+F   G++V+   +    R D++  +
Sbjct: 790  APIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEF-HYGIRVS--DTPISTRRDVTTLH 846

Query: 808  FLKNLTFKLDPYEEDAFNDNNELDELYDTIEINELIETVNIDLQATPKLSVVSGESIFEY 867
             LK  +FK +   ++   DN    +  + I++ E I  +N + +A P LS++ GESIFE+
Sbjct: 847  ALKRFSFKFEELPQEW--DNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDGESIFEF 904

Query: 868  TGYTRLTQDYHCFDKNGGFNSAFIYTQW----------------SNVGNGVTLDV----- 906
             GY R+  DY+CF+KNG   +  +YT                   +V NGV L       
Sbjct: 905  QGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLAAHNSPV 964

Query: 907  -SSESLYDSTTNDLSLHWAKILFDKVFTI----GKNTDDDGSCSV-----YFVIDATSWL 956
              +E   ++        W  +  D  F       +    D +C+      YFV+DATSWL
Sbjct: 965  DCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYFVLDATSWL 1024

Query: 957  RHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIP 1016
            RHFAH++KLA NN+LKFAICLTTFQELR+LR SKD++VVEAATR+VIT RQLY E+K++P
Sbjct: 1025 RHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLLP 1084

Query: 1017 MRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSK---- 1072
            +RFTGNIATH+EE+LEFEEQITW++HVDEFVI+A+ K  + F+      +++G+      
Sbjct: 1085 LRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPTD 1144

Query: 1073 -------EFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117
                    F VLVTDD NM  KA+   I   +++++F+  ++LG N  +C N
Sbjct: 1145 PKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1030 (48%), Positives = 663/1030 (64%), Gaps = 124/1030 (12%)

Query: 204  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITA 263
            +  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTT+LK+LW IYK+N +LI NY+ FI TA
Sbjct: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357

Query: 264  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFIC 323
            LL++Q   DL +G+EI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEVCCQFIT+ FI 
Sbjct: 358  LLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417

Query: 324  ISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 383
            +S ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE WY E+MK+ Y  GKLY
Sbjct: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477

Query: 384  YHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETA 443
            YH++T+QQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R++GN       
Sbjct: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGN------- 530

Query: 444  HRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFG---------------KDFNG 488
            +RN QLI+YLKH+EVMLLP+FLEN +LQ VVLLYF++KFG                  N 
Sbjct: 531  NRNLQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNN 590

Query: 489  N----DVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLP---- 540
            N    D+F ++DMF QNPE L+Y+FRHAPAFAES ILQL+GFG+PKNPFALLF+LP    
Sbjct: 591  NTRTIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLK 650

Query: 541  ------------------------XXXXXXXXXXXXXXSGAAEIPH-YRDPFDDQGSSES 575
                                                   G  +I + + D   +Q +SE 
Sbjct: 651  ERKDKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEE 710

Query: 576  YFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWL 635
            +FQNI+ L  D+   P ++ IW+ SLN+IN+ S++CS+ VL KFLH PL +ALPH L W 
Sbjct: 711  FFQNIEQLRFDY-FIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWC 769

Query: 636  HFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLDN----------- 684
            +FII++L K E +  E    FWI  L+   PWN ++ F NVL+ Y LDN           
Sbjct: 770  YFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVND 829

Query: 685  -----LHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAVKK-----CDV 734
                 ++ F+     K+ ++   DL+++FNENE+LPEVWKCWG+LWFD +        D 
Sbjct: 830  TKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADS 889

Query: 735  MEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDLGLKVNFQA 794
             E  G++DH+F D P+DGI +  +DE GE FW R++R I   KGIA+ F  LGLKV++ A
Sbjct: 890  FENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNA 949

Query: 795  SVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDN--NELDELYDTI--------EINELIE 844
                R N++  D  LK  +FK      D  + N  +EL+   +TI        +I E I 
Sbjct: 950  GTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIH 1009

Query: 845  TVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVGNGVTL 904
              N++ +  P  S+++ E IF+YTGY +L  +   FDKNG F+S  IYT W    + + L
Sbjct: 1010 ETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLIL 1069

Query: 905  -------DVSSESLYDSTTNDLSL------HWAKILFDKVFTIGKNTDDD--GSCSVYFV 949
                     +++ + D  T  LS+         +  F    T+  +T  +       YFV
Sbjct: 1070 AQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFV 1129

Query: 950  IDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLY 1009
             DATSWLRHFAHI+KLA N++LKFA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY
Sbjct: 1130 FDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLY 1189

Query: 1010 DEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKG 1069
             +  ++P+RFTGN+AT IEE+LEFEEQITW++HVDEFVI+A+ K  + F   +T++  +G
Sbjct: 1190 SDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEG 1249

Query: 1070 RSK----------------------EFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSK 1107
             S                       ++ VL+TDDD+M  KA+ K I T  T+ +FS+ S 
Sbjct: 1250 TSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSM 1309

Query: 1108 LGINSGLCTN 1117
            +GI+ G+CTN
Sbjct: 1310 MGIDEGVCTN 1319

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (50%), Gaps = 12/108 (11%)

Query: 40  LHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGI--------TTSQISMQNIPFK 91
           + QKRHSS+S+++   +   KRR+    E V   +ID +          S I  Q  P K
Sbjct: 52  IRQKRHSSNSYSNAKNNPAVKRRI-AKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSK 110

Query: 92  AEDISRRPSISRKAMETTPQLHTSSNSAMDIPKSPYYVNRTAITRNME 139
              +SRRPS+ +K M +TPQ    S    ++P SP+Y+   + + N E
Sbjct: 111 GT-LSRRPSLIKKQMNSTPQ--PMSYVVSEVPASPFYLPANSFSNNYE 155

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/943 (51%), Positives = 635/943 (67%), Gaps = 51/943 (5%)

Query: 205  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITAL 264
              I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IYK+NT+L+ NY+ FI TAL
Sbjct: 274  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333

Query: 265  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFICI 324
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEVCCQFIT+ F+ +
Sbjct: 334  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393

Query: 325  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 384
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKYIY  GKLYY
Sbjct: 394  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453

Query: 385  HIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETAH 444
            H++T+QQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++GN        
Sbjct: 454  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 506

Query: 445  RNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFCQNPES 504
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++F+ +DMF QNP+ 
Sbjct: 507  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDF 566

Query: 505  LRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSGAA------ 558
             +Y+FRH P+FA+S ILQ++GFG PKNPFA+LF+LP              S         
Sbjct: 567  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTE 626

Query: 559  --------------EIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYI 604
                          EI        D      +F +IDTL             WL++L ++
Sbjct: 627  SSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLETLKFL 686

Query: 605  NMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRT 664
            NMTS++C I VL KFLH PL +ALPH L W++FII++  K   ++      FW+  ++R 
Sbjct: 687  NMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRA 746

Query: 665  MPWNSMVTFSNVLVCYMLDNL--HPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWG 722
             PW++MVTF NVL+ Y+LDN   +  +    + +  L L +L+E FNE E LPE+  CWG
Sbjct: 747  FPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWG 806

Query: 723  SLWFDAVKKCDVMEIP--------GVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTIL 774
            +LWFD + + +   I         G++D++  DSP DGI+FD+KDE GEKFW R+ RTI 
Sbjct: 807  TLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIF 866

Query: 775  TLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELY 834
              + +++ FP +G+ +     ++  R+       L +L FKL+P   +  N+   L  L 
Sbjct: 867  LFRELSRSFP-IGVIIRNDPLIY--RSSFQNTNILGSLVFKLEPL-CNIHNNIPVLGALE 922

Query: 835  DTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQ 894
              I+I+E     N DL A P+LSV  G++IF Y GY +L  DY CFDKNG F SA +YT 
Sbjct: 923  SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTT 982

Query: 895  WSNVGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATS 954
            W  V N    ++     Y+S   +  L    I  D      K T        YFV DATS
Sbjct: 983  WY-VPNSNNTNIEDNINYNSEKENEGLFLECIKSDYPEIDFKTT--------YFVFDATS 1033

Query: 955  WLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKI 1014
            WLRH A IFKLA+N +L+FAICLTTFQELR+LR SKD+NV+EAATR +ITIRQLY E K+
Sbjct: 1034 WLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKV 1093

Query: 1015 IPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEF 1074
            +P+RFTGN+ATHIEENLEFEEQITW+THVDEFVI+++ K  +  ++  +  +   R   +
Sbjct: 1094 LPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESA-SEPRLSPRRFNY 1152

Query: 1075 AVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117
             VL++DDD M +KA++K IKT +T+++FSL +KLG    LCT+
Sbjct: 1153 VVLISDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD 1195

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/974 (50%), Positives = 646/974 (66%), Gaps = 85/974 (8%)

Query: 190  LPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLN 249
            +PSV+  +P  + +Q  ++KLQ+IYKII+ QE ELQ+RC  LT SQTTE+K+LW IYKLN
Sbjct: 304  VPSVS--VPPRKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLN 361

Query: 250  TELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMD 309
             +LI NY+ FI TAL  +Q  +DL++G+EI+DIY+IE+RLWVYG ITFLDVLK+FSNFMD
Sbjct: 362  ADLINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMD 421

Query: 310  PEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY 369
            PEVCCQFIT+ FI IS+ML+DIP KY+I W Q+LGDLSRMA++L+PSGFIDW+LSAE WY
Sbjct: 422  PEVCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWY 481

Query: 370  TESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAF 429
              +M+Y YG GKLYYH++T+QQN+LEAFVNLGKSVFCQ+ F PSQQ LQL+I+NIYQ AF
Sbjct: 482  MAAMEYSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAF 541

Query: 430  IDRSSGNTNNNETAHRNSQ-LIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNG 488
             DR      N+ +  RN Q L+DYLKH+EVMLLP+F+E+ DLQ VVLLYF +KFG D+N 
Sbjct: 542  ADR------NSSSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNN 595

Query: 489  NDV--FSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXX 546
            N+V  F  + MF QN + L++YFRHA AFAE+QILQL+G+GNPKNPFALLF LP      
Sbjct: 596  NNVKMFQPRQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKER 655

Query: 547  XXXXXXXXSGAAEIPHYRDPFDDQGS----------------------SESYFQNIDTLN 584
                          P  +   +D  S                      SE +F NID L 
Sbjct: 656  RDKKEKRK------PKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLA 709

Query: 585  SDFNDPPTNIGIWLDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKK 644
             + N  P +I +W DSL Y N T+ +CS+ VL KFL+ PL VALPH L W++F+I++  +
Sbjct: 710  IN-NFMPNSISLWNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQ 768

Query: 645  LETINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLDNL--HPFLEKQLEKFYSLELD 702
            +E      +  FW  F++R  PWNSMV F NVL+ YM+DN   +  L +  +++ SL L+
Sbjct: 769  IEKYQDTAMMEFWYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLE 828

Query: 703  DLIEYFNENENLPEVWKCWGSLWFDAV------KKCDVMEIPGVQDHLFFDSPLDGIVFD 756
            +L+  FN NE+LPEVWKC GSLWFD +      + CD     G++D+ F D P+DGI FD
Sbjct: 829  ELLRNFNANEDLPEVWKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFD 888

Query: 757  KKDEIGEKFWIRSVRTILTLKGIAKKFPDLG-LKVNFQASVFCRRNDISPDYFLKNLTFK 815
            + DEIG KFW RSVR I   +GI ++F   G L +++ A V  RR  +  +  L   +FK
Sbjct: 889  ENDEIGIKFWKRSVRVIFLFRGIVERFNGFGNLAISYNAPVINRRG-LGVNSHLVGYSFK 947

Query: 816  LDPYEEDAFNDNNELDELYDTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQ 875
            L    +D   D+  +          E I++ N D  A P LS++ GE+IFEY GY R+  
Sbjct: 948  LMAKSDDIMFDDMLVSNF-------EEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHA 1000

Query: 876  DYHCFDKNGGFNSAFIYTQWS-NVGNGVT---------------LDVSSE-----SLYDS 914
            DY+ FDKNG   S   Y  WS N   GV                 D  +E       +D 
Sbjct: 1001 DYYSFDKNGDLISTSFYNTWSINQDTGVNGGPLSNNSSSSNAASSDPMNEKELFNKCFDP 1060

Query: 915  TTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFA 974
              + +   W K ++D    IG+    +     YF++DATSWLRHFAH++K+A N+ILKF+
Sbjct: 1061 EYDSVDEFWNKEIYDD---IGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFS 1117

Query: 975  ICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFE 1034
            ICLTTFQELR+LR SKD+NVVEAATR++IT+RQL+ E K++P+RFTGN+ATHIEE+LEFE
Sbjct: 1118 ICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFE 1177

Query: 1035 EQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFAVLVTDDDNMNQKAKDKMIK 1094
            EQITW++HVDEFVI+A+ K  +  + E+ +   KG      VLVTDD NM  KA +K  K
Sbjct: 1178 EQITWRSHVDEFVIEAVIKA-ETKRKEQEMHNMKGFQ---IVLVTDDSNMKNKALEKGSK 1233

Query: 1095 TCNTKYLFSLGSKL 1108
            T +T+++F++ + L
Sbjct: 1234 TFSTRFVFAISNYL 1247

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 60/116 (51%), Gaps = 20/116 (17%)

Query: 40  LHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKG-FID------GITTSQISMQNIPFKA 92
           L QKRH SSS+  TP  ++ K+RV         G F+D      G  ++Q S+QN P   
Sbjct: 63  LGQKRHGSSSYYITP--NYIKKRVAKNSYNSATGNFLDSGSNGGGDISNQTSLQNTPLA- 119

Query: 93  EDISRRPSISRKAM---ETTPQLHTSSNSAMDIPKSPYYVNRTAITRNMEVVSKES 145
              S +PSI++  +    TTPQ    +  +M    SP+ +N + +  N+++VS E+
Sbjct: 120 ---SPKPSIAKNNIINTSTTPQPTYITQDSM---TSPFVLN-SNLPSNLDIVSNEN 168

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/1260 (41%), Positives = 726/1260 (57%), Gaps = 193/1260 (15%)

Query: 34   PTTAAFLHQKRHSSSSHNDTPESSFAKRRVPGVVE--PVGKGFIDGITTSQISMQ----- 86
            P     LHQKRH+SS++N T ++   KRR+P   +  P+G  F+D  + +   +Q     
Sbjct: 40   PGFTQGLHQKRHNSSANNHTRDT-IVKRRLPVQSDENPIG-NFLDSFSKNSSPLQQCRTP 97

Query: 87   -----NIPFKAEDISRRPSISR---------------------------KAMETTPQLHT 114
                 ++  K  +I     + R                           K       L  
Sbjct: 98   GSRPHSVTKKTSNIDNTDMVGRSNAIGGYSDNANMSNKSPAEFNAGPVNKNHTGNSLLDN 157

Query: 115  SSNSA--MDIPKSPYYVNRTAITRNME----------VVSKESHDEN-GPQTRADDSLTT 161
             +NSA  +DIP SP+Y+     +  +E          V S E   E+ GP+    +    
Sbjct: 158  IANSANRVDIPGSPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIGPELNLIEEQYN 217

Query: 162  STGIYANSQPQSQITLSDTRAAPIV-ANSLPSVTRQ-------------LPSA--QPNQT 205
            S     N +      +SD  + P   ANS+ S   +             LP+   +  Q 
Sbjct: 218  SN--LENGEINYNTEVSDFESLPTKDANSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQA 275

Query: 206  FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITALL 265
             I KLQ+IYK I+VQE ELQ  C  +T+SQTT+LK +W +YK+N EL+ NY+ FI TALL
Sbjct: 276  LISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTALL 335

Query: 266  TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFICIS 325
             +Q   DL++GQEI+D+Y+IE+RLWVYG ITFLDVLK FSNFMDPE+CCQFI + FI I+
Sbjct: 336  PSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIA 395

Query: 326  NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 385
            NM + IP K+SI W  RLGDLSRMA +LYP G  DW+LSAEYWY E+MKY YG GKLYYH
Sbjct: 396  NMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYH 455

Query: 386  IATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETAHR 445
            +AT+QQNSL AF+NLGKSVFC+D F P+QQ LQL+I+NIYQ A+I R        E +  
Sbjct: 456  MATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRG-------EESSS 508

Query: 446  NSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFCQNPESL 505
            N Q++DYLKH E+M+LP+F+EN +LQ +  +YF +KFG+DF GN+ F T+ MF QN ES+
Sbjct: 509  NVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESV 568

Query: 506  RYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSGAAEIPHYRD 565
            ++YFRH+P FA++ ILQ++G+GN  N FALL++LP              S         D
Sbjct: 569  KFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSID 628

Query: 566  PFDDQGSSE------SYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQVLTKF 619
                Q S         YF +++ ++ +F  PP N+ IW+ SL Y N T I C + VL KF
Sbjct: 629  TLSFQVSGNEIHDVGEYFNSLENIDKEFTLPP-NVDIWIQSLQYTNTTGIFCGMMVLQKF 687

Query: 620  LHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVC 679
            L  P   ALPH L W++F+I+V  K+ET+       FW  F+RR  PWN+++ F NVL+ 
Sbjct: 688  LQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIA 747

Query: 680  YMLDNLH--PFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAVK-KCDV-- 734
            ++ DN      + +  E +  L LD+++  F+ENE LPEVW CWGSLWFD +K K +   
Sbjct: 748  FLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSY 807

Query: 735  --MEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDLGLKV-- 790
              ++  G++D  F D+P DGIVFD++D+ G KFW R+ R +   KG A+KF D GL++  
Sbjct: 808  SGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKF-DQGLRLTN 866

Query: 791  -----NFQASVFCRRNDISPDYFLKNLTFKLDP-YE----EDAFNDNNELDELY-DTIEI 839
                 + + ++F ++ +     FL    FK DP Y+    ++A N   ++  L+ + +  
Sbjct: 867  INSLNSEEENIFTKKQEKRNIDFL----FKFDPTYDLLPIDEASNKYFQVYSLFTEKLPA 922

Query: 840  NELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW---S 896
             E I   NI L A P+LSV+ GESIF+Y GY +L   Y+ +DKNG  N   IY+ W   +
Sbjct: 923  FESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFN 982

Query: 897  NVGNGVTLDVSSESLY-----DSTTN-------------------DLSLHWAKI------ 926
             +GNG+   + + S +     D + N                   + S H A++      
Sbjct: 983  QLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAEVEREGDE 1042

Query: 927  -----------LFDKVFTIGKNTDD-------DGSC-----SVYFVIDATSWLRHFAHIF 963
                         DK +T  ++ D        +G       S YF+ DAT+WLRHFAHI+
Sbjct: 1043 TEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIY 1102

Query: 964  KLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRFTGNI 1023
            K+A + +L F ICLTTFQELR+LR S+D+NV+EAATR+VI IR LY  KK+IP+RF G I
Sbjct: 1103 KIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKI 1162

Query: 1024 ATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQN--------------FQTER--TID-- 1065
            A+HIEE+LEFEEQITW++HV+EFVI+A+AK  +N              F  E   T D  
Sbjct: 1163 ASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSA 1222

Query: 1066 --KNKG------RSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117
              K +G       SK  +VLVTDD NM+ KAK++ I+TC+T+++FS+ S+LG+  G+CTN
Sbjct: 1223 DTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/965 (47%), Positives = 640/965 (66%), Gaps = 69/965 (7%)

Query: 199  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYIN 258
            S+Q +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT+LK+LW IYK+NTELI NY+ 
Sbjct: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266

Query: 259  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFIT 318
            FI TALL +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLK+FSNFMDPEVCCQFIT
Sbjct: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326

Query: 319  YAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 378
            + FI ISNML D+P K++  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WYT+++ +I+G
Sbjct: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386

Query: 379  CGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTN 438
             GKLYYH++T+QQN+LEAFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+ GN  
Sbjct: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGN-- 444

Query: 439  NNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMF 498
                  RNS +++YLKH+EVMLL SFLE+ +LQ VVL +F++KFG   N  D FS + +F
Sbjct: 445  -----QRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499

Query: 499  CQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSG-- 556
             Q+ E  +Y+FRHAPAFAES ILQ++GFGNPKNPFALLF+LP              S   
Sbjct: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSS 559

Query: 557  ----AAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCS 612
                + E P    P +       Y +++D+    + + PT++ IW  SL++IN TSI+CS
Sbjct: 560  NSFTSMEAPSPTSPIE-------YLESVDSPRFVY-EFPTDLAIWQQSLSHINTTSIKCS 611

Query: 613  IQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVT 672
              VL KFLH PL  A  H L W +F++++  +++ + S ++  FWI   R+  PWNS+V 
Sbjct: 612  AVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVN 671

Query: 673  FSNVLVCYMLDNL--HPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAVK 730
            F N+++ + LDN      ++   E+F S+++  L+++F++NE+LPEVWKCWG+LWFD + 
Sbjct: 672  FLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVIS 731

Query: 731  -KCDVMEIPG----VQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPD 785
             K DV++       VQDH+F D P+DGI FD+ DE G +FW R+ R +   KGIA++F +
Sbjct: 732  DKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF-N 790

Query: 786  LGLKVNFQASV-FCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEINELIE 844
            +GL +   ASV    R  ++  + L+N  FK     ED   D+     +   +   E I 
Sbjct: 791  MGLTL---ASVPLQSRRSLAAGHPLQNFCFKF----EDPPVDSESYALISTQMPAFENIS 843

Query: 845  TVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWS----NVGN 900
              N+D  A P  S++ G+S+FE  GY +L  D+ CF+K G   +  +YT  S     +  
Sbjct: 844  ERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHG 903

Query: 901  GVTLDVSSESLYDSTT----------NDLSLHWAKIL---------FDKVFTIGKNTDDD 941
            G   +    S  D             + +   W             +D  F  G  + + 
Sbjct: 904  GDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNC 963

Query: 942  GSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRS 1001
             S   YFV DATSWLRHFAH++KLA N +L+FAICLTTFQELR+LR SKD++VVEAATR+
Sbjct: 964  DSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRA 1023

Query: 1002 VITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTE 1061
            VIT+RQLY EK+++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K    F+  
Sbjct: 1024 VITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEAL 1083

Query: 1062 RTIDKNKGR-----SKE----FAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINS 1112
                K  G      ++E    F  LV+DD NM  KA  + I+T +++++F++ +++G+  
Sbjct: 1084 NAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAH 1143

Query: 1113 GLCTN 1117
              CTN
Sbjct: 1144 HACTN 1148

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/994 (48%), Positives = 655/994 (65%), Gaps = 94/994 (9%)

Query: 190  LPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLN 249
            +PSV+  +P  + +Q  ++KLQ+IYK IV QE ELQ+RC  LT SQTTELK+LW IY++N
Sbjct: 370  IPSVS--VPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVN 427

Query: 250  TELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMD 309
            +EL+ NYI FI TA+  TQP +D  +G+EI++IY+IE+RLWVYG ITFLD+LK+FSNFMD
Sbjct: 428  SELVDNYITFITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMD 487

Query: 310  PEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY 369
            PEVCCQFI + FI ISNML DIP KY + W Q+LGDLSRMAI+LYPS FIDW+LSAE WY
Sbjct: 488  PEVCCQFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWY 547

Query: 370  TESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAF 429
              +M++ YG GKLYYH++T+QQN+LEAFVNLGKS+FC++ F PSQQ LQL+I NIYQ A+
Sbjct: 548  MAAMEFTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAY 607

Query: 430  IDRSSGNTNNNETAHRNSQL-IDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFN- 487
             D  S N+NN     RN QL +DY+KH EV LLP+F E+ +LQ VVL+YF DKFG D+N 
Sbjct: 608  AD--SNNSNNG----RNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNN 661

Query: 488  -GNDVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXX 546
              N++F ++ MF QN +  + ++R++ AFAESQILQ++G+GN K+PF+LLF+LP      
Sbjct: 662  SSNNMFISRKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDR 721

Query: 547  XXXXXXXXSGAAEIPHYRDPFDDQG----------------SSESYFQNIDTLNSDFNDP 590
                         I     P                     ++E +F+NIDT+N   +  
Sbjct: 722  KEKKEKRKPKTMLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYP-SFM 780

Query: 591  PTNIGIWLDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINS 650
            P ++ IW  SL Y N  SI+CS+ V  KFLHAP  +ALPH L W +FII+++ +L+   +
Sbjct: 781  PNSVDIWNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKN 840

Query: 651  EQVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLDNL-HPFLEKQLEKFY-SLELDDLIEYF 708
              +  FW+ F+RR  PWNS+V F NVL+ YM+DN     +  +L  FY S+ LD+L+ YF
Sbjct: 841  VAMNEFWVEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYF 900

Query: 709  NENENLPEVWKCWGSLWFDAV---------KKCDVM----------EIPGVQDHLFFDSP 749
            NENE LPEVWKC GSLWFD +         K  +V+          +  GV+D+ FFD P
Sbjct: 901  NENEELPEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFP 960

Query: 750  LDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDLG-LKVNFQASVFCRRNDISPDYF 808
            +DG  FD+ DEIGE+FW R+ R I   K +A+ +  LG L ++++A VF RR D   +Y 
Sbjct: 961  IDGTDFDESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKD---EYK 1017

Query: 809  LKNLTFKLD--PYEEDAFNDNNELDELYDTIEINELIETVNIDLQATPKLSVVSGESIFE 866
            +  +  +L    ++ +A +D   LD   D IE  E  + VN D   TP LS+V G+SIF+
Sbjct: 1018 VNTVCQELLEFSFKLNASSDGVMLD---DIIESFETPDEVNYDTHKTPMLSMVDGDSIFD 1074

Query: 867  YTGYTRLTQDYHCFDKNGGFNSAFIYTQWS----------NVGNGVTLD-VSSESLYDS- 914
            Y GY R+  +++ FDKNG F S   +  WS          N  + +T D +SS S  DS 
Sbjct: 1075 YVGYKRVCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSA 1134

Query: 915  --TTNDLSLHWAKILFDKVFTIGKNT-----------DDDGSCSV----YFVIDATSWLR 957
              +TN+  ++   ++F++ F     T           D   + S+    YF++DATSWLR
Sbjct: 1135 AASTNNDPMN-ELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLR 1193

Query: 958  HFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPM 1017
            HFAHI+K+A + ILKFAICLTTFQELRYLR SKD NVVEAATR++IT+RQLY E  ++P+
Sbjct: 1194 HFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPL 1253

Query: 1018 RFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKN-----KGRSK 1072
            RFTGN+ATHIEE+LEFEEQITW++HVDEFVI+A+ K  +  +T+R  D N     K +S 
Sbjct: 1254 RFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEK-RTDRLNDINMDTDEKEKSI 1312

Query: 1073 EFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGS 1106
               +LVTDD  M  KA D+ IKT +T+++FS+ +
Sbjct: 1313 FGIILVTDDITMKNKAMDRKIKTFSTRFIFSMAN 1346

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/962 (47%), Positives = 643/962 (66%), Gaps = 60/962 (6%)

Query: 198  PSAQP-NQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNY 256
            PS+ P +Q  ++KLQ+IY+ IV QE ELQ+RC  LTTSQTT+LK+LW IYK+N ELI NY
Sbjct: 235  PSSSPTSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNY 294

Query: 257  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQF 316
            + FI TALL +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLK+FSNFMDPEVCCQF
Sbjct: 295  VAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQF 354

Query: 317  ITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 376
            IT+ FI IS ML D+P K+S  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++ +I
Sbjct: 355  ITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHI 414

Query: 377  YGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGN 436
            +G GKLYYH++T+QQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R+ GN
Sbjct: 415  FGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGN 474

Query: 437  TNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKD 496
                   HRNS +++YLKH+EVMLL SFLE+ +LQ VVL +F+ KFG   +  D F+ +D
Sbjct: 475  -------HRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRD 527

Query: 497  MFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSG 556
            MF Q+ E ++Y+FRHAPAFAES ILQ +GFG+PKNPFALLF+LP              S 
Sbjct: 528  MFLQDGERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSK 587

Query: 557  AAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQVL 616
            ++      +       SE Y +N+D+    + + P ++ IW +SL++IN+TS +CS  V 
Sbjct: 588  SSHSFTSIETTSHLSPSE-YLENVDSPRYAY-EFPEDLAIWRESLSHINITSARCSSIVF 645

Query: 617  TKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFSNV 676
             KFL  PL VA+ H L W +F++++  K++++ S ++ +FWI  +R+  PWNS+V F N+
Sbjct: 646  QKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNM 705

Query: 677  LVCYMLDN---LHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAV---- 729
            L+ ++LDN     P ++   E+  S++   L+E+F+E+E+LPE+W+CWG+LWFD +    
Sbjct: 706  LMAFVLDNNWKTSP-IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKS 764

Query: 730  --KKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDLG 787
              +  DV+   G +DH F+D P DGI FD+ DE+GEKFW R+ R I   KGIA++F  LG
Sbjct: 765  NGEDGDVIN-SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEF-SLG 822

Query: 788  LKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEINELIETVN 847
            L ++  A     R  ++  + L+N +F      E+    +     + + I + E I T N
Sbjct: 823  LTLSAFAPQ--SRRPMTAGHPLQNFSFNF----EEIPAQSQIQSFVRNQIPLFEEIATGN 876

Query: 848  IDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW------------ 895
            +D    P  S++ GESIF++ GY ++  DY CF+K+G   S  +YT              
Sbjct: 877  LDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDD 936

Query: 896  -----------SNVGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSC 944
                       SN      +        D   N ++  + +  ++  F  G  + +  S 
Sbjct: 937  FNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSG 996

Query: 945  SVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVIT 1004
              YFV+DATSWLRHFAH+FKLA NN+L+F ICLTTFQELR+LR SKD++VVEAATR+VIT
Sbjct: 997  VSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVIT 1056

Query: 1005 IRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTI 1064
            +RQLY +KK++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K  + F+     
Sbjct: 1057 VRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQ 1116

Query: 1065 DKNKGRS---------KEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLC 1115
             K  G             F  LV+DD NM  KA  + I+T +T+++F++ +++G+    C
Sbjct: 1117 AKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQAC 1176

Query: 1116 TN 1117
            TN
Sbjct: 1177 TN 1178

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/979 (48%), Positives = 641/979 (65%), Gaps = 83/979 (8%)

Query: 190  LPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLN 249
            +P+V   + + Q +Q  ++KLQEIY+ IV QETELQQRC  LTTSQTT+LK+LW IYK+N
Sbjct: 271  VPTVA--VTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVN 328

Query: 250  TELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMD 309
             ELI NY  FI TALL TQP  DL++G+EI+++YRIE+RLWVYG ITFLDVLK+FSNFMD
Sbjct: 329  AELIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMD 388

Query: 310  PEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY 369
            PEVCCQFI Y FI ISNML DIP K+SI+W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY
Sbjct: 389  PEVCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWY 448

Query: 370  TESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAF 429
             E++KY +G GKLYYH++T+QQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF
Sbjct: 449  HEALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAF 508

Query: 430  IDRSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGN 489
             +R+SG+       HRN+ L++YLKHTEVMLLPSFLE+ +LQ VVL +F+ KFG   N  
Sbjct: 509  AERNSGH-------HRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-V 560

Query: 490  DVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXX 549
            D F  + +F Q+ E L+++FRHA  +AES +LQL+GFG+P+NPFALLF+LP         
Sbjct: 561  DFFDPRLVFVQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDR 620

Query: 550  XXXXXSGAAEIPHYRDPFDDQ---GSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINM 606
                 S ++    Y    DD     +   +F+ ID+    +   P +I IW +SL+Y N+
Sbjct: 621  REKRKSKSSTSTQYDTSIDDDCAFAAPSEFFETIDSTKYIYKF-PDDINIWKESLSYANV 679

Query: 607  TSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMP 666
            T+++CS+ VL KFLH PL  ALPH L W +F+ A   ++ TI  +++  FW+  +R+  P
Sbjct: 680  TAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFP 739

Query: 667  WNSMVTFSNVLVCYMLDNLH---PFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGS 723
            +N+++TF NVL+ YM +      PF ++  E+F  + L DL+ YF ENE LPEVW+CWG+
Sbjct: 740  FNTIITFLNVLLLYMNNQTQANFPF-DEYFEQFIDMSLADLVGYFCENEELPEVWECWGT 798

Query: 724  LWFDAVKKCDVMEI-----PGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKG 778
            LWFDA+    +  +      GV+DH+F DSP+DGI FD  DE GEKFW R  R IL  + 
Sbjct: 799  LWFDALNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRA 858

Query: 779  IAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKL-DPYEE--DAFNDNNELDELYD 835
            +A + P +GL+            +IS     ++L FK  +P  E  D + +   L  ++D
Sbjct: 859  LALECP-VGLR------------EISGGRNWRSLVFKFEEPPSEWCDMYLEPFTL--VFD 903

Query: 836  TIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYT-- 893
            T    E I  VN+D +ATP   +     I    GY  L  DY+CF++NG   +  +YT  
Sbjct: 904  TF---EQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIG 960

Query: 894  --QWSNVGNGVTLD----------VSSE-----SLYDSTTNDLSLHWAK-------ILFD 929
              + S +  G   +          VS+E     SL D     +   + +       + ++
Sbjct: 961  TLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWE 1020

Query: 930  KVFTIGKNTDDDGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGS 989
            ++   G       +   YFV+DAT+WLRHF H++KLA NNILKFAICLTTFQELR+LR S
Sbjct: 1021 QMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKS 1080

Query: 990  KDDNVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVID 1049
            KD++V+EAATR+VIT+RQLY E+K++P+RFTGN+A H+EE+LE EEQ+TW++HVDEFVI+
Sbjct: 1081 KDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIE 1140

Query: 1050 AIAKLNQNFQTERTIDKNKGRSKE-----------FAVLVTDDDNMNQKAKDKMIKTCNT 1098
            AI K    F      D  K  S++           F  LVTDD NM  KA  + IK  +T
Sbjct: 1141 AIHKAQDKFNALN--DDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFST 1198

Query: 1099 KYLFSLGSKLGINSGLCTN 1117
            +++FS+ ++LG    +CTN
Sbjct: 1199 RFMFSVCNELGHAKNVCTN 1217

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/972 (48%), Positives = 625/972 (64%), Gaps = 73/972 (7%)

Query: 194  TRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELI 253
            T  +PS   +QT ++KLQEIYK IV QETELQ+RC  LTTSQTT+LK+LW IYKLN ELI
Sbjct: 311  TVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELI 370

Query: 254  KNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVC 313
             NY  FI TALL TQP  DL++GQEI+++YRIE+RLW+YG ITFLDVLK+FSNFMDPEVC
Sbjct: 371  DNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVC 430

Query: 314  CQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESM 373
            CQFI Y FI ISN+L +IP  +S++W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++
Sbjct: 431  CQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEAL 490

Query: 374  KYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRS 433
            KY +G GKLYYH++T+QQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+
Sbjct: 491  KYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN 550

Query: 434  SGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFS 493
            SG+       HR S +++YLKHTEVMLLPSFLEN++ Q VVL +F  KFG   + N  F 
Sbjct: 551  SGH-------HRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSAN-FFD 602

Query: 494  TKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXX 553
               +F Q+ E L+++FRHA  +AES ILQL+GFG+P+NPFALLF+LP             
Sbjct: 603  PSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKR 662

Query: 554  XSGAAEIPHYRDPFDDQ--GSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQC 611
             S +          DD   G    +F+ +++  + +     ++ IW +SLNY+N TS++C
Sbjct: 663  KSKSTASNQSDMSIDDTFLGDPVQFFETLNSTKTAYRF-SQDLNIWKESLNYVNKTSMRC 721

Query: 612  SIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMV 671
            S+ VL KFL++ L  ALPH L W +F++AV  +L+ I +E    FWI F+R+  PW S+ 
Sbjct: 722  SMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESIT 781

Query: 672  TFSNVLVCYMLDNLHPF---LEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDA 728
             F NVL+ Y+ D   P    +++ +  + ++ L +L+EYF ENE+LPEVW CWG+LWFD 
Sbjct: 782  NFLNVLLLYINDQ-KPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDV 840

Query: 729  VKKCDVMEI-----PGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKF 783
            +    V  +      GV+DH+F D+P+DGI FD  DE GEKFW R VR IL  +GIA +F
Sbjct: 841  INSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQF 900

Query: 784  PDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEINELI 843
            P       F  + F   +D       K+L FK +  E  A      L          E I
Sbjct: 901  P-------FGFTEFNGSDD------WKSLVFKFN--EPPAEWKEQYLGSFSKEYGEFESI 945

Query: 844  ETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQ-WSNVGNGV 902
              VN DLQ+ P   +V G  I    GY +L  DY CF+KNG   +  +YT   S  G+GV
Sbjct: 946  SFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGV 1005

Query: 903  TLD----------VSSESLYDSTTNDLS--------------LHW----AKILFDKVFTI 934
              D          + +E L  S   D +              L W        +++    
Sbjct: 1006 PNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPR 1065

Query: 935  GKNTDDDGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNV 994
            G       +   YFV+DAT+WLRHF H++KLA +N+LKFAICLTTFQELR+LR SKD++V
Sbjct: 1066 GDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESV 1125

Query: 995  VEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKL 1054
            +EAATR+VIT+RQLY E+K++P+RFTGN+A H+EE+LE EEQ+TW++HVDEFVI+AI K 
Sbjct: 1126 LEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKA 1185

Query: 1055 NQNFQTERTIDKNKGRSK---------EFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLG 1105
               F       K  GR            F  LVTDD NM  KA+ + I+  +TK++F++ 
Sbjct: 1186 QSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAIC 1245

Query: 1106 SKLGINSGLCTN 1117
             ++G++  +CT+
Sbjct: 1246 HEIGLSKKVCTD 1257

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/973 (47%), Positives = 623/973 (64%), Gaps = 88/973 (9%)

Query: 206  FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITALL 265
             ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  YK+N ELI NYI FI TALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 266  TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFICIS 325
             +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLK+FSNFMDPEVCCQFI Y FI +S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 326  NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 385
            NMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G GKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 386  IATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDR-SSGNTNNNETAH 444
            ++T+QQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R SSGN        
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGN-------- 515

Query: 445  RNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFCQNPES 504
            R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  F    +F Q+ E 
Sbjct: 516  RTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFIQDAER 574

Query: 505  LRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSGAAEIPHYR 564
            L+++FRH+  F++S ILQL GFG+PKNPFA+LF+L               S  +      
Sbjct: 575  LKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSL 634

Query: 565  DPFD----DQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQVLTKFL 620
            DP +     Q S+E +F  ID+    + + P ++G+W  SL+YIN+TS++C + VL +FL
Sbjct: 635  DPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIVLRRFL 693

Query: 621  HAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVCY 680
            + P+  ALPH L WL FII++  +L+ +N   +  FWI F+RR  PW+S++TF N L+ Y
Sbjct: 694  YGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHY 753

Query: 681  -MLDNLHPF-LEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAV-KKCDV--- 734
             M+     F ++  +  +  +  ++L+    ENENLPE W CWGSLWF+ + KK D+   
Sbjct: 754  CMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVT 813

Query: 735  -MEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTIL---------TLKGIAKKFP 784
             +E  G+ D LF DSP +GI FD  DE G K+W R  RT+L            G      
Sbjct: 814  TLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCK 873

Query: 785  DLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEINELIE 844
             L  +     ++  R ND + D     L+ +L P E ++F             E  E+I 
Sbjct: 874  KLNPEATSWKNLVFRFNDDTND----QLSVELYPEENESF-----------PFEKFEIIS 918

Query: 845  TVNI--DLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW----SNV 898
             +N   +LQ   K S++ G SI    G+  +  DY CF+KNG   +A +YT+     +N+
Sbjct: 919  NLNCSDNLQDGSK-SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANI 977

Query: 899  GNG-----------VTLDVSSESLYDSTTNDLSLHW----------AKILFDKVFTIGKN 937
              G             L V     Y S  + L   W           + L ++ F    N
Sbjct: 978  QGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLN 1037

Query: 938  TDDDGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEA 997
               D + + +FV+DAT+WLRHFAHI+KLA +++LKFAICLTTFQELR+LR SKD++V+EA
Sbjct: 1038 CQADTNVT-FFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA 1096

Query: 998  ATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQN 1057
            ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK    
Sbjct: 1097 ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK 1156

Query: 1058 FQT--ERTIDKNK--------GRSKE---FAVLVTDDDNMNQKAKDKMIKTCNTKYLFSL 1104
            F       I+K K        G+S +   F  LVTDD NM  KA+   I+T +T+++F++
Sbjct: 1157 FNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAI 1216

Query: 1105 GSKLGINSGLCTN 1117
              +LG  +G+CTN
Sbjct: 1217 CRELGRETGVCTN 1229

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 75/158 (47%), Gaps = 31/158 (19%)

Query: 32  MRPTTAAF-----LHQKRHSSSSHNDTPESSFAKRRVP-GVVEPVGKGFIDGITTSQI-- 83
           M P +A+      LHQKRH+S+S  D  +S+  KRR   GV E V       I+ ++I  
Sbjct: 1   MDPGSASMAGHSGLHQKRHNSNSV-DYYDSNIIKRRTGDGVPENV------DISVAEIPQ 53

Query: 84  --------SMQNIPFKAEDISRRPSISRK---AMETTPQLHTSSNSAMDIPKSPYYVNRT 132
                   S+   P K     + PSI++     ME TPQ      S  + P+SP+Y+  T
Sbjct: 54  EPCQYLDTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSG-EFPQSPFYLPTT 112

Query: 133 AITRNMEVVSKESHDENGPQTRADDSLTTSTGIYANSQ 170
           + T N E  +  + +EN    R  DS+T  T +  N+Q
Sbjct: 113 SQT-NFEAAT--TVNENS-SIRRSDSVTRLTTVGNNTQ 146

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  463 bits (1192), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 236/380 (62%), Positives = 287/380 (75%), Gaps = 50/380 (13%)

Query: 204 QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITA 263
           Q  I+KLQ+IYK+IV QE +LQ RC  LTTSQTT+LK+LW IYK+N +LI NYINFI  A
Sbjct: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455

Query: 264 LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFIC 323
           LL TQ  NDL +G+EI++IYRIE+RLWVYG ITFLDVLKSFSNFMDPEVCCQFI++ FI 
Sbjct: 456 LLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515

Query: 324 ISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 383
           IS +L DIP+KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575

Query: 384 YHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETA 443
           YH++T+QQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R++GN       
Sbjct: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGN------- 628

Query: 444 HRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFG-------------------- 483
           HRN QLI+YLKHTEVMLLP+FLE+LDLQ+VVL+YF+ KFG                    
Sbjct: 629 HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGA 688

Query: 484 -----------------------KDFNGNDVFSTKDMFCQNPESLRYYFRHAPAFAESQI 520
                                  + F   D+F  +DMF QNP+ L+Y+FRH+  FA+S I
Sbjct: 689 NVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHI 748

Query: 521 LQLIGFGNPKNPFALLFQLP 540
           LQL+GFG+PKNPFALLF+LP
Sbjct: 749 LQLVGFGDPKNPFALLFELP 768

 Score =  418 bits (1075), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 238/592 (40%), Positives = 338/592 (57%), Gaps = 98/592 (16%)

Query: 567  FDDQGSS---ESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQVLTKFLHAP 623
            FD+  S+   E +F+NID L   +  P T I IWL+SL  IN+ S++CSI VL KFL+ P
Sbjct: 856  FDNNYSNILCEEFFENIDLLQFPYKIPQT-IEIWLESLKNINLISLKCSIIVLKKFLNGP 914

Query: 624  LAVALPHFLIWLHFIIAVLKKLE-TINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVCYML 682
            + +ALPH L W+HFII++L K+E +I   Q   FW  FL+  +PWNS+V F NVL+ Y+L
Sbjct: 915  ILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLL 974

Query: 683  DNLHP-------FLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAVKKCDV- 734
            DN++         L  +     S  L++++++FN+NENLPE+WKCWG+LWFD +   ++ 
Sbjct: 975  DNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNIN 1034

Query: 735  ----------------------------------MEIPGVQDHLFFDSPLDGIVFDKKDE 760
                                              +   G++DH   D PLDGI F   DE
Sbjct: 1035 SDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDE 1094

Query: 761  IGEKFWIRSVRTILTLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKL---- 816
             G  F+ RS+R I   K + + FP+LGLK++ + S +CR   I  ++ L N  FKL    
Sbjct: 1095 DGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLY 1154

Query: 817  DP------------------YEEDAFNDNNELDELYDTIEINELIETVNIDLQATPKLSV 858
            DP                    +D   + + L  + +  +I+E IE +N++LQ  P LS+
Sbjct: 1155 DPSLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSI 1214

Query: 859  VSG-ESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW-----------------SNVGN 900
            + G E+IF Y GY RL  +   F +NG   S  IY+ W                  ++ N
Sbjct: 1215 LGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVN 1274

Query: 901  GVTLDVSSESLYDSTTNDLSL-HWAKILFD-KVFTIGKNTDDDGSCSV---------YFV 949
              T+   + ++ D T  D S   + K+ F  K+ T   N+    +  +         +FV
Sbjct: 1275 DSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFV 1334

Query: 950  IDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLY 1009
             DATSWLRHFAHI+KL+KN  LKFA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY
Sbjct: 1335 FDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLY 1394

Query: 1010 DEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTE 1061
             E K++P+RFTGN+AT IEE+LEFEEQITW++HVDEFVI+AI +  + F+T+
Sbjct: 1395 KEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTK 1446

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  409 bits (1052), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/409 (51%), Positives = 277/409 (67%), Gaps = 69/409 (16%)

Query: 201 QPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFI 260
           + NQ  I+KLQ IYK+IV QE ELQ +C  L+TSQ+T+LK LW+IYKLN +LI NYI FI
Sbjct: 264 KSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFI 323

Query: 261 ITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYA 320
           +T+L  +Q IND ++G+EIL+IY+IE+RLW+YG ITFLD+LK+F+NFMDPE+  QFIT+ 
Sbjct: 324 LTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHV 383

Query: 321 FICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 380
           F  ISNM+ D+P+ +   W QRLGDLSRMAI+LYPS FIDW+LS+EYWY ESMK+ +  G
Sbjct: 384 FESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHG 443

Query: 381 KLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNN- 439
           KLYYHI+T+QQN LEAFVNLGKSVFC D F PSQ+ +QL+I+NIYQ AFI+R+S ++++ 
Sbjct: 444 KLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSN 503

Query: 440 ------------NETAHRNSQ---LIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGK 484
                         +  +N Q   LI+YLKH+EVMLLP+FLEN  L+ VVL YF + FGK
Sbjct: 504 NAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGK 563

Query: 485 ----------------------------------------------------DFNGNDVF 492
                                                                 N  ++F
Sbjct: 564 IAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLF 623

Query: 493 STKDMFCQ-NPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLP 540
           + +++F Q N + L+Y+F+++  FAES ILQLIGFG+PKNPFALLFQLP
Sbjct: 624 NFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLP 672

 Score =  225 bits (574), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 148/331 (44%), Positives = 192/331 (58%), Gaps = 75/331 (22%)

Query: 847  NIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW----------- 895
            N DL   P LS++  ES+FEY GY R   D+  FDKNG   S  +YT             
Sbjct: 1157 NTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDTINGSSSN 1216

Query: 896  SNVGNGVTLDVSSESLYDS---------------TTN----DLSLHWAKILFDKVFTIG- 935
            +N+ N  T + + ES  DS               TTN    +L L   K +F+K+     
Sbjct: 1217 ANIINTTT-NANDESNNDSSATAGSNQNKESSNSTTNIDNKELFL-MEKEIFNKILDPDY 1274

Query: 936  KNTDD--------DGS---CSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELR 984
            KN D+        D S      YFV+DATSWLRHFAH++KLA N ILKFAICLTTFQELR
Sbjct: 1275 KNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELR 1334

Query: 985  YLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVD 1044
            +LR SKD+NV+EAATR++IT+RQLY EK+++P+RFTGNIATHIEE+LEFEEQITW++HVD
Sbjct: 1335 FLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVD 1394

Query: 1045 EFVIDAIAKLNQNFQTERTIDKNKGRSKEFA-----------------------VLVTDD 1081
            EFVI+AI +     Q +R  ++N+  S   +                       VLVTDD
Sbjct: 1395 EFVIEAIKRA----QLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVLVTDD 1450

Query: 1082 DNMNQKAK----DKMIKTCNTKYLFSLGSKL 1108
             +M +K +    D  I T +TK++FSL + L
Sbjct: 1451 ISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  200 bits (509), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 104/276 (37%), Positives = 167/276 (60%), Gaps = 11/276 (3%)

Query: 564  RDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQVLTKFLHAP 623
             D   D  S + +F N+++L   F   P ++ IW +SL YIN+ S+ CSI VL KFL+ P
Sbjct: 779  EDEMLDNLSPQDFFNNLESLKLSF-FLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGP 837

Query: 624  LAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLD 683
            L V+LPH L W +FII++  ++E++ + +   FW+ F+R+  PWNS+V++ NV++  +LD
Sbjct: 838  LFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLD 897

Query: 684  NLH--PFLEKQLEKFYSLELDDLIEYFNENE-NLPEVWKCWGSLWFDAVKKC------DV 734
            N +    + K +  + +  LD+L+  FNENE  LPEVWKC+GSLWFD + +       D 
Sbjct: 898  NCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDC 957

Query: 735  MEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDL-GLKVNFQ 793
             +   ++D    + P+DG+ FD+ +E G  FW RS R I   K +  +F    GL ++  
Sbjct: 958  SKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSN 1017

Query: 794  ASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNE 829
             SV+C R+DI  ++ L+   FKL P +++  N++N+
Sbjct: 1018 TSVYCNRSDIPNNHILRTFAFKLLPDDDNYMNNSNK 1053

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  145 bits (366), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 205/931 (22%), Positives = 383/931 (41%), Gaps = 152/931 (16%)

Query: 226  QRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRI 285
            Q  L+L  ++      L  ++KL+T+++  Y  FI  AL       DLI G+E +   R+
Sbjct: 128  QALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRL 187

Query: 286  EKRLWVYGIITFLDVLKSFSNFM----------DPEVCCQFITYAFICISNMLEDIPLKY 335
             +RL  + +   L++++++ N M          + +   +FI    I I++MLE+IPLK+
Sbjct: 188  NERLINHCLKPLLEIIENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKF 247

Query: 336  SILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TESMKYIYGCGK--------- 381
               W   +GDL+R+ + L       +RL++ + Y       ++ Y    GK         
Sbjct: 248  HYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMC 307

Query: 382  -LYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNN 440
              Y++++ +Q +SL   V L K +  ++     +   QL I+ I  S  +++     N  
Sbjct: 308  NYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAIDKII-SKLLNKQ---VNLK 363

Query: 441  ETAHRNSQLIDYLKHTEVMLLPSFLENLD-LQHVVLLYFKDKFGKDFNGNDVFSTKDMFC 499
            ++    + L+ Y     +    +    L  ++   L YF ++F  +++ N     K + C
Sbjct: 364  QSMGGTTILMKYFTLLSLFFGSTSSSQLSGMERSSLHYFWNEFANEYHLNYSSLRKPVNC 423

Query: 500  QNPES----LRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXS 555
            +  +       +YF +AP F+   I++ I      NPF  +++                 
Sbjct: 424  KYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVYK----------------- 466

Query: 556  GAAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQV 615
                            SS+           DF     ++  W   +  ++ T +  +  +
Sbjct: 467  ----------------SSD-----------DFEIKSVSLSNWKILIEQMDDTLLHSNKLL 499

Query: 616  LTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFSN 675
              KFL   +A++ P  L WL F I+V  ++  +    V   W   L+  +PW+ +VT+ N
Sbjct: 500  FKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVTYLN 559

Query: 676  VLVCYMLDNLHPFLEKQLEKFY----SLELDDLIEYFNENENLPEVWKCWGSLWFDA--- 728
              +  +  N H    K L        S  L DL+ Y     N  E+  C G +WFD+   
Sbjct: 560  ESIDMV--NKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLAS 617

Query: 729  -VKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDLG 787
             +K+  +     +     +++  D +++D  D++  K W R++  IL +K +   +P+L 
Sbjct: 618  KIKQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRALLIILLIKNVINDYPEL- 676

Query: 788  LKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEED-AFNDNNELDELYDTIEINELIETV 846
                    V  R   ++    +KN     + Y  D  F  NN      + + I++ +   
Sbjct: 677  ------IDVSIRGQSLTNSSCIKNSDSLTNDYLFDWGFELNNN-----NAVIIDDTLHGR 725

Query: 847  NIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNG----GF----NSAFIYTQ-WSN 897
            N                IF+++       D+  FDKNG    G+    N  +IY+  +++
Sbjct: 726  N---------------RIFKFS----YIPDFQDFDKNGDITWGYSLISNYDYIYSNDFNS 766

Query: 898  VGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLR 957
              +G      S  L  S  ND S   +K    K+    +N         YF++D  +WL+
Sbjct: 767  EEDGNFFQRYSRRLL-SAHNDYSEDKSKKYLPKL----ENN--------YFMVDTLAWLK 813

Query: 958  HFAHIFKLAKNNILKFAICLTTFQELRYLRG-SKDDNVVEAATRSVITIRQLYDEKKI-I 1015
            H   + +      +K  + ++   +L  L+  S+ ++V  +A+R +I I  LY   +I I
Sbjct: 814  HSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINI 873

Query: 1016 PMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFA 1075
               F   I+  + +N++  + + +     +F  D + K N   Q    I+          
Sbjct: 874  LKEFESPISKAL-KNIDGSQILNFN---GKFKNDLLTKENGPGQQLNMIELRMDN----V 925

Query: 1076 VLVTDDDNMNQKAKDKMIKTCNTKYLFSLGS 1106
            V+V+DD       K K     +TK LFS+ S
Sbjct: 926  VVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956

>NCAS0H01260 Chr8 (238877..240499) [1623 bp, 540 aa] {ON} Anc_6.152
          Length = 540

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 80/159 (50%), Gaps = 16/159 (10%)

Query: 72  KGFIDGIT----TSQISMQNIPFKAEDISRRPSISR-KAMETTPQ--LHTS---SNSAMD 121
           + ++DGI      +Q+  +     + +++R+PS+S+ + + + PQ  +H S   SN+A  
Sbjct: 79  RKYLDGIPDVKLPNQLRSEEPVTVSANMTRQPSLSQEQQLFSDPQHIIHRSTFMSNAA-- 136

Query: 122 IPKSPYYVNRTAITRNMEVVSKESHD--ENGPQTRADDSLTTSTGIYANSQPQSQITLSD 179
              S Y +    I+++  +++K   D   + P +  + ++  S      S PQS  + S 
Sbjct: 137 --NSEYAILSNIISQDGGMINKIPVDVLYSNPNSNGNTNMGNSPNNMRRSLPQSPESESS 194

Query: 180 TRAAPIVANSLPSVTRQLPSAQPNQTFIKKLQEIYKIIV 218
             A PIV N++ S TRQ  +  P Q +  + Q +Y +++
Sbjct: 195 MTARPIVYNNVSSTTRQHSANVPPQPYPSEYQNVYSLLL 233

>Kpol_1025.24 s1025 (57304..57924) [621 bp, 206 aa] {ON}
          (57304..57924) [621 nt, 207 aa]
          Length = 206

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 27 SVVNDMRPTTAAFLHQKRHSSSSHNDTPESSF 58
          SV+N++ P   AFLHQ R S     +T + SF
Sbjct: 27 SVLNELPPDPKAFLHQHRESKRDKQNTKQQSF 58

>TPHA0F02620 Chr6 complement(577529..580285) [2757 bp, 918 aa] {ON}
           Anc_6.70 YLR273C
          Length = 918

 Score = 32.3 bits (72), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 53/120 (44%), Gaps = 15/120 (12%)

Query: 67  VEPVGKGFIDG-ITTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSSNSAMDI-PK 124
           ++     F+D  ITT+ ++  + P K  +ISR+ S++     T+P  H   N    I P+
Sbjct: 461 IQKFNNSFLDDFITTTTLTHNSNPSKTANISRKFSVNTDYYNTSPLKHLYHNDTTLIKPR 520

Query: 125 SPYYV------------NRTAIT-RNMEVVSKESHDENGPQTRADDSLTTSTGIYANSQP 171
           S   V            NRT+ T +N+      SH  N  +   D +LT +  I  NS P
Sbjct: 521 SVNSVVLCDEAINQNSQNRTSNTDKNVNNSDFTSHIANPSKFPQDIALTNNIAISNNSHP 580

>YOR326W Chr15 (925721..930445) [4725 bp, 1574 aa] {ON}  MYO2One of
            two type V myosin motors (along with MYO4) involved in
            actin-based transport of cargos; required for the
            polarized delivery of secretory vesicles, the vacuole,
            late Golgi elements, peroxisomes, and the mitotic spindle
          Length = 1574

 Score = 32.3 bits (72), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 29/123 (23%)

Query: 984  RYLRGSKDDNVVEAATRSVITIRQLYD------------------EKKIIPMRFTGNIAT 1025
            R+LR  KD  VV++  R     R+L                    E K+I +  T N+A+
Sbjct: 899  RFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIEL--TQNLAS 956

Query: 1026 HIEENLEFEEQIT-WKTHVDEFVIDAIAKLN---QNFQTERTIDKNKGRSKEFAVLVTDD 1081
             ++EN E  E+I   +  V+E      AKL    +N + E  ID +  +SK+  +  T +
Sbjct: 957  KVKENKEMTERIKELQVQVEES-----AKLQETLENMKKEHLIDIDNQKSKDMELQKTIE 1011

Query: 1082 DNM 1084
            +N+
Sbjct: 1012 NNL 1014

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 127,429,858
Number of extensions: 6039845
Number of successful extensions: 22140
Number of sequences better than 10.0: 108
Number of HSP's gapped: 22664
Number of HSP's successfully gapped: 142
Length of query: 1117
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 997
Effective length of database: 39,721,479
Effective search space: 39602314563
Effective search space used: 39602314563
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)