Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.355.709ON39339320280.0
Skud_9.155.709ON40239318140.0
YIL153W (RRD1)5.709ON39339317760.0
Smik_9.165.709ON39339317710.0
TDEL0B021105.709ON38934911031e-149
NCAS0G002005.709ON43833810731e-144
NDAI0F002405.709ON46432810491e-140
SAKL0E15070g5.709ON38534610281e-138
KLTH0E00880g5.709ON37133310201e-137
ZYRO0B16478g5.709ON39133010121e-135
Kpol_2001.775.709ON41334710051e-134
Kwal_55.196615.709ON3713339751e-130
Ecym_40125.709ON3953639581e-127
KAFR0D021905.709ON4263489431e-124
TPHA0D046505.709ON4213629411e-124
TBLA0E016905.709ON4883359461e-124
AFR293C5.709ON3653249051e-119
CAGL0H06655g5.709ON4243448941e-117
KLLA0A00462g5.709ON3533478821e-116
KNAG0L021705.709ON3963968601e-112
NDAI0E024108.674ON3592494047e-45
NCAS0C016908.674ON3592714003e-44
KAFR0H024408.674ON3533143976e-44
Kpol_1013.48.674ON3582493969e-44
ACR139C8.674ON3592703951e-43
ZYRO0F07326g8.674ON3522443942e-43
TPHA0D012408.674ON3592513942e-43
KLLA0F11187g8.674ON3602233925e-43
KNAG0J016908.674ON3632493908e-43
TDEL0A062008.674ON3553053854e-42
Ecym_23998.674ON3512513821e-41
Smik_6.3498.674ON3582523811e-41
CAGL0M02255g8.674ON3582463812e-41
YPL152W (RRD2)8.674ON3582523784e-41
SAKL0H06622g8.674ON3552473784e-41
KLTH0D11176g8.674ON3532553767e-41
Skud_16.1308.674ON3582523723e-40
Suva_16.1588.674ON3582523714e-40
TBLA0C018608.674ON3562363662e-39
Kwal_26.87838.674ON3552213559e-38
Kpol_1053.333.102ON596131830.12
YGL220W (FRA2)3.530ON12052663.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.35
         (393 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   785   0.0  
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   703   0.0  
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   688   0.0  
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   686   0.0  
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   429   e-149
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      417   e-144
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      408   e-140
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   400   e-138
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   397   e-137
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   394   e-135
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   391   e-134
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   380   e-130
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   373   e-127
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   367   e-124
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   367   e-124
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   369   e-124
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   353   e-119
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   348   e-117
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   344   e-116
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   335   e-112
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   160   7e-45
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   158   3e-44
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   157   6e-44
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   157   9e-44
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   156   1e-43
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   156   2e-43
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   156   2e-43
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   155   5e-43
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   154   8e-43
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   152   4e-42
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   151   1e-41
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   151   1e-41
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   151   2e-41
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   150   4e-41
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   150   4e-41
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   149   7e-41
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   147   3e-40
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   147   4e-40
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   145   2e-39
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   141   9e-38
Kpol_1053.33 s1053 complement(52288..54078) [1791 bp, 596 aa] {O...    37   0.12 
YGL220W Chr7 (82374..82736) [363 bp, 120 aa] {ON}  FRA2Protein i...    30   3.7  

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/393 (96%), Positives = 378/393 (96%)

Query: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60
           MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT
Sbjct: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60

Query: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120
           ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ
Sbjct: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120

Query: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKY 180
           YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKY
Sbjct: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKY 180

Query: 181 YAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVR 240
           YAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVR
Sbjct: 181 YAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVR 240

Query: 241 EYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFP 300
           EYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFP
Sbjct: 241 EYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFP 300

Query: 301 VVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTRFXXXXXXXXX 360
           VVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTRF         
Sbjct: 301 VVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTRFPASTSMPPP 360

Query: 361 XXXXXXNNVNSLLSHQNHTHRNQTSSSRDRLRR 393
                 NNVNSLLSHQNHTHRNQTSSSRDRLRR
Sbjct: 361 MAPPSANNVNSLLSHQNHTHRNQTSSSRDRLRR 393

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/393 (84%), Positives = 357/393 (90%)

Query: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60
           MSLDHVDW HA FSTPVKRIFDTQTT DFQSSLAIHRIKYHLHKYTTLMSHC DPD HA 
Sbjct: 10  MSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAA 69

Query: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120
           +SSI MVNGLM VLD+ AQLID+TPPLPGPRRYGNLACREWHYKLD HL+QWL+E+LPA+
Sbjct: 70  SSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAE 129

Query: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKY 180
           YH VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLG+FPHLRG DVFLLF+KY
Sbjct: 130 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKY 189

Query: 181 YAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVR 240
           Y IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA+APLQPR+VLDKSLV 
Sbjct: 190 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVH 249

Query: 241 EYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFP 300
           +Y+DTNFYCQGINFIN+VKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVL+KFP
Sbjct: 250 DYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 309

Query: 301 VVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTRFXXXXXXXXX 360
           VVQHFWFGTGFFPW+N+QNGTDLPVFEEKE+E+I+QANA S  P+ TSTRF         
Sbjct: 310 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTSTRFPGSLSMPPP 369

Query: 361 XXXXXXNNVNSLLSHQNHTHRNQTSSSRDRLRR 393
                 +++N LLSHQN +HRNQ SSS+DRLRR
Sbjct: 370 MGPPSGSSINYLLSHQNSSHRNQASSSKDRLRR 402

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/393 (84%), Positives = 358/393 (91%)

Query: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60
           MSLD VDWPHA FSTPVKRIFDTQTT DFQSSLAIHRIKYHLHKYTTL+SHC+DPDPHAT
Sbjct: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60

Query: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120
           ASSI MVNGLM VLD+ A LID+TPPLPGPRRYGNLACREWH+KLD  L QWL+E+LP++
Sbjct: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120

Query: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKY 180
           YH VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALD+LG+FPH+RG DVFLLF+KY
Sbjct: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKY 180

Query: 181 YAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVR 240
           Y IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPR++LDKSLVR
Sbjct: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240

Query: 241 EYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFP 300
           EY+DTNFYCQGINFIN+VKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVL+KFP
Sbjct: 241 EYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300

Query: 301 VVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTRFXXXXXXXXX 360
           VVQHFWFGTGFFPW+N+QNGTDLPVFEEKEEESI+QANA S   ++TSTRF         
Sbjct: 301 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMPPP 360

Query: 361 XXXXXXNNVNSLLSHQNHTHRNQTSSSRDRLRR 393
                 NN+N LLSHQN +HRNQTS SRDRLRR
Sbjct: 361 GVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/393 (84%), Positives = 354/393 (90%)

Query: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60
           MSLDHVDWPHA FSTPVKRIFDTQTT DFQSSLAIHRIKYHLHKYTTLMSHCADPDP A 
Sbjct: 1   MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV 60

Query: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120
           ASSIPM NGLM VLD+ A LID+TPPLPGPRRYGNLACREWH+KLD  L QWLRE+LP +
Sbjct: 61  ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE 120

Query: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKY 180
           YH VVPELQYYLGNSFGSSTRLDYGTGHELSFMATV ALDLLG+FPHLRGTDVFLLF+KY
Sbjct: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKY 180

Query: 181 YAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVR 240
           Y IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPR++LDKSLVR
Sbjct: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240

Query: 241 EYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFP 300
           EY++TNFYCQGINFIN+VKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVL+KFP
Sbjct: 241 EYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300

Query: 301 VVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTRFXXXXXXXXX 360
           VVQHFWFGTGFFPW+N+QNGT+LPVFEEKEEE+I+QANA    P+ TSTRF         
Sbjct: 301 VVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASMSMPPP 360

Query: 361 XXXXXXNNVNSLLSHQNHTHRNQTSSSRDRLRR 393
                 +N+N LLSHQNH+ RNQ SS RDRLRR
Sbjct: 361 ITPLSGSNINYLLSHQNHSQRNQPSSPRDRLRR 393

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  429 bits (1103), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 207/349 (59%), Positives = 254/349 (72%), Gaps = 5/349 (1%)

Query: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60
           +S   +D     F +PVK IFD+Q   DFQ S+AI R+KYHL KY  ++     P  H  
Sbjct: 2   ISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIH--GQPIVHE- 58

Query: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120
            S I +VN ++++L R ++L+D+TPP  GPRRYGNLACR+WH KLDA+L + L++VLP  
Sbjct: 59  PSGIEVVNRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQD 118

Query: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLF-PHLRGTDVFLLFSK 179
           YH  +PEL YYLGNSFGSSTRLDYGTGHELSF+A + ALD+LGL+     G DV LLF  
Sbjct: 119 YHKCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDT 178

Query: 180 YYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLV 239
           YY ++R+LILTYTLEPAGSHGVWGLDDHFH++YILGSSQW   D   P+ PRDV +K LV
Sbjct: 179 YYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSS-DPAVPMTPRDVKNKVLV 237

Query: 240 REYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKF 299
           ++Y DTN YCQ I+FI  VK GPF EHS +LYDIA TV  WSKV  GLLKMY VEVL+KF
Sbjct: 238 QDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKF 297

Query: 300 PVVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTS 348
           PVVQHFWFG GF+PWI+ +NG  LP++E  E E     + T+  P  T+
Sbjct: 298 PVVQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTT 346

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  417 bits (1073), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/338 (58%), Positives = 252/338 (74%), Gaps = 15/338 (4%)

Query: 6   VDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIP 65
           +D     FS P KRIFD+QTTQDFQSS+A++R+++ L KY +++++   P P  T SS+ 
Sbjct: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTP-PEGTLSSVT 91

Query: 66  MVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVL-------- 117
           +VN ++ +L+  + LID+TPPL GPRRYGNLACR+WH K++A L   L E+L        
Sbjct: 92  LVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151

Query: 118 --PAQYHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPH-LRGTDVF 174
              +  H  + EL YY+ N+FGSSTRLD+GTGHELSFMA +AA+D+LGL+   ++GTD+ 
Sbjct: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDIL 211

Query: 175 LLFSKYYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVL 234
           LLF+ YYA++R+LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      AP++PRDV 
Sbjct: 212 LLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI---RNAPMRPRDVK 268

Query: 235 DKSLVREYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294
           D SLV++Y  +N YCQ I FI QVK GPF EHSPILYDIA +V  WSKV +GL+KMY  E
Sbjct: 269 DISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328

Query: 295 VLQKFPVVQHFWFGTGFFPWINVQNGTDLPVFEEKEEE 332
           VL+KFPVVQHFWFG GF+PWIN   G  LP++E   E+
Sbjct: 329 VLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPED 366

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  408 bits (1049), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 190/328 (57%), Positives = 241/328 (73%), Gaps = 5/328 (1%)

Query: 6   VDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCA-DPDPHATASSI 64
           +D     FS PVKRIFD+QTTQDFQSS+A+ R+++ L +Y  L+++    P P +  S I
Sbjct: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73

Query: 65  PMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPA-QYHA 123
            MVN ++ +L+  + ++ DTPPL GPRRYGNLACR+WH K++  L + L + +P+     
Sbjct: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133

Query: 124 VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKYYAI 183
            + EL YY+ NSFGSSTRLDYGTGHELSFMA +AALD+LGLFP L G D+ ++F+ YY++
Sbjct: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYYSL 193

Query: 184 MRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQ 243
           +R LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      APL P+++ +  LV++Y 
Sbjct: 194 VRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWL---NNAPLTPKEITNSRLVKDYS 250

Query: 244 DTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQ 303
             N YCQ I F+  VK GPF EHSPILYDI+ +V  W KV +GL+KMY  EVL KFPVVQ
Sbjct: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310

Query: 304 HFWFGTGFFPWINVQNGTDLPVFEEKEE 331
           HFWFGTGF+PWIN Q   +LPV+E   E
Sbjct: 311 HFWFGTGFYPWINFQTLRELPVYEHSPE 338

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  400 bits (1028), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 190/346 (54%), Positives = 249/346 (71%), Gaps = 6/346 (1%)

Query: 6   VDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIP 65
           +D  H  F+ PVK+IFDTQ TQDFQSS+ ++R++ +LHKY TL+     P    + S+  
Sbjct: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIP----STSNND 65

Query: 66  MVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVV 125
            VN    ++D  ++ ID+TPPLPGPRR+GN ACR WH K+   L   L+  +P +YH  +
Sbjct: 66  AVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCI 125

Query: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLF-PHLRGTDVFLLFSKYYAIM 184
            E++YYLGN+FGS  RLDYGTGHELSF+A V+A+D+L L+  +  G D+  LF+ YY ++
Sbjct: 126 VEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLV 185

Query: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQD 244
           ++LI TYTLEPAGSHGVWGLDDHFHL YILGSSQ   + +  PL+P D+LD+  V +Y  
Sbjct: 186 KKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPI-SHNPLRPSDILDRHTVEDYAK 244

Query: 245 TNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQH 304
           TN Y Q I FI++VK G F EHSP+LYDIA TV  WSKV +GLLKMYS EVL KFPVVQH
Sbjct: 245 TNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQH 304

Query: 305 FWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTR 350
           FWFGTGFFPW+NV++G  LP +E  +EE+   ++ TS +   T+T+
Sbjct: 305 FWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATK 350

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  397 bits (1020), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 191/333 (57%), Positives = 240/333 (72%), Gaps = 8/333 (2%)

Query: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60
           MSL+ +D   A F+ P KRIFD++ +  FQSS+A+ R+K +LHKY + MS    P+    
Sbjct: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE---- 56

Query: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120
            S+   V     +L   ++L+D TP LPGPRRYGNLACR WH K+D  L   L + LP  
Sbjct: 57  TSTNHEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEP 116

Query: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLF-PHLRGTDVFLLFSK 179
            H  + ELQYYLGN+FGS  RLDYGTGHELSF A + ALD+LG++    + +DV  LF K
Sbjct: 117 CHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDK 176

Query: 180 YYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQ-APLQPRDVLDKSL 238
           YYA++R+L+LTYTLEPAGSHGVWGLDDHFHL+YI G+SQW  +D + AP+ PR+V DK +
Sbjct: 177 YYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQW--VDGKCAPIAPREVQDKLI 234

Query: 239 VREYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQK 298
           V EY  TNFYCQ I+FI QVK GPF EHSP+L+DI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 235 VDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNK 294

Query: 299 FPVVQHFWFGTGFFPWINVQNGTDLPVFEEKEE 331
           FPVVQHFWFGTG FPW ++ +G  LP +E  +E
Sbjct: 295 FPVVQHFWFGTGLFPWTSLGDGYALPTYEASQE 327

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  394 bits (1012), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 187/330 (56%), Positives = 242/330 (73%), Gaps = 8/330 (2%)

Query: 13  FSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPMVNGLMA 72
           F+TPVKRIFD+Q T +FQ+S+AI R+KY + KY  +++    P      S I +VN  + 
Sbjct: 11  FNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQ---GPSRISVVNEFVG 67

Query: 73  VLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVVPELQYYL 132
           VL+  + L+D TPPL GPRRYGNLACR+WH K+D  +    R+VLP ++H  + EL +YL
Sbjct: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYL 127

Query: 133 GNSFGSSTRLDYGTGHELSFMATVAALDLLGLFP-HLRGTDVFLLFSKYYAIMRRLILTY 191
           GNSFGS+TRLDYGTGHELSF+A V A+D+LGLF    +G D  L+ + YYA++R+LILTY
Sbjct: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187

Query: 192 TLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTNFYCQG 251
           TLEPAGSHGVWGLDDHFHL Y+ GS+QW     +APL+PRD+L+  LV+EY   N YCQ 
Sbjct: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYK-EAPLRPRDILNHHLVQEYAHLNLYCQT 246

Query: 252 INFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFWFGTGF 311
           I FI QVK GPF EHS +LYD+A TV  W+K+  GL+KMY+VEVL KFPVVQHFWFGTGF
Sbjct: 247 IGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGF 306

Query: 312 FPWINVQNGTDLPVFEEKEEESIDQANATS 341
           +PW++ Q G  L +++  +    D+ N +S
Sbjct: 307 YPWVDNQTGKQLLIYDPADA---DRRNTSS 333

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  391 bits (1005), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 189/347 (54%), Positives = 245/347 (70%), Gaps = 11/347 (3%)

Query: 13  FSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPMVNGLMA 72
           F  PVKRI+D+Q T  FQSS+AI R+KY + KY  L+ +   PD  +  S IP VN L+ 
Sbjct: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPD-ESYVSEIPTVNKLVK 73

Query: 73  VLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAV-------V 125
           ++   + L+D+TPP PGPRR+GNL+CREWH K+D +L   L ++L      +       V
Sbjct: 74  LISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSV 133

Query: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLF-PHLRGTDVFLLFSKYYAIM 184
            EL YYLGNSFGSSTRLDYGTGHELSF+A +A +D+LGL+  +++G D+ ++F++YY +M
Sbjct: 134 VELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLM 193

Query: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQD 244
           ++LILTYTLEPAGSHGVWGLDDHFH  YILGS+QW   +   PL+P D+++K LV EY +
Sbjct: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETN-NPPLKPMDIVNKDLVCEYAN 252

Query: 245 TNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQH 304
           TN YC  I FI+ VK GPF EHSP+LYDI+ +V  WSKV  GLLKMY VEVL KFPVVQH
Sbjct: 253 TNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQH 312

Query: 305 FWFGTGFFPWINVQNGTDLPVFEEKEEESID-QANATSATPDRTSTR 350
           FWFGTG FPWI+      LP++E   +++      + S +P   STR
Sbjct: 313 FWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTR 359

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  380 bits (975), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 182/333 (54%), Positives = 238/333 (71%), Gaps = 8/333 (2%)

Query: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60
           M  D +D     F+ PVKRIFD++ T  FQSS+A+ R+K HLHKY  ++S    P    +
Sbjct: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIP----S 56

Query: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120
            +S P V  L  +L  F++L+D+TP LPGPRRYGNLACR+WH K++  + + L+E LP +
Sbjct: 57  ETSNPNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEK 116

Query: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLF-PHLRGTDVFLLFSK 179
           Y+  + EL YYLGN+FGS  RLDYGTGHELSF + + ALD+LG++    +  D+  LF++
Sbjct: 117 YYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNE 176

Query: 180 YYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQW-QLLDAQAPLQPRDVLDKSL 238
           YY+++R+LI  Y+LEPAGSHGVWGLDDHFHL+YI G+SQW    DA+A   PR++  K +
Sbjct: 177 YYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEA--SPREIQSKMI 234

Query: 239 VREYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQK 298
           V EY  +NFYCQ I+FI +VK GPF EHSP+LYDI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 235 VDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNK 294

Query: 299 FPVVQHFWFGTGFFPWINVQNGTDLPVFEEKEE 331
           FPVVQHFWFGT  FPW +   G  LP +E  +E
Sbjct: 295 FPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQE 327

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  373 bits (958), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 186/363 (51%), Positives = 241/363 (66%), Gaps = 22/363 (6%)

Query: 6   VDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIP 65
           V+     FS PVKRIFD+  T DFQ SL ++R++ HL +Y  L+ +   P      S   
Sbjct: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62

Query: 66  MVNGLMAVLDRFAQLIDDTPPLPG-PRRYGNLACREWHYKLDAHLAQWLREVLP----AQ 120
            V+     LDRF +LID+TPP    PRR+GN+ACR+WH K+   +    R  LP    A 
Sbjct: 63  FVS---IFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAA 119

Query: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFP------HLRGTDVF 174
           Y   + EL+YYLGN+FGS  RLDYGTGHELSF+A V A+D+LGL+        L GTD+ 
Sbjct: 120 YENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLL 179

Query: 175 LLFSKYYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVL 234
            L++KYY+I+ +LILTYTLEPAGSHGVWGLDDH HL YI+G+SQW   D  AP+Q  D+L
Sbjct: 180 YLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDIL 239

Query: 235 DKSLVREYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294
           D   + +Y+DTN YC  I F+ +VK GPF +HSP+LYDI+ TVP WSK   GL+KMY VE
Sbjct: 240 DMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVE 299

Query: 295 VLQKFPVVQHFWFGTGFFPWINVQNGTDLPVFE-----EKEEESID---QANATSATPDR 346
           VL KFPVVQHFWFGTGFFPW++++ G  LP +E       +E ++D     ++T+A P  
Sbjct: 300 VLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTA 359

Query: 347 TST 349
           T +
Sbjct: 360 TGS 362

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  367 bits (943), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 184/348 (52%), Positives = 237/348 (68%), Gaps = 9/348 (2%)

Query: 6   VDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIP 65
           VD   + FS P KRIFD+QTTQ FQ S+A +R+KY  +KY  L+     P P +   ++ 
Sbjct: 10  VDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGV--PLPVSRNITMT 67

Query: 66  MVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVL----PAQY 121
           +   ++ +LD+ +Q ID+TPPL  PRR+GNL+CR WH K++++L   L+ ++      + 
Sbjct: 68  ITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN 127

Query: 122 HAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKYY 181
             +  EL YYL NSFGS TRLDYGTGHELSF+A ++ +D++ +   +   D  L++  YY
Sbjct: 128 ENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYY 187

Query: 182 AIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVRE 241
            + R+LILTYTLEPAGSHGVWGLDDHFHL YI GSSQ  L+   + L P+D+L K +V E
Sbjct: 188 NLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQ--LISDISHLAPKDILKKDVVAE 245

Query: 242 YQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPV 301
           +++ N YCQ INFI  VK GPF EHSPILYDI+  V  WSKV KGLLKMY+ EVL KFPV
Sbjct: 246 HKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPV 305

Query: 302 VQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTST 349
           VQHFWFG GFFPW +  +G DLPVFE  E ES + A  T   P  T T
Sbjct: 306 VQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMT-MMPSSTET 352

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  367 bits (941), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 181/362 (50%), Positives = 242/362 (66%), Gaps = 16/362 (4%)

Query: 3   LDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATAS 62
           L  ++    +FS P+KRI+D+Q+T  FQSS+AI+R+KY+LHKY  ++ +   PD     S
Sbjct: 4   LSTINIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPD-LTYVS 62

Query: 63  SIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYH 122
            I +VN + ++L   +  ID  PP  GPRRYGNLACR WH  +D+ +   L +VL    H
Sbjct: 63  EITIVNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNH 122

Query: 123 A-----------VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLF-PHLRG 170
           A            + EL YYL NS GS+TRLDYGTGHELSF+A +AA+D+LGL+  + +G
Sbjct: 123 ATEKGEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKG 182

Query: 171 TDVFLLFSKYYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQP 230
            D+  +F  YY ++++LI+TYTLEPAGSHGVWGLDDHFHL YILGSSQ    +   P  P
Sbjct: 183 VDLLHMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSE-NPNPPFSP 241

Query: 231 RDVLDKSLVREYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKM 290
            D+++K +V EY   NFYC  I+FI +VK GPF EHSPILYDI+ TV  W KV  GL+KM
Sbjct: 242 SDIINKKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKM 301

Query: 291 YSVEVLQKFPVVQHFWFGTGFFPWINVQNGTDLPVF--EEKEEESIDQANATSATPDRTS 348
           Y VEVL KFPVVQHFWFG GF+PW NV+    L V+  +  +E ++  ++ +S+ P+   
Sbjct: 302 YMVEVLNKFPVVQHFWFGEGFYPWKNVKTHKLLDVYMNDTNQENNVFNSSDSSSIPNNAM 361

Query: 349 TR 350
            +
Sbjct: 362 NK 363

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  369 bits (946), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 174/335 (51%), Positives = 227/335 (67%), Gaps = 18/335 (5%)

Query: 10  HAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPMVNG 69
           +  FS P K+IFD+Q TQ F  S+A HRI+Y + KYT L+     P P    SS   ++G
Sbjct: 12  NCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIP-PTDYTSSNDTISG 70

Query: 70  LMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPA-----QYHAV 124
           +  +++   +L+++TPPLPGPRRYGNL+CR+WH ++D ++ +   + L           +
Sbjct: 71  VSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKYYAIM 184
             EL YY   S GS TRLDYGTGHELSF+A + ALD+L L   + GTD+  +F++YY ++
Sbjct: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLI 190

Query: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA------------QAPLQPRD 232
           R+LIL YTLEPAGSHGVWGLDDHFHL+YI GSSQW   +A            +AP++P D
Sbjct: 191 RKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVD 250

Query: 233 VLDKSLVREYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYS 292
           +L+K+L+ +++ +NFYCQ I FI  VK GPF EHSPIL+DIA  V  W KV  GLLKMY 
Sbjct: 251 ILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310

Query: 293 VEVLQKFPVVQHFWFGTGFFPWINVQNGTDLPVFE 327
           VEVL KFPVVQHFWFGTGF+PWIN      LP +E
Sbjct: 311 VEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYE 345

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  353 bits (905), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 219/324 (67%), Gaps = 8/324 (2%)

Query: 13  FSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPMVNGLMA 72
           FS PVKRIFDT  T DFQ SL ++R++ HL +Y  L+     P      + +  V     
Sbjct: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVVRFV----C 65

Query: 73  VLDRFAQLIDDTPPLPG-PRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVVPELQYY 131
           +L+R   L+D+TPP  G  RR+G+LACR+WH ++   L   L  +LP        EL+YY
Sbjct: 66  ILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYY 125

Query: 132 LGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPH--LRGTDVFLLFSKYYAIMRRLIL 189
           LG++FGS  RLDYGTGHEL+F+A V ALD+LGL+      G D+  ++++YYA++ RLIL
Sbjct: 126 LGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLIL 185

Query: 190 TYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTNFYC 249
           TY LEPAGSHGVWGLDDH HL YILG+SQW   D   P+QP D+LD   V  Y +TN YC
Sbjct: 186 TYNLEPAGSHGVWGLDDHLHLAYILGASQWAQ-DRNVPMQPSDILDPKAVARYSETNLYC 244

Query: 250 QGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFWFGT 309
             I F+ +VK G F +HSP+L+DIA TVP WSKV  GL+KMY VEVL KFPVVQHFWFGT
Sbjct: 245 NSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGT 304

Query: 310 GFFPWINVQNGTDLPVFEEKEEES 333
           GFFPW+++ +G  LP +E   E S
Sbjct: 305 GFFPWVDMAHGMSLPNYEAPSETS 328

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  348 bits (894), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 234/344 (68%), Gaps = 16/344 (4%)

Query: 13  FSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPMVNGLMA 72
           FS PVKRI+D+Q    FQSS AI R++  + KYT L+      D   +     +    + 
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSGVVGGV----VK 57

Query: 73  VLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVL----PAQYHAVVPEL 128
           VLDR  QL+ +TPP+PGPRRYGN+ACR+WH K++  +   L +++    P++   VV EL
Sbjct: 58  VLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVV-EL 116

Query: 129 QYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKYYAIMRRLI 188
           +YYL NSFGS+TRLD+GTGHELSF+ATVAALD+LG      G  V  +F +YY+++ RLI
Sbjct: 117 RYYLANSFGSATRLDFGTGHELSFLATVAALDMLGA--SFDGDQVLYIFDRYYSLVHRLI 174

Query: 189 LTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTNFY 248
           L+YTLEPAGSHGVWGLDDHFHL YILGSSQW      A ++P D+ D  LV +Y  TN +
Sbjct: 175 LSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLA-MEPNDLSDPVLVEQYSRTNIF 233

Query: 249 CQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFWFG 308
           C+ +NF+  VK G F EHSP+L+DI+ +V  W+KV KGL KMY  EVL KFPV+QHFWFG
Sbjct: 234 CKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFG 293

Query: 309 TGFFPWINVQNGTDLPVFEEKEEESIDQAN--ATSATPDRTSTR 350
           TGF+PW++ +NG  LP +E   +  ID+ N   T A  +   TR
Sbjct: 294 TGFYPWVDYKNGKPLPNYENSPD--IDETNDLKTQAQANMDGTR 335

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  344 bits (882), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 169/347 (48%), Positives = 225/347 (64%), Gaps = 10/347 (2%)

Query: 7   DWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPM 66
           D+ +A FS P KRIFD+Q T DFQ+S+A+ RI+YHL KY TL      PD   T      
Sbjct: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPD---TIKESFF 60

Query: 67  VNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVVP 126
            N ++ +L R + LID+TPP     RYGNL+ R+W  K    L  WL E+LP +Y+  + 
Sbjct: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSII 120

Query: 127 ELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKYYAIMRR 186
           EL YY+ N+FGS  R+DYGTGHELSF+A +  LD+L +   ++G  +   F+ YY ++++
Sbjct: 121 ELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI-ETIKGPALLYCFNSYYDVIQK 179

Query: 187 LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTN 246
           LILTY LEPAGSHGVWGLDDHFH  YILG++Q  LLD    L P+D+ +  L+ +   +N
Sbjct: 180 LILTYKLEPAGSHGVWGLDDHFHFSYILGATQ--LLDVNTSLIPKDISNTRLMEQNSSSN 237

Query: 247 FYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFW 306
            +C+ I FIN VK GPF  HSP+LY+I+ +V  W K+ +GL+KMY VEVL KFPVVQHFW
Sbjct: 238 LFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFW 297

Query: 307 FGTGFFPWINVQNGTDLPVFEEKEEES----IDQANATSATPDRTST 349
           FGT FFPW +  N   LP+++  E       +   NAT+  P   ST
Sbjct: 298 FGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLST 344

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  335 bits (860), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 181/396 (45%), Positives = 238/396 (60%), Gaps = 23/396 (5%)

Query: 6   VDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIP 65
           +D  HA F  P KRIFD+QTT  FQ S+A+ RI++H+ KY  +M    D     +AS   
Sbjct: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMR--GDTSGGISAS--- 70

Query: 66  MVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVV 125
            V  ++ +LDR   L+D+TPPL GPRRYGNLACR+WH K+D+ L     +V         
Sbjct: 71  -VARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGAC 129

Query: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKYYAIMR 185
            E +YYL NSFGS  RLDYGTGHELSF+A VAALD++     +   ++  L+ +YY ++R
Sbjct: 130 IEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVR 189

Query: 186 RLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSL-VREYQD 244
           RLI+ Y LEPAGSHGVWGLDDHFHL Y+ G+SQ+   +    +QPRDVL   +  R+   
Sbjct: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA--NNPVGVQPRDVLSGVIPGRDDAP 247

Query: 245 TNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQH 304
            NF  + I F+  VK GPF E+SP+L DI   V  W K+ +GL +MY+ EVL KFPVVQH
Sbjct: 248 ANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307

Query: 305 FWFGTGFFPWINVQNGTDLPVFEEK---EEESIDQAN----ATSATPDRTSTRFXXXXXX 357
           FWFGT FFPW +V++GT LPV+E+    E+E+ D        T+  P   ++        
Sbjct: 308 FWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSGAPPGPGTTTLPALDTSTMASVPSR 367

Query: 358 XXXXXXXXXNNVNSLLSHQNHTHRNQTSSSRDRLRR 393
                      VN  + H        T+S RDRLRR
Sbjct: 368 RPAMGPPAGRQVNKFIQH-------TTASHRDRLRR 396

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  160 bits (404), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 139/249 (55%), Gaps = 11/249 (4%)

Query: 65  PMVNGLMAVLDRFAQLIDDTPPLPGPR--RYGNLACREWHYKLDAHLAQWLREVLPAQYH 122
           P +N L  +L    ++ID  P L      R+G    R ++ +++    + + E  P+  H
Sbjct: 50  PAINTLEQILVSIDKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSLTH 109

Query: 123 AVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAAL---DLLGLFPHLRGTDVFLLFSK 179
             + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   D+L L    R   V ++F K
Sbjct: 110 EQLEQLTIYLDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNM-VLIIFIK 168

Query: 180 YYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLV 239
           Y  IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + ++ LV
Sbjct: 169 YLDIMRSLETKYWLEPAGSHGVWGLDDYHFLPFLFGAYQ---LATHKHLKPLSIHNEELV 225

Query: 240 REYQDTNFYCQGINFINQVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQK 298
             +     Y   I FIN VK       HSP+L DI+  V RWSKV +G++KMY+ EVL K
Sbjct: 226 EMFAKKYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSK 284

Query: 299 FPVVQHFWF 307
            P++QHF+F
Sbjct: 285 LPIMQHFYF 293

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  158 bits (400), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 98/271 (36%), Positives = 150/271 (55%), Gaps = 17/271 (6%)

Query: 65  PMVNGLMAVLDRFAQLIDDTPPLPGPR--RYGNLACREWHYKLDAHLAQWLREVLPAQYH 122
           P +  L ++LD   +L+D  P +   +  R+G +  R+++ +L+   +  ++        
Sbjct: 50  PSIASLSSLLDEVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFSTLSD 109

Query: 123 AVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTD--VFLLFSKY 180
             + +L  YL  S+G+  R+DYG+GHEL+F+  +  L   GLF   +     V ++F KY
Sbjct: 110 EQLEQLSIYLDESWGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINLVLVVFLKY 169

Query: 181 YAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVR 240
             IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + ++ LV 
Sbjct: 170 LNIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LVPHKHLKPMSIHNEELVE 226

Query: 241 EYQDTNFYCQGINFINQVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKF 299
            ++D   Y   I+FIN VK       HSP+L DI+  V +WSKV +G++KMY+ EVL K 
Sbjct: 227 LFKDKFLYFGCISFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEVLGKL 285

Query: 300 PVVQHFWFG------TGFFPWIN--VQNGTD 322
           P++QHF+F        G  P  +  + NGTD
Sbjct: 286 PIMQHFYFSEFLKCPEGISPARSNHIHNGTD 316

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  157 bits (397), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 108/314 (34%), Positives = 161/314 (51%), Gaps = 22/314 (7%)

Query: 14  STPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPM---VNGL 70
           S P KR+      + + SS    + K  L  + T ++  A  D   T    P+   V+  
Sbjct: 3   SCPQKRLLTKDDMEIWDSS----QTKKELINFITDLAE-AVKDRDNTQFKEPISAEVSST 57

Query: 71  MAVLDRFAQLIDDTPPL-PGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVVPELQ 129
           +A+LD    ++D+ P L     R+G    R ++  + ++    L +         + +L 
Sbjct: 58  LALLDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTNQIEQLS 117

Query: 130 YYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTD--VFLLFSKYYAIMRRL 187
            Y   S+G+  R+DYG+GHEL+F+  +  L    +F   R +   V L+F KY  IMRRL
Sbjct: 118 IYFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVILVFVKYLKIMRRL 177

Query: 188 ILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTNF 247
              Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + +  +V  ++D   
Sbjct: 178 ETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSNHKHLKPKSIHNDEIVDMFKDKYL 234

Query: 248 YCQGINFINQVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFW 306
           Y   I FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL K PV+QHF+
Sbjct: 235 YFGCIAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLPVMQHFY 293

Query: 307 FG------TGFFPW 314
           F       TG  P+
Sbjct: 294 FSEFLACPTGISPY 307

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  157 bits (396), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 89/249 (35%), Positives = 136/249 (54%), Gaps = 9/249 (3%)

Query: 65  PMVNGLMAVLDRFAQLIDDTPPLPGPR--RYGNLACREWHYKLDAHLAQWLREVLPAQYH 122
           P +   M +L     +ID  P +   +  R+G +  R+++ +L +     +    P+   
Sbjct: 50  PQIESFMGLLKSVNNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAYPSLTE 109

Query: 123 AVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRG--TDVFLLFSKY 180
             + +L  YL  S+G+  R+DYG+GHEL+F+  +  L    +F   +     V  +F +Y
Sbjct: 110 DQLDQLYVYLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNMVLKIFIEY 169

Query: 181 YAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVR 240
             +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + ++ LV 
Sbjct: 170 LRVMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LATHKHLKPLSIHNEELVE 226

Query: 241 EYQDTNFYCQGINFINQVKMG-PFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKF 299
            +QD   Y   + FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL K 
Sbjct: 227 MFQDKYLYFSCVAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKL 285

Query: 300 PVVQHFWFG 308
           P++QHF+FG
Sbjct: 286 PIMQHFYFG 294

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  156 bits (395), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 147/270 (54%), Gaps = 12/270 (4%)

Query: 65  PMVNGLMAVLDRFAQLIDDTPPL--PGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYH 122
           P +  L A+L+    +    P L      R+G +  R++H ++ A     + +V P+   
Sbjct: 58  PAIEALEALLEEMQGIAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALVLQVDPSLTD 117

Query: 123 AVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFL-LFSKYY 181
               EL  YLGN++G   R+DYG+GHEL+F+  +  L   G+      T+  L +F KY 
Sbjct: 118 EQAQELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTNAVLRVFVKYM 177

Query: 182 AIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVRE 241
            +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + +  +V  
Sbjct: 178 DVMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LATHKHLKPKSIHNPEVVEL 234

Query: 242 YQDTNFYCQGINFINQVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFP 300
           +++   Y   I FIN+VK       HSP+L DI+  V  W+KV +G++KMY  EVL K P
Sbjct: 235 FENRYLYFGCIAFINRVKTTASLRWHSPMLDDIS-GVRSWTKVSEGMVKMYKAEVLGKLP 293

Query: 301 VVQHFWFGTGFFPWINVQNGTDLPVFEEKE 330
           ++QHF+F + F P   V +G   P   E+E
Sbjct: 294 IMQHFFF-SRFLP---VPDGVSPPRTSEEE 319

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  156 bits (394), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 93/244 (38%), Positives = 136/244 (55%), Gaps = 9/244 (3%)

Query: 71  MAVLDRFAQLIDDTPPL--PGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVVPEL 128
           M +L +   LID  P +      R+G +  R+++  L  H  + +    P+     V EL
Sbjct: 56  MQLLKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSLNKDQVEEL 115

Query: 129 QYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLR-GTDVFL-LFSKYYAIMRR 186
             YL  S+G+  R+DYG+GHEL+F+  +  L +  +F   R   D+ L +F +Y  IMR 
Sbjct: 116 AVYLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRIMRI 175

Query: 187 LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTN 246
           L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + ++ +V  + D  
Sbjct: 176 LETKYWLEPAGSHGVWGLDDYHFLPFLFGAHQ---LATHPHLRPKSIHNEEVVEMFMDKY 232

Query: 247 FYCQGINFINQVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHF 305
            Y   I FIN VK       HSP+L DI+  V  W+KV +G++KMY  EVL K P++QHF
Sbjct: 233 IYFGCIAFINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKLPIMQHF 291

Query: 306 WFGT 309
           +FG 
Sbjct: 292 YFGN 295

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  156 bits (394), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 136/251 (54%), Gaps = 9/251 (3%)

Query: 67  VNGLMAVLDRFAQLIDDTPPLPGPR--RYGNLACREWHYKLDAHLAQWLREVLPAQYHAV 124
           V  +M +L +   ++   P +      R+G +  R+++  L +     L+E  P+   + 
Sbjct: 52  VESMMKLLHKVQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTD--VFLLFSKYYA 182
           + +L  Y+  S+G+  R+DYG+GHEL+FM  +  L    +F   R     V  +F +Y  
Sbjct: 112 IEQLYVYVDESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVLKVFIQYLK 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREY 242
           +MR L L Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + +  L+  +
Sbjct: 172 LMRVLELQYWLEPAGSHGVWGLDDYHFLPFLFGAYQ---LSTHKHLKPSSIHNDDLIEMF 228

Query: 243 QDTNFYCQGINFINQVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPV 301
            D   Y   I FIN VK       HSP+L DI+  V +WSKV +G+ KMY  EV++K P+
Sbjct: 229 ADKYLYFGCIEFINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPI 287

Query: 302 VQHFWFGTGFF 312
           +QHF+F   F 
Sbjct: 288 MQHFYFNDMFL 298

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  155 bits (392), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 129/223 (57%), Gaps = 10/223 (4%)

Query: 92  RYGNLACREWHYKLDAHLAQWLREVLPAQYH---AVVPELQYYLGNSFGSSTRLDYGTGH 148
           R+G +  R+++  +  H  + + ++           + ++  Y  NS+G  +R+DYG+GH
Sbjct: 78  RFGKIEFRDFYDDISEHSNELISKIFEGIEKPDTGKLDDICTYFINSWGDRSRIDYGSGH 137

Query: 149 ELSFMATVAALDLLGLFPHLRGTD--VFLLFSKYYAIMRRLILTYTLEPAGSHGVWGLDD 206
           EL+F+  +  L    +F     +   V +LF KY  IMR L L Y LEPAGSHGVWGLDD
Sbjct: 138 ELNFICFLYCLTESKVFDLENDSSNIVLMLFIKYLGIMRSLELKYWLEPAGSHGVWGLDD 197

Query: 207 HFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTNFYCQGINFINQVK-MGPFEE 265
           +  L ++ G+ Q   L     L+P+ + +  +V  +QD   Y   I FIN+VK       
Sbjct: 198 YHFLPFLFGAFQ---LSTHKHLKPKSIHNPEVVEMFQDRYLYFGCIAFINKVKTTASLRW 254

Query: 266 HSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFWFG 308
           HSP+L DI+  V RWSKV +G++KMY  EVLQK P++QHF+FG
Sbjct: 255 HSPMLDDIS-GVKRWSKVAEGMVKMYKAEVLQKLPIMQHFYFG 296

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  154 bits (390), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 136/249 (54%), Gaps = 13/249 (5%)

Query: 67  VNGLMAVLDRFAQLIDDTPPLPG---PRRYGNLACREWHYKLDAHLAQWLREVLPAQYHA 123
           V  LM +L +   +I+  P         R+G +  R+++ +L A  A  +    P     
Sbjct: 55  VEALMGLLQQVRGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQLTQN 114

Query: 124 VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTD----VFLLFSK 179
            V +LQ YL  S+G   R+DYG+GHEL+FM  +  L    +F  L GTD    V   F +
Sbjct: 115 QVRQLQTYLEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVF-DLGGTDRANLVLKPFIE 173

Query: 180 YYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLV 239
           Y  IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + ++ +V
Sbjct: 174 YLKIMRVLETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSTHKHLKPLSIHNEEVV 230

Query: 240 REYQDTNFYCQGINFINQVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQK 298
             + D   Y   I+FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL K
Sbjct: 231 ELFADKYLYFGCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVLSK 289

Query: 299 FPVVQHFWF 307
            P++QHF+F
Sbjct: 290 LPIMQHFYF 298

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  152 bits (385), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 155/305 (50%), Gaps = 17/305 (5%)

Query: 16  PVKRIF---DTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPMVNGLMA 72
           P KR+    D Q  Q+ Q+   + +    L      + +     P     SI  V  L+ 
Sbjct: 4   PEKRLLTKDDMQLWQNCQTKSDLLKFLCELADAVKGLENSQYSQP--IGGSIQSVEALIE 61

Query: 73  VLDRFAQLIDDTP-PLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVVPELQYY 131
            +D   Q I++ P    GP R+G    R+ +  +    +  ++E   +     V +L  Y
Sbjct: 62  CVD---QCIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLTDEQVAQLSVY 118

Query: 132 LGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTD--VFLLFSKYYAIMRRLIL 189
              S+G  +R+DYG+GHEL+F+  +  L   G+F   +     V ++F KY   MR +  
Sbjct: 119 FNESWGDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNLVLIVFMKYLKTMRVIET 178

Query: 190 TYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTNFYC 249
            Y LEPAGSHGVWGLDD+  L ++ G+SQ   L     L+P+ + +  +V  + +   Y 
Sbjct: 179 VYWLEPAGSHGVWGLDDYHFLPFLFGASQ---LSTHRHLKPKSIHNPEVVEMFSEKYLYF 235

Query: 250 QGINFINQVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFWFG 308
             I+FIN VK       HSP+L DI+  V  W+KV +G++KMY  EVL K P++QHF+F 
Sbjct: 236 GCIDFINSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEVLCKLPIMQHFYF- 293

Query: 309 TGFFP 313
           + F P
Sbjct: 294 SEFLP 298

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  151 bits (382), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 138/251 (54%), Gaps = 9/251 (3%)

Query: 67  VNGLMAVLDRFAQLIDDTPPL--PGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAV 124
           +  L A+LD  A+++D  P +   G  R+G +  R+++ ++     + +  +        
Sbjct: 52  IENLCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELISSLSSELTDEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFL-LFSKYYAI 183
           V EL  Y   S+G   R+DYG+GHEL+F+  +  L    +       ++ L +F KY  +
Sbjct: 112 VEELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLKVFIKYLDV 171

Query: 184 MRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQ 243
           MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + +  +V  ++
Sbjct: 172 MRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPKSIHNPEIVEVFE 228

Query: 244 DTNFYCQGINFINQVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVV 302
               Y + + FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P++
Sbjct: 229 KRYMYFECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKAEVLGKLPIM 287

Query: 303 QHFWFGTGFFP 313
           QHF+F T F P
Sbjct: 288 QHFFFST-FLP 297

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  151 bits (381), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 140/252 (55%), Gaps = 10/252 (3%)

Query: 67  VNGLMAVLDRFAQLIDDTPPLP--GPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAV 124
           ++ +M +L     +I   P +      R+G +  R+++ ++     ++LR   P+     
Sbjct: 52  ISRMMNLLSYIRDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLRSEFPSLTDEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLL--FSKYYA 182
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F     +   +L  F +Y  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLK 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREY 242
           IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L +   L+P  + +  LV  +
Sbjct: 172 IMRILETRYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTSHKHLKPISIHNNELVEMF 228

Query: 243 QDTNFYCQGINFINQVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPV 301
            +   Y   I+FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P+
Sbjct: 229 ANRYLYFGCIDFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPI 287

Query: 302 VQHFWFGTGFFP 313
           +QHF+F + F P
Sbjct: 288 MQHFYF-SDFLP 298

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  151 bits (381), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 133/246 (54%), Gaps = 9/246 (3%)

Query: 67  VNGLMAVLDRFAQLIDDTPPL--PGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAV 124
           V   +AVL    +LI   P +      R+G +  R+++  +       L    PA     
Sbjct: 52  VQSTIAVLTEIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTSEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTD--VFLLFSKYYA 182
           + +L  YL  S+G+  R+DYG+GHEL+F+  +  L    +F   R     V +LF +Y  
Sbjct: 112 IEQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYLK 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREY 242
           IMR +   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + ++ LV  +
Sbjct: 172 IMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LAPHKHLKPKSIHNEELVEMF 228

Query: 243 QDTNFYCQGINFINQVKMG-PFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPV 301
            D   Y   I FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL K P+
Sbjct: 229 ADKYLYFGCIAFINSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPI 287

Query: 302 VQHFWF 307
           +QHF+F
Sbjct: 288 MQHFYF 293

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  150 bits (378), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 137/252 (54%), Gaps = 10/252 (3%)

Query: 67  VNGLMAVLDRFAQLIDDTPPLPGP--RRYGNLACREWHYKLDAHLAQWLREVLPAQYHAV 124
           +N +M +L +   +    P +      R+G +  R+++ ++  +  + LR   P+     
Sbjct: 52  INSMMNLLSQIKDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTD--VFLLFSKYYA 182
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F     +   V  +F +Y  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLK 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREY 242
           IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + +  LV  +
Sbjct: 172 IMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPISIHNNELVEMF 228

Query: 243 QDTNFYCQGINFINQVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPV 301
                Y   I FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P+
Sbjct: 229 AHRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPI 287

Query: 302 VQHFWFGTGFFP 313
           +QHF+F + F P
Sbjct: 288 MQHFYF-SEFLP 298

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  150 bits (378), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 139/247 (56%), Gaps = 9/247 (3%)

Query: 67  VNGLMAVLDRFAQLIDDTPPL--PGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAV 124
           ++ L ++LD+  +++   P +      R+G +  R+++  L +  ++ +  +        
Sbjct: 52  IDELCSLLDKVNKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLSDKLSTPQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLR-GTDVFL-LFSKYYA 182
           V EL  Y   S+G+ TR+DYG+GHEL+F+  +  L+    F   +  T+V L +F KY  
Sbjct: 112 VDELAAYFRKSWGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKYLD 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREY 242
           +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + +K  V  +
Sbjct: 172 VMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LATHKHLKPKSIHNKEFVEMF 228

Query: 243 QDTNFYCQGINFINQVKMG-PFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPV 301
           +    Y   I FIN VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P+
Sbjct: 229 EKRYLYFGCIGFINSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLPI 287

Query: 302 VQHFWFG 308
           +QHF+FG
Sbjct: 288 MQHFYFG 294

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  149 bits (376), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 133/255 (52%), Gaps = 12/255 (4%)

Query: 60  TASSIPMVNGLMAVLDRFAQLIDDTPPLPGPR--RYGNLACREWHYKLDAHLAQWLREVL 117
           T SSI        +L+  A L +  P        R+G +  R ++  L +     ++   
Sbjct: 48  TGSSI---ESCCQLLEEVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAF 104

Query: 118 PAQYHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLF--PHLRGTDVFL 175
            A       EL  Y   S+G  +R+DYG+GHEL+F+  +  L   G+F  P      V  
Sbjct: 105 DALDGTQCEELSVYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVLK 164

Query: 176 LFSKYYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLD 235
           LF KY  +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ + +
Sbjct: 165 LFIKYLGVMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSTHKHLKPKSIHN 221

Query: 236 KSLVREYQDTNFYCQGINFINQVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294
             +V  +     Y   I+FIN+VK       HSP+L DI+  V  W+KV +G++KMY  E
Sbjct: 222 SEVVEMFGKRYLYFGCIDFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAE 280

Query: 295 VLQKFPVVQHFWFGT 309
           VL K P++QHF+FG+
Sbjct: 281 VLNKLPIMQHFFFGS 295

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  147 bits (372), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 92/252 (36%), Positives = 136/252 (53%), Gaps = 10/252 (3%)

Query: 67  VNGLMAVLDRFAQLIDDTPPL--PGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAV 124
           +  +M +L +   +I   P +      R+G +  R+++ ++  +  + LR   P      
Sbjct: 52  IISMMNLLSQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRSEFPHLTDEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLL--FSKYYA 182
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F     +   +L  F +Y  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQ 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREY 242
           IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + +  LV  +
Sbjct: 172 IMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPISIHNNELVEMF 228

Query: 243 QDTNFYCQGINFINQVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPV 301
                Y   I FIN+VK       HSP+L DI+  V  WSKV +G++KMY VEVL K P+
Sbjct: 229 AHRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLSKLPI 287

Query: 302 VQHFWFGTGFFP 313
           +QHF+F   F P
Sbjct: 288 MQHFYF-CEFLP 298

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  147 bits (371), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 90/252 (35%), Positives = 138/252 (54%), Gaps = 10/252 (3%)

Query: 67  VNGLMAVLDRFAQLIDDTPPL--PGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAV 124
           +  ++++L R   +I+  P +      R+G +  R+++ ++  +  + L+          
Sbjct: 52  ITRMLSLLSRVRDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLKSEFSLLTDEQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLL--FSKYYA 182
           + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F     +   +L  F +Y  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEYLD 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREY 242
           IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  + +  LV  +
Sbjct: 172 IMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPISIHNSELVEMF 228

Query: 243 QDTNFYCQGINFINQVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPV 301
            D   Y   I FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P+
Sbjct: 229 SDRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPI 287

Query: 302 VQHFWFGTGFFP 313
           +QHF+F + F P
Sbjct: 288 MQHFYF-SEFLP 298

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  145 bits (366), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 132/236 (55%), Gaps = 11/236 (4%)

Query: 92  RYGNLACREWHYKLDAHLAQWLREVLPAQYHAVVPELQYYLGNSFGSSTRLDYGTGHELS 151
           R+G +  + ++  ++ +  + ++          + EL  YL  S+G+  R+DYG+GHEL+
Sbjct: 80  RFGKVEFKSFYDDINQNSEKLIKSHFNGLDPNQIQELSIYLVESWGNRQRIDYGSGHELN 139

Query: 152 FMATVAALDLLGLFPHLRGTD--VFLLFSKYYAIMRRLILTYTLEPAGSHGVWGLDDHFH 209
           F+  +  L    +F  L  +   V  +F +Y  IMR +   Y LEPAGSHGVWGLDD+  
Sbjct: 140 FICFLYGLTKYNIFNLLEDSTNLVLKIFMEYINIMRIIETKYWLEPAGSHGVWGLDDYHF 199

Query: 210 LVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTNFYCQGINFINQVK-MGPFEEHSP 268
           L ++ G+ Q   L     L+P  + ++ +V  ++D   Y   I+FIN +K       HSP
Sbjct: 200 LPFLFGAFQ---LSKHKHLKPISIHNEEMVEMFKDKYMYFGCIDFINSIKTTATLRWHSP 256

Query: 269 ILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFWFGTGFFPWINVQNGTDLP 324
           +L DI+  V +WSKV +G++KMYS EVL K P++QHF+F + F P      G  LP
Sbjct: 257 MLDDIS-GVKKWSKVSEGMIKMYSAEVLGKLPIMQHFYF-SDFLP---CPQGVSLP 307

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  141 bits (355), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 118/221 (53%), Gaps = 7/221 (3%)

Query: 92  RYGNLACREWHYKLDAHLAQWLREVLPAQYHAVVPELQYYLGNSFGSSTRLDYGTGHELS 151
           R+G +  R ++  L       + +           EL  Y   S+G   R+DYG+GHEL+
Sbjct: 79  RFGKIEFRHFYDDLRIKAQDLISKEFDQLSQDQAEELVAYFVESWGDRERIDYGSGHELN 138

Query: 152 FMATVAALDLLGLFPHLRGTD--VFLLFSKYYAIMRRLILTYTLEPAGSHGVWGLDDHFH 209
           F+  +  L   GLF   R     V  +F  Y  +MR L  TY LEPAGSHGVWGLDD+  
Sbjct: 139 FICFLYGLKDCGLFERSRDYRNLVLKVFIHYLELMRVLETTYWLEPAGSHGVWGLDDYHF 198

Query: 210 LVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTNFYCQGINFINQVK-MGPFEEHSP 268
           L ++ G+SQ   L     L+P+ + +  LV  +     Y   I+FIN+VK       HSP
Sbjct: 199 LPFLFGASQ---LAPHKHLKPKSIHNNELVDMFASRYLYFGCIDFINRVKTTASLRWHSP 255

Query: 269 ILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFWFGT 309
           +L DI+     WSKV +G++KMY  EVL K P++QHF FG+
Sbjct: 256 MLDDIS-GAKSWSKVAEGMIKMYRKEVLAKLPIMQHFLFGS 295

>Kpol_1053.33 s1053 complement(52288..54078) [1791 bp, 596 aa] {ON}
           complement(52288..54078) [1791 nt, 597 aa]
          Length = 596

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 60/131 (45%), Gaps = 12/131 (9%)

Query: 27  QDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPMVNGLMAVLDRFAQLIDDTPP 86
           +D ++ +     KY +H    L ++   P       S  +  GL+ V D F  ++++   
Sbjct: 181 EDLRTIILERSKKYIIHAIKALRNYHPVP-------SQKIQKGLLEVKDIFQYIVENNYS 233

Query: 87  LPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVVPELQYYLGNSFGSSTRLDYGT 146
           L    R        W+YK   + ++++R +   Q+  +  + QY+LGN   S+T ++Y  
Sbjct: 234 LALELRQAYSYTMRWYYK--NYFSRYIRSLTILQFRNI--DAQYFLGNGL-SNTSVNYLN 288

Query: 147 GHELSFMATVA 157
           G+ ++   T +
Sbjct: 289 GYSITNYLTAS 299

>YGL220W Chr7 (82374..82736) [363 bp, 120 aa] {ON}  FRA2Protein
           involved in negative regulation of transcription of iron
           regulon; forms an iron independent complex with Fra2p,
           Grx3p, and Grx4p; null mutant fails to repress iron
           regulon and is sensitive to nickel
          Length = 120

 Score = 30.0 bits (66), Expect = 3.7,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 99  REWHYKL---DAHLAQWLREVLPAQYHAVVPELQYYLGNSFGSSTRLDYGTG 147
           R+ HYK+   +  L + +   +P  YH +V +L Y  G SF      D+  G
Sbjct: 30  RQRHYKMPVTEQGLRERIESAIPQVYHIIVTDLSYGCGQSFDIVVVSDFFQG 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,151,930
Number of extensions: 1806969
Number of successful extensions: 3840
Number of sequences better than 10.0: 42
Number of HSP's gapped: 3795
Number of HSP's successfully gapped: 42
Length of query: 393
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 281
Effective length of database: 40,638,807
Effective search space: 11419504767
Effective search space used: 11419504767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)