Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.365.707ON22422410581e-148
Smik_9.175.707ON2512338091e-109
Skud_9.165.707ON2262267412e-99
YIL152W5.707ON2352356952e-92
TBLA0I016905.707ON3201041134e-06
TPHA0E001805.707ON165981105e-06
ZYRO0B16434g5.707ON2371071011e-04
NCAS0G002105.707ON288120993e-04
NDAI0F002705.707ON298110968e-04
KNAG0L021605.707ON209102940.001
TDEL0B021305.707ON208103920.002
Kpol_1043.745.707ON17798830.021
KLTH0E00946g5.707ON21587810.041
SAKL0E15026g5.707ON290103780.12
TPHA0K008707.249ON60581730.71
KNAG0A033508.606ON38756674.1
NOTE: 4 genes in the same pillar as Suva_9.36 were not hit in these BLAST results
LIST: KAFR0D02200 Kwal_55.19675 KLLA0A00506g Cgla_YGOB_Anc_5.707

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.36
         (224 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)    412   e-148
Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)    316   e-109
Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)    290   2e-99
YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...   272   2e-92
TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...    48   4e-06
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    47   5e-06
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    44   1e-04
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    43   3e-04
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    42   8e-04
KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {O...    41   0.001
TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.70...    40   0.002
Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {...    37   0.021
KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved...    36   0.041
SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa] ...    35   0.12 
TPHA0K00870 Chr11 complement(181868..183685) [1818 bp, 605 aa] {...    33   0.71 
KNAG0A03350 Chr1 (423945..425108) [1164 bp, 387 aa] {ON} Anc_8.6...    30   4.1  

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score =  412 bits (1058), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 208/224 (92%), Positives = 208/224 (92%)

Query: 1   MGHKRRGLVIYQDQKQQQHSPGKSISSLAWSAAQQHPLKQQSTNSFTAILSKSCLRQDVQ 60
           MGHKRRGLVIYQDQKQQQHSPGKSISSLAWSAAQQHPLKQQSTNSFTAILSKSCLRQDVQ
Sbjct: 1   MGHKRRGLVIYQDQKQQQHSPGKSISSLAWSAAQQHPLKQQSTNSFTAILSKSCLRQDVQ 60

Query: 61  QDSSHLPISSLVLKXXXXXXXXXXXXXXXXLRKLVQNSQWTSSATHRPSWKQEKQPKAFY 120
           QDSSHLPISSLVLK                LRKLVQNSQWTSSATHRPSWKQEKQPKAFY
Sbjct: 61  QDSSHLPISSLVLKQQQQQQQHPSQSSGPPLRKLVQNSQWTSSATHRPSWKQEKQPKAFY 120

Query: 121 HTDSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLHTEDTIILHS 180
           HTDSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLHTEDTIILHS
Sbjct: 121 HTDSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLHTEDTIILHS 180

Query: 181 RTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224
           RTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI
Sbjct: 181 RTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score =  316 bits (809), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 168/233 (72%), Positives = 183/233 (78%), Gaps = 9/233 (3%)

Query: 1   MGHKRRGLVIYQDQKQQQHSPGKSISSLAWSAAQQ--HPLKQQSTNSFTAILSKSCLRQD 58
           M HKRRGLVIYQDQKQQQ   G+SISS++WS  Q+  HPLKQQSTN+FTAILSKS ++QD
Sbjct: 19  MSHKRRGLVIYQDQKQQQRPSGQSISSISWSPKQRPHHPLKQQSTNNFTAILSKSTVQQD 78

Query: 59  VQQDSSHLPISSLVLKXXX-------XXXXXXXXXXXXXLRKLVQNSQWTSSATHRPSWK 111
           VQQD SHLPISSLVLK                       LRKLVQ SQWTSS +H  S K
Sbjct: 79  VQQDRSHLPISSLVLKQEQHQQNEEQRRRNMQQQNSGPPLRKLVQESQWTSSTSHCHSRK 138

Query: 112 QEKQPKAFYHTDSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLH 171
           QEK P+ FY +DS+LVSQLHSSVKDLD I+QTHKP+FDTIIHDLS TTILS NELLIKL 
Sbjct: 139 QEKIPQGFYSSDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIHDLSRTTILSSNELLIKLP 198

Query: 172 TEDTIILHSRTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224
            E+TIILHSRTP IN EWL NKVSN GASLVIDSRSFLILC+NIKWYLHWKFI
Sbjct: 199 MEETIILHSRTPTINEEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251

>Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)
          Length = 226

 Score =  290 bits (741), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 165/226 (73%), Positives = 181/226 (80%), Gaps = 2/226 (0%)

Query: 1   MGHKRRGLVIYQDQKQQQHSPGKSISSLAWSAAQQH--PLKQQSTNSFTAILSKSCLRQD 58
           M HKRRGLVIYQDQKQQQ   G+S+SS++WS  ++H  PLKQQS+NSFT ILSKS ++QD
Sbjct: 1   MSHKRRGLVIYQDQKQQQQPSGQSLSSISWSPTRRHHHPLKQQSSNSFTEILSKSSVQQD 60

Query: 59  VQQDSSHLPISSLVLKXXXXXXXXXXXXXXXXLRKLVQNSQWTSSATHRPSWKQEKQPKA 118
           V+QDSSHLPISSLVLK                LRK+VQ+SQWTSS  H PS KQEKQ   
Sbjct: 61  VRQDSSHLPISSLVLKQQQQRRNMPSQNSGPPLRKVVQDSQWTSSTIHCPSRKQEKQSLT 120

Query: 119 FYHTDSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLHTEDTIIL 178
           FY TDS+LVSQLH+SVKDLDTIVQTHKPRFDTIIHDLSHT ILS NELLIKL   DTIIL
Sbjct: 121 FYRTDSKLVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIKLPMNDTIIL 180

Query: 179 HSRTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224
           HSR P INAEWL NK S+  ASLVIDSRSFLILC+NIKWYLHWKFI
Sbjct: 181 HSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score =  272 bits (695), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 178/235 (75%), Gaps = 11/235 (4%)

Query: 1   MGHKRRGLVIYQDQKQQQ-HSPGKSISSLAWSAAQQ--HPLKQQSTNSFTAILSKSCLRQ 57
           M HKRRGLVIYQDQKQQQ H PG+S+SS++WS  ++  HPLKQQSTNSF+ ILSKS ++ 
Sbjct: 1   MSHKRRGLVIYQDQKQQQQHPPGQSLSSISWSPTRRPHHPLKQQSTNSFSEILSKSSVQP 60

Query: 58  DVQQDSSHLPISSLVLKXX--------XXXXXXXXXXXXXXLRKLVQNSQWTSSATHRPS 109
           +VQ D +H+PIS LVLK                        LR+LVQ SQWTSSA++   
Sbjct: 61  NVQHDGNHMPISLLVLKQEHHKQQQQQQQRQNIRSQNSTPPLRQLVQESQWTSSASNSSL 120

Query: 110 WKQEKQPKAFYHTDSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIK 169
            KQEKQP+ FY+TDS+LVSQLHSSVKDLD I+QTHKP+FDTII D S  TILS NELLIK
Sbjct: 121 KKQEKQPQTFYNTDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIK 180

Query: 170 LHTEDTIILHSRTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224
           L  + TIILHSR P INAEWL+NKV++  ASLVIDSRSFL LC+NIKWYLHWKFI
Sbjct: 181 LPKDQTIILHSRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 59/104 (56%), Gaps = 13/104 (12%)

Query: 126 LVSQLHSSVKDLDTIVQTHKP-RFDTIIHDLSHTTILSPNELLIKLHTEDTIILHSRTPI 184
           LV+ LH+ + +L+T + + +  +FD I   +S  T LS  ELL+  +T  +++LHS + I
Sbjct: 225 LVNGLHTILSNLNTRIHSSRNLKFDKIFQ-ISKLTKLSDTELLVITNTNSSLLLHSDSTI 283

Query: 185 INAEW----LRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224
             +E+    L+ KV+        +S S L +  ++ WYL WKFI
Sbjct: 284 GQSEFNNYTLKEKVA-------TNSISILKITEDLNWYLKWKFI 320

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query: 127 VSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLHTEDTIILHSRTP-II 185
           VS L  S+   + +++    ++D I HD++    LS NE ++      T+ILHS    ++
Sbjct: 59  VSDLRLSINKFNMLLKASSNKYDEI-HDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVV 117

Query: 186 NAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKF 223
           N+    N  +     + I+S+ +L L +++ WYL WKF
Sbjct: 118 NS----NNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 56/107 (52%), Gaps = 16/107 (14%)

Query: 124 SRLVSQLHSSVKDLDTIVQT--HKPRFDTIIHDLSHTTILSPNELLIKLHTEDT----II 177
           + LV+QL  ++ D + +V+T      +D ++ D+ H   LSP E+++   ++D      I
Sbjct: 141 TNLVTQLICALNDFNLMVKTSQQNQNYDILV-DIRHAIWLSPFEIMV--ISDDPRVKRAI 197

Query: 178 LHSRTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224
           LHS   I        K  N+ + L I S+  L L +++ WYL WKF+
Sbjct: 198 LHSHKAIP-------KFVNSPSRLAICSKCCLTLYNDMNWYLKWKFL 237

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 17/120 (14%)

Query: 115 QPKAFYHTDSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLH-TE 173
           +PK F       V+ L   + DLDT+++T K      +  ++  T LS  EL +    + 
Sbjct: 173 EPKIF-------VTSLQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSP 225

Query: 174 DTIILHSRTPIINAEWLR--NKVS-------NAGASLVIDSRSFLILCSNIKWYLHWKFI 224
             IILH++T I N   L+  + VS            L I+S+SF+ +  +I WY+ WKFI
Sbjct: 226 QLIILHNKTSINNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFI 285

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 58/110 (52%), Gaps = 13/110 (11%)

Query: 124 SRLVSQLHSSVKDLDTIVQTHKP-RFDTIIHDLSHTTILSPNELLIK--------LHTED 174
           S L+  L  S+ DLDT ++T     +DT++  ++   +LS +E+ I           T+ 
Sbjct: 193 SALLQSLQKSLCDLDTSLKTLSYHSYDTLL-TVTSFEMLSDHEIKINSVKNYTAGFTTDV 251

Query: 175 TIILHSRTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224
           T++LHS+  + N     N   +    L +DS+ +L L  N+KWYL WKFI
Sbjct: 252 TMLLHSKISL-NVPLPNN--LHKDYKLALDSKVYLELAPNVKWYLVWKFI 298

>KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {ON}
           Anc_5.707 YIL152W
          Length = 209

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 56/102 (54%), Gaps = 6/102 (5%)

Query: 126 LVSQLHSSVKDLDTIVQT--HKPRFDTIIHDLSHTTILSPNELLIKL-HTEDTIILHSRT 182
           LV QL  S+  L+ +V T  H   +D ++  ++    LS +EL+++  H+    +LHS  
Sbjct: 107 LVQQLQRSLGRLNQLVLTTGHSRHYDALV-GVTGCLKLSSHELMLETGHSSKRYVLHSNG 165

Query: 183 PIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224
           P+    +L +++++ G ++ + S+  + +  ++ W L WK +
Sbjct: 166 PVHG--FLLDQIASGGYTVALYSKLAVRVTPDLYWCLQWKLV 205

>TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.707
           YIL152W
          Length = 208

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 51/103 (49%), Gaps = 8/103 (7%)

Query: 123 DSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLHTEDTIILHSRT 182
           D  L + +  ++  L+T +Q      D ++       +LS +ELL+ +      +LHS  
Sbjct: 113 DKSLSTAVSVALSHLNTRIQVLSGELDQLMA-FERLVLLSQHELLV-VTQRKIFVLHSVI 170

Query: 183 PIINAEWLRNKVSNAGA-SLVIDSRSFLILCSNIKWYLHWKFI 224
           P+      R  VS  GA  L ++S+ + +L +++ W++ WKF 
Sbjct: 171 PLT-----REGVSRFGALKLAVNSQCYYVLYNDVVWFMRWKFF 208

>Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {ON}
           complement(158958..159491) [534 nt, 178 aa]
          Length = 177

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 52/98 (53%), Gaps = 8/98 (8%)

Query: 130 LHSSVKDLDTIVQTHKP-RFDTIIHDLSHTTILSPNEL--LIKLHTEDT--IILHSRTPI 184
           LH+S+   +TIV++    +FD + H L H  +LS  ++  L+  H E T  IIL+     
Sbjct: 81  LHNSLYVFNTIVRSGSLLKFDHVWHIL-HFQLLSQFQIYCLVVDHNEMTKNIILYKNNNN 139

Query: 185 INAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWK 222
            N   +   +    A + I+S SF+ L  N+ WYLHW+
Sbjct: 140 NNNANI--TLPTTFAKIAINSNSFVHLYGNVNWYLHWR 175

>KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved
           hypothetical protein
          Length = 215

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 12/87 (13%)

Query: 141 VQTHKPRFDTIIHDLSHTTILSPNELLIKLHT---EDTIILHSRTPIINAEWLRNKVSNA 197
           + TH+  +D  +H + +T +LSP ELL         + +ILH      +AE        +
Sbjct: 138 LSTHE--YDRKLH-VQYTKLLSPTELLAVAAGPLGREVLILHMLPSTKDAE------PKS 188

Query: 198 GASLVIDSRSFLILCSNIKWYLHWKFI 224
           G+ L++ S +  +L   ++WY  W+ I
Sbjct: 189 GSQLLLSSNASALLYPGLRWYFEWRVI 215

>SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa]
           {ON} conserved hypothetical protein
          Length = 290

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 10/103 (9%)

Query: 126 LVSQLHSSVKDLDTIVQ----THKPRFDTIIHDLSHTTILSPNELL-IKLHTEDTIILHS 180
           ++ +L  S+ D +T+ +      KP +D I+  +  T  LSP+ELL I       I+LH 
Sbjct: 188 MLFRLQKSLCDFNTVYKLSSHVSKPNYD-IVLTVDCTQQLSPDELLVISSECAHAIVLHR 246

Query: 181 RTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKF 223
                N  + R +       L +DSRS + L   + WY +W F
Sbjct: 247 ---FKNKAFPRTEKHRV-LKLHLDSRSEIELYPGLYWYSNWYF 285

>TPHA0K00870 Chr11 complement(181868..183685) [1818 bp, 605 aa] {ON}
           Anc_7.249 YER068W
          Length = 605

 Score = 32.7 bits (73), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 15/81 (18%)

Query: 105 THRPSWKQEKQPKAFYHTDSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPN 164
           T++PS +Q      FY   +   SQ +++ KD++                LS +   SP 
Sbjct: 270 TNKPSQQQSSGHTMFYKNTTLNASQTNTATKDMN---------------GLSDSNTSSPA 314

Query: 165 ELLIKLHTEDTIILHSRTPII 185
            +  +LHTE+T+   + TPI+
Sbjct: 315 PVKAQLHTENTVNSGTPTPIL 335

>KNAG0A03350 Chr1 (423945..425108) [1164 bp, 387 aa] {ON} Anc_8.606
           YOR196C
          Length = 387

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 94  LVQNSQWTSSATHR-PSWKQEKQPKAFYHTDSRLVSQLHSSVKDLDTIVQTHKPRF 148
           L +  Q+   +T + PSW +   PK F +      ++LHS VKDL+  +   +P+ 
Sbjct: 76  LQKARQYAKESTEKLPSWLKVPIPKGFNY------NKLHSDVKDLNRALSAKRPKL 125

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.128    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,057,393
Number of extensions: 805295
Number of successful extensions: 3022
Number of sequences better than 10.0: 30
Number of HSP's gapped: 3051
Number of HSP's successfully gapped: 30
Length of query: 224
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 118
Effective length of database: 41,326,803
Effective search space: 4876562754
Effective search space used: 4876562754
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)