Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.325.711ON53853829060.0
YIL155C (GUT2)5.711ON64953828180.0
Skud_9.135.711ON64953828150.0
Smik_9.145.711ON65253828000.0
KAFR0D021705.711ON66054920360.0
NCAS0G001805.711ON65454220280.0
Kwal_55.196495.711ON64154020250.0
SAKL0E15114g5.711ON64954220180.0
KLTH0E00836g5.711ON64154020100.0
CAGL0H06699g5.711ON65054520060.0
NDAI0F002105.711ON65354519860.0
KLLA0A00418g5.711ON64254219640.0
TDEL0B020905.711ON64354019490.0
TPHA0E001505.711ON64653819450.0
TBLA0E017505.711ON66554519330.0
Ecym_40105.711ON64454219020.0
ZYRO0B16522g5.711ON64354218880.0
Kpol_1043.775.711ON65755018890.0
AFR295W5.711ON63153918670.0
KNAG0L021905.711ON64554117570.0
CAGL0M00770g4.327ON1088138830.20
Smik_13.4086.294ON256159790.34
Kwal_27.110826.169ON50386751.6
SAKL0G16610g4.296ON1966113733.3
Smik_13.5105.32ON378136713.9
KLLA0F16819g1.487ON64152706.2
Kpol_1008.77.505ON79995698.0
SAKL0E06512gna 1ON40327688.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.32
         (538 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...  1123   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...  1090   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...  1088   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...  1083   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   788   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   785   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   784   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   781   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   778   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   777   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   769   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   761   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   755   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   753   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   749   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   737   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   731   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   732   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   723   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   681   0.0  
CAGL0M00770g Chr13 (86290..89556) [3267 bp, 1088 aa] {ON} weakly...    37   0.20 
Smik_13.408 Chr13 (648920..649690) [771 bp, 256 aa] {ON} YMR200W...    35   0.34 
Kwal_27.11082 s27 complement(631427..632938) [1512 bp, 503 aa] {...    33   1.6  
SAKL0G16610g Chr7 (1434140..1440040) [5901 bp, 1966 aa] {ON} sim...    33   3.3  
Smik_13.510 Chr13 (839587..840723) [1137 bp, 378 aa] {ON} YMR294...    32   3.9  
KLLA0F16819g Chr6 (1548402..1550327) [1926 bp, 641 aa] {ON} unip...    32   6.2  
Kpol_1008.7 s1008 complement(9101..11500) [2400 bp, 799 aa] {ON}...    31   8.0  
SAKL0E06512g Chr5 (532120..533331) [1212 bp, 403 aa] {ON} conser...    31   8.6  

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score = 1123 bits (2906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/538 (100%), Positives = 538/538 (100%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 181 LQMDRNASGQPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLDV 240
           LQMDRNASGQPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLDV
Sbjct: 181 LQMDRNASGQPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLDV 240

Query: 241 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 300
           RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV
Sbjct: 241 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 300

Query: 301 LSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 360
           LSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE
Sbjct: 301 LSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 360

Query: 361 TIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTRS 420
           TIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTRS
Sbjct: 361 TIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTRS 420

Query: 421 SIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEYCR 480
           SIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEYCR
Sbjct: 421 SIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEYCR 480

Query: 481 TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538
           TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV
Sbjct: 481 TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score = 1090 bits (2818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/538 (95%), Positives = 529/538 (98%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIY+TWQVPYI
Sbjct: 112 MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYI 171

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           Y GCKFYDFFAG QNLK SYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA
Sbjct: 172 YMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 231

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           ITAVENGATVLNYVEVQKLIKDP SGKV+GAEARDVETNELVRINAKCVVNATGPYSDAI
Sbjct: 232 ITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAI 291

Query: 181 LQMDRNASGQPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLDV 240
           LQMDRN SG P+SPLNDNSKIKS FNQ+AVMDP+MVIPSIGVHIVLPSFYCPKD+GLLDV
Sbjct: 292 LQMDRNPSGLPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDV 351

Query: 241 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 300
           RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV
Sbjct: 352 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 411

Query: 301 LSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 360
           LSAWAGVRPLVRDPR+IPA GKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE
Sbjct: 412 LSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 471

Query: 361 TIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTRS 420
           T+DKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV+NYGTRS
Sbjct: 472 TVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRS 531

Query: 421 SIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEYCR 480
           SIICEFFK+SMENKLPLSLADKENN IYS+EENNLVNFDTFRYPFTIGELKYSMQYEYCR
Sbjct: 532 SIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCR 591

Query: 481 TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538
           TPLDFLLRRTRFAFLDAKEALN+VHATVKVMGDEFNWS+KKRQWELEKTVNFIKTFGV
Sbjct: 592 TPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score = 1088 bits (2815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/538 (95%), Positives = 527/538 (97%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI
Sbjct: 112 MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 171

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           Y GCKFYDFFAG QNLK SYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA
Sbjct: 172 YMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 231

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           ITAVENGATVLNYVEVQ+LIKDPASGKVVGAEARDVETNELV+INAKCVVNATGPYSDAI
Sbjct: 232 ITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAI 291

Query: 181 LQMDRNASGQPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLDV 240
           LQMDRN SGQPNSPLNDNS IKS FNQ+AV DP+MVIPSIGVHIVLPSFYCPKD+GLLDV
Sbjct: 292 LQMDRNPSGQPNSPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLDV 351

Query: 241 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 300
           RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV
Sbjct: 352 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 411

Query: 301 LSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 360
           LSAWAGVRPLVRDPR+IPA GKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE
Sbjct: 412 LSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 471

Query: 361 TIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTRS 420
           T+DKVVEVG FHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV+NYGTRS
Sbjct: 472 TVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRS 531

Query: 421 SIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEYCR 480
           SIICEFFK+SMENKLPLSLADKENN IYS+EENNLVNFDTFRYPFTIGELKYSMQYEYCR
Sbjct: 532 SIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCR 591

Query: 481 TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538
           TPLDFLLRRTRFAFLDAKEALNS HATVKVMGDEFNWS+KKRQWELEKT+NFIKTFGV
Sbjct: 592 TPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score = 1083 bits (2800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/538 (95%), Positives = 527/538 (97%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIY+T QVPYI
Sbjct: 115 MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYI 174

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           Y GCKFYDFFAG QNLK SYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA
Sbjct: 175 YMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 234

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           ITAVENGATVLNYVEVQKLIKDPASGKV+GAEARDVETNEL+RI AKCVVNATGPYSDAI
Sbjct: 235 ITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAI 294

Query: 181 LQMDRNASGQPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLDV 240
           LQMDRN SGQP+SPLNDNSK KSAFNQ+AVMDP+MVIPSIGVHIVLPSFYCPKD+GLLDV
Sbjct: 295 LQMDRNPSGQPDSPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDV 354

Query: 241 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 300
           RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV
Sbjct: 355 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 414

Query: 301 LSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 360
           LSAWAGVRPLVRDPR+IPA GKKGSATQGVVRSHFLFTSDN LITIAGGKWTTYRQMAEE
Sbjct: 415 LSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEE 474

Query: 361 TIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTRS 420
           TIDKVVEVGGFHNL PCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV+NYGTRS
Sbjct: 475 TIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRS 534

Query: 421 SIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEYCR 480
           SIICE+FK+SMENKLPLSLADKENN IYS+EENNLVNFDTFRYPFTIGELKYSMQYEYCR
Sbjct: 535 SIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCR 594

Query: 481 TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538
           TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWS+KKRQWELEKTVNFIKTFGV
Sbjct: 595 TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/549 (66%), Positives = 445/549 (81%), Gaps = 16/549 (2%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKAFWE SKAQLDLVIEALNER HL+NTAPHLC +LPI+IP+YN WQ+PY 
Sbjct: 117 MAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYF 176

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           YAGCK YD FAG QNLKSSYLLSK +  + APML T  LKA LVYHDG+FNDSR+N+TLA
Sbjct: 177 YAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLA 236

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           +TA+ENG+TVLNY+EV++L+K+  SGK+ GA   D+ET +   I AK V+NATGPYSDAI
Sbjct: 237 VTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAI 296

Query: 181 LQMDRNASGQPNSPLNDNSKIKSAF-NQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLD 239
           LQMD+N +G P+ PLN N K  +    +V+V +P+MV+PS GVHI+LPSFYCPKDIGLLD
Sbjct: 297 LQMDQNPTGLPD-PLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLD 355

Query: 240 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 299
            +TSDGRVMFFLPWQGKVLAGTTD+P+KQ+PENP  TEADIQDILKELQHYI FPVKRED
Sbjct: 356 AKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKRED 415

Query: 300 VLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAE 359
           VLSAWAG+RPLV+DPR++   G    +TQG+VRSHF+FTSD+GL+TIAGGKWTTYR MAE
Sbjct: 416 VLSAWAGIRPLVKDPRTLDKNGD--GSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAE 473

Query: 360 ETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTR 419
           ET+D+ ++VG F N+KPC TRDIKLAG E W  N  ALLAQ YHLSSK+S +L +NYGTR
Sbjct: 474 ETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADNYGTR 533

Query: 420 SSIICEFFKDSMENKLPLSLA----------DKENNTIYSNEENNLVNFDTFRYPFTIGE 469
           + IICE +    +NKLP++LA          +  N+ IY+NE  ++  F+ FRYPFT+GE
Sbjct: 534 APIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDV--FECFRYPFTVGE 591

Query: 470 LKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKT 529
           +KYS+ YEY  T LDFL+RR+RFAFLDAKEA+++V  TVK+MGDE NW + +R  E+E T
Sbjct: 592 VKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENT 651

Query: 530 VNFIKTFGV 538
           + +IKTFGV
Sbjct: 652 IKYIKTFGV 660

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/542 (69%), Positives = 441/542 (81%), Gaps = 10/542 (1%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKAF++ SK+QLDLVIEALNER HL+NTAPHLC +LPILIP+Y  WQVPY 
Sbjct: 119 MAHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYF 178

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           YAGCK YD FAG QNLK+SYLLS+S  +E APML   NLKA+LVYHDGSFNDSRLNATLA
Sbjct: 179 YAGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLA 238

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           ITA+E GATVLNYVEVQKL+KD  +G + G   RD+ET + + + +K VVNATGP+SD I
Sbjct: 239 ITAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKI 298

Query: 181 LQMDRNASGQPNSPLNDNSKI---KSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGL 237
           LQMD+N +G P+  +N N K+   +   +++AV +P MV+PS GVHI+LPS+YCPK +GL
Sbjct: 299 LQMDKNPTGLPDD-MNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGL 357

Query: 238 LDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKR 297
           LDVRTSDGRVMFFLPWQGKV+AGTTDIP+ QVPE P+  EADIQDILKELQHYI+FPVKR
Sbjct: 358 LDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKR 417

Query: 298 EDVLSAWAGVRPLVRDPRSIPAGGKKG-SATQGVVRSHFLFTSDNGLITIAGGKWTTYRQ 356
           EDVLSAWAG+RPLVRDPR +    KK   +TQG+VRSHF+FTSDNGL+TIAGGKWTTYR+
Sbjct: 418 EDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYRE 477

Query: 357 MAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENY 416
           MAEETID+VV+ G F + KPC TR++KLAGAE W  N  ALL+Q Y+L S M+NYL +NY
Sbjct: 478 MAEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNY 537

Query: 417 GTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQY 476
           GTRS IICE F +   NKLP+ LA +E   I  N      +F+TFRYP TIGELKYSM+Y
Sbjct: 538 GTRSPIICELFLNDEINKLPVLLAGEEKEQILGN-----TDFNTFRYPITIGELKYSMRY 592

Query: 477 EYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTF 536
           EY RT LDFL+RRTRFAFLDAKEAL +V  TVK+MGDEFNWS ++RQ E EKT+ FIK+F
Sbjct: 593 EYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSF 652

Query: 537 GV 538
           GV
Sbjct: 653 GV 654

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/540 (68%), Positives = 431/540 (79%), Gaps = 9/540 (1%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC VLPI+IP+YN WQVPY 
Sbjct: 109 MAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYF 168

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           Y GCK YD FAG QNLKSSY++S     E APML    LKA LVYHDGSFNDSR+NA LA
Sbjct: 169 YVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALA 228

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           +TA+E GATVLNY+EV +L+K+  SG++ GA  RD ET E  RI AK VVN+TGP+SD +
Sbjct: 229 VTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRL 288

Query: 181 LQMDRNASGQPNSPLND--NSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLL 238
           LQMD    G+P + L    N    S  +++AV +P MV+PS GVHIVLP+FYCPK+IGLL
Sbjct: 289 LQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLL 348

Query: 239 DVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRE 298
           D +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQDILKELQHYI+FPVKR 
Sbjct: 349 DAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRG 408

Query: 299 DVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 358
           DVLSAWAG+RPL+RDPR+I  G    S+TQG+VR+HFL+TSDNGL+TIAGGKWTTYR+MA
Sbjct: 409 DVLSAWAGIRPLIRDPRTIKEGDDV-SSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMA 467

Query: 359 EETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGT 418
           EETID+VV+ G F   KPC T+ IKLAGAE W  N+VA+LAQ YHLSSKM+ +L  NYGT
Sbjct: 468 EETIDEVVKQGKFQ-AKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGT 526

Query: 419 RSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEY 478
           RS IICE FK   +N+LP++   +EN T+Y N     VNFD+FRYPFTIGELKYSMQYEY
Sbjct: 527 RSPIICEMFKRDEKNQLPVTFGGRENVTVYKN-----VNFDSFRYPFTIGELKYSMQYEY 581

Query: 479 CRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538
            RT LDFL+RRTRF FLDA++AL +V  TV VMGDE  WSD +RQ E ++   FIKTFG+
Sbjct: 582 TRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/542 (68%), Positives = 433/542 (79%), Gaps = 10/542 (1%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKAFWE SKAQLDLV+EALNER H++ TAPHLC +LPI+IP+YN WQ PY 
Sbjct: 114 MAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYF 173

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           Y GCK YD FAG QNLKSSY+L+ S   E APML    LKA LVYHDGSFNDSR+NATLA
Sbjct: 174 YVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLA 233

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           +TAVE GATVLNY+EV++LIK+  +GKV GA A+D ET E  RI AK VVNATGP+SD I
Sbjct: 234 VTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRI 293

Query: 181 LQMDRNASGQPNSPLNDNSKIKSAF-NQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLD 239
           LQMD ++ G P+  L  +S I +   ++VAV +P+MV+PS GVHIVLPSFYCPK+IGLLD
Sbjct: 294 LQMDEDSKGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLD 353

Query: 240 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 299
            +TSDGRVMFFLPWQGKVLAGTTDIP+KQ+PENP  TEADIQDILKELQHYI+FPVKRED
Sbjct: 354 AKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKRED 413

Query: 300 VLSAWAGVRPLVRDPRSIPAGGK---KGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQ 356
           VLSAWAG+RPLV+DPR            S+TQ +VRSHFLFTSDN L+TIAGGKWTTYR+
Sbjct: 414 VLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYRE 473

Query: 357 MAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENY 416
           M+EETI++VV+VG F N KPC TR +KLAGAE +  N  A+LAQ YHLSSKM+ YL  NY
Sbjct: 474 MSEETINEVVKVGKF-NAKPCITRKLKLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNY 532

Query: 417 GTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQY 476
           GTR+ +ICE FKD  +NKLP++   KEN T+Y N     V+FD+FRYPFTIGELKYS+  
Sbjct: 533 GTRAPLICELFKDDDKNKLPMAFGGKENVTVYGN-----VDFDSFRYPFTIGELKYSINN 587

Query: 477 EYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTF 536
           EY RT LDFL+RRTR+AFLDAK+AL +V  TVKVMGDE +W   +RQ E EK   FIKTF
Sbjct: 588 EYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTF 647

Query: 537 GV 538
           GV
Sbjct: 648 GV 649

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/540 (68%), Positives = 431/540 (79%), Gaps = 9/540 (1%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC VLPI+IP+YN WQVPY 
Sbjct: 109 MAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYF 168

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           Y GCK YD FAG QNLKSSY+++     E APML    LKA LVYHDGSFNDSR+NA LA
Sbjct: 169 YVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALA 228

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           +TA+E GATVLNY+EV +L+K+  +G+V GA ARD ET +  RINAK VVN+TGP+SD I
Sbjct: 229 VTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRI 288

Query: 181 LQMDRNASGQPNSPLND--NSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLL 238
           LQMD    G P + L    N    S  ++VAV +P MV+PS GVHIVLP+FYCPK IGLL
Sbjct: 289 LQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQIGLL 348

Query: 239 DVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRE 298
           D +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQDILKELQHYI+FPVKRE
Sbjct: 349 DAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRE 408

Query: 299 DVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 358
           DVLSAWAG+RPLVRDPR++  G    S+TQG+VR+HFLFTSDNGL+TIAGGKWTTYR+MA
Sbjct: 409 DVLSAWAGIRPLVRDPRTLKEGDDV-SSTQGLVRNHFLFTSDNGLVTIAGGKWTTYREMA 467

Query: 359 EETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGT 418
           EETID+VV+ G F   KPC T+ IKLAGAE W  N+VA+LAQ YHLSSKM+ +L  NYGT
Sbjct: 468 EETIDEVVKQGHFQ-AKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGT 526

Query: 419 RSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEY 478
           RS IICE F+   +N+LP++   +EN T+Y N     VNFD+FRYPFTI ELKYS++YEY
Sbjct: 527 RSPIICEMFRRDEKNQLPVTFGGRENVTVYKN-----VNFDSFRYPFTIAELKYSVKYEY 581

Query: 479 CRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538
            RT LDFL+RRTRF FLDAK+AL +V  TV +MGDE  W + KR  E+++  +FIKTFGV
Sbjct: 582 TRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/545 (68%), Positives = 434/545 (79%), Gaps = 17/545 (3%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKAFWE SKAQLDLVIEALNER HL+NTAPHLC +LPI+IP+YN WQVPY 
Sbjct: 116 MAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLCKLLPIIIPVYNYWQVPYF 175

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           YAGCK YD FAG QNLK SYL+SK+AT+E APML   NLKA LVYHDGSFND+R+NATLA
Sbjct: 176 YAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAGLVYHDGSFNDTRMNATLA 235

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           +TA+EN ATVLNY+EV++L+KD   GKV GA   D ET +   + AK VVNATGPYSD +
Sbjct: 236 VTAIENSATVLNYMEVKQLVKD-KDGKVAGAVVEDRETGKTYSVRAKVVVNATGPYSDRL 294

Query: 181 LQMDRNASGQPN------SPLND-NSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPK 233
           LQMD N  G P+       P+ D N+ +KS  +QVAV  P MV+PS GVHI+LPSFYCPK
Sbjct: 295 LQMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTKPNMVVPSAGVHIILPSFYCPK 354

Query: 234 DIGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEF 293
           ++GLLD +TSDGRVMFFLPWQGKVLAGTTDIPLKQVPENP  TEADIQDILKELQ YI+F
Sbjct: 355 EMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPTATEADIQDILKELQPYIKF 414

Query: 294 PVKREDVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTT 353
           PVKREDVLSAWAG+RPLV DPR      K   +TQG+VRSHF+FTSD+GL+TIAGGKWTT
Sbjct: 415 PVKREDVLSAWAGIRPLVTDPRK---KSKADGSTQGLVRSHFIFTSDHGLVTIAGGKWTT 471

Query: 354 YRQMAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV 413
           YR MAEETID+VV+ G F + KPC TR +KLAGAE W  N  ALLAQ YHLS KMS+YL 
Sbjct: 472 YRAMAEETIDEVVKNGKF-DAKPCITRKLKLAGAENWDPNLPALLAQKYHLSQKMSHYLA 530

Query: 414 ENYGTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYS 473
           ENYGTR+ +ICE F +  EN+LPL LADKE   +  +     V+FD+FRYP TI ELKY+
Sbjct: 531 ENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLGH-----VDFDSFRYPITIAELKYA 585

Query: 474 MQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFI 533
           ++YEY RT LDFL+RRTRFAFLDAK+ALN+V  TV++MGD   W +++RQ E+  +  FI
Sbjct: 586 IKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGDSLGWDEQRRQDEIRYSTEFI 645

Query: 534 KTFGV 538
           KTFGV
Sbjct: 646 KTFGV 650

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/545 (66%), Positives = 438/545 (80%), Gaps = 15/545 (2%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKAF +FSK+QLDLVIEALNER HL+NTAPHLC +LPILIP+YN WQ+PY 
Sbjct: 117 MAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYF 176

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           YAGCKFYDFFAG QNLKSSYL+S+   +E APML   NLKA+LVYHDGSFNDSRLN+++A
Sbjct: 177 YAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIA 236

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           ITA+ENGATVLNYVEV+KL+KDP S K++G   +D ET E+  + +K +VNATGPYSD I
Sbjct: 237 ITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTI 296

Query: 181 LQMDRNASGQP-----NSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDI 235
           LQMD+N SG P     +  + D + I S   ++AV +P+MV+PS GVHI+LPS+YCPK +
Sbjct: 297 LQMDKNLSGLPDLANIDPKMYDPNDISS---KIAVSNPKMVVPSSGVHIILPSYYCPKQM 353

Query: 236 GLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPV 295
           GLLD RT+DGRVMFFLPWQGKV+AGTTDIP+ QVP+ P+  E DIQDILKELQHYI+FPV
Sbjct: 354 GLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPV 413

Query: 296 KREDVLSAWAGVRPLVRDPRSI-PAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTY 354
           +REDVLSAWAG+RPLVRDPR I     +K   TQG+VRSHFLFTSDNGLITIAGGKWTTY
Sbjct: 414 RREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTY 473

Query: 355 RQMAEETIDKVVEVGGFHNL-KPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV 413
           R+MAEETID+VV+ G F N  KPC T+D+KL GAE W  N VALL+Q ++LSS M+ YL 
Sbjct: 474 REMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLS 533

Query: 414 ENYGTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYS 473
           ENYGTRS+IIC+ F+    NKLP+ LA  E+  I  N     V+F+TFRYP TI ELKY+
Sbjct: 534 ENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGN-----VDFNTFRYPITIAELKYA 588

Query: 474 MQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFI 533
           M+YEY RTPLDFL+RRTRFA+LDA +AL +V  TVKVMGDEF W  K+R+ E++    FI
Sbjct: 589 MKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFI 648

Query: 534 KTFGV 538
           ++FGV
Sbjct: 649 ESFGV 653

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/542 (66%), Positives = 434/542 (80%), Gaps = 16/542 (2%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC +LPI+IP+YN WQVPY 
Sbjct: 113 MAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYF 172

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           Y G K YD FAG QNLKSSYLLS S   E APML    LKA LVYHDGSFNDSR+N++LA
Sbjct: 173 YVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLA 232

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           ITA+E GATVLNYV++++L+K+  +GKV GA A D ET +  +I AK VVNATGPYSD +
Sbjct: 233 ITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRL 292

Query: 181 LQMDRNASGQPNSP----LNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIG 236
           LQMD++ +G P+      +N+N+ + +   ++AV +P+MV+PS GVHIVLPSFYCPK+IG
Sbjct: 293 LQMDQSPTGLPDDSVLQKINENATVST---KIAVPNPKMVVPSAGVHIVLPSFYCPKEIG 349

Query: 237 LLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVK 296
           LLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQ+PENP  TEADIQDILKELQHYI FPVK
Sbjct: 350 LLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVK 409

Query: 297 REDVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQ 356
           REDVLSAWAG+RPLV+DPR   +G     +TQ +VRSHFLFTS + L+TI+GGKWTTYR+
Sbjct: 410 REDVLSAWAGIRPLVKDPRKADSG---SGSTQQLVRSHFLFTSPSNLVTISGGKWTTYRE 466

Query: 357 MAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENY 416
           MAEETID+VV+VG F N KPC T+ +KL G E W  N  ALL+Q YHLSS MS +L  NY
Sbjct: 467 MAEETIDEVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNY 525

Query: 417 GTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQY 476
           GTR+ +ICE F +   NKLP++LA +EN +++ +     V++D+FRYP+TIGELKYS++Y
Sbjct: 526 GTRAPLICELFNEDPRNKLPVALAGQENVSVFGH-----VDYDSFRYPYTIGELKYSLKY 580

Query: 477 EYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTF 536
           EY R  LDFL+RRTR+AFLDAK+ALN+V  TVKVMGDE  W  KKRQ E+++   +IKTF
Sbjct: 581 EYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTF 640

Query: 537 GV 538
           GV
Sbjct: 641 GV 642

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/540 (65%), Positives = 430/540 (79%), Gaps = 14/540 (2%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKA ++ SKAQLDLVIEALNER H++NTAPHLC +LPI+IP+Y  WQ+PY 
Sbjct: 116 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCKILPIMIPVYTYWQIPYF 175

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           Y GCK YD FAG QNLK+SYLL+K    + APML    LKA LVYHDGSFNDSR+N  LA
Sbjct: 176 YVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGLVYHDGSFNDSRMNTALA 235

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           +TA+ENGATVLNY+EV++LIKD  +GKV GA   + ET E   + AK  VNATGPYSD +
Sbjct: 236 VTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFTVKAKVTVNATGPYSDKL 295

Query: 181 LQMDRNASGQPN--SPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLL 238
           LQMD N  G+P+   PL  N+ I +   +VAV +P+MV+PS GVHI+LPSFYCP+++GLL
Sbjct: 296 LQMDENKDGKPDPTKPL-PNATIST---KVAVENPKMVVPSAGVHIILPSFYCPREMGLL 351

Query: 239 DVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRE 298
           DV+TSDGRVMFFLPWQGKVLAGTTDIP+KQVP+ P   E+DIQDIL+ELQHYI+FPVKRE
Sbjct: 352 DVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESDIQDILQELQHYIKFPVKRE 411

Query: 299 DVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 358
           DVLSAWAG+RPLV DPR   + G  G +TQG+VRSH  FT+DNG++TIAGGKWTTYR+MA
Sbjct: 412 DVLSAWAGIRPLVIDPRK--SQGNTGGSTQGLVRSHLCFTTDNGMVTIAGGKWTTYREMA 469

Query: 359 EETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGT 418
           EETI++VV+VG F N+KPC TR +KL+GAE W  N  ALLAQ YHLS  MSN+L ENYGT
Sbjct: 470 EETINEVVKVGKF-NVKPCITRKLKLSGAENWNPNLAALLAQKYHLSGAMSNHLSENYGT 528

Query: 419 RSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEY 478
           R+ +ICE F++   N+LP++   +EN T+Y N     VNFD+FRYPFTIGEL YS+ YEY
Sbjct: 529 RAPLICEMFQEDERNQLPVTFGGRENVTVYGN-----VNFDSFRYPFTIGELNYSVDYEY 583

Query: 479 CRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538
            RT LDFL+RRTRFAFLDA++AL++V  TV VMGD+ NW   +R+ E+EK+  FI+TFGV
Sbjct: 584 TRTALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTRRKHEIEKSKEFIRTFGV 643

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/538 (65%), Positives = 427/538 (79%), Gaps = 12/538 (2%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKA ++ SKAQLDLVIEALNER HL+ TAPHLC +LPI+IP+Y  WQVPY 
Sbjct: 121 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYKYWQVPYF 180

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           YAG K YD FAG QNLKSSYL+SK+   E APML    LKA LVYHDG+FNDSR+N+TLA
Sbjct: 181 YAGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAGLVYHDGTFNDSRMNSTLA 240

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           ITA+ENGATVLNY+EV++L+KDP+S ++ GA   D+ET E ++INAK +VNATGPYSD I
Sbjct: 241 ITAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKIQINAKVIVNATGPYSDKI 300

Query: 181 LQMDRNASGQPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLDV 240
           LQMD N +G+P+      S   S   +VAV +P MV+PS GVHI+LPSFYCP+++GLLD 
Sbjct: 301 LQMDNNKNGKPDE--FTQSAETSIATKVAVQNPHMVVPSAGVHIILPSFYCPREMGLLDA 358

Query: 241 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 300
            TSDGRVMFFLPWQGKVLAGTTDIP+K VPENP  TEADIQDILKELQHYI+FPVKREDV
Sbjct: 359 NTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHYIKFPVKREDV 418

Query: 301 LSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 360
           LSAWAG+RPLV+DPR  P  G    ATQ +VRSHF+FTSD+GL+TIAGGKWTTYR+MAEE
Sbjct: 419 LSAWAGIRPLVQDPRKTPKEG----ATQELVRSHFIFTSDHGLVTIAGGKWTTYREMAEE 474

Query: 361 TIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTRS 420
           TID VV+ G F N+KPC TR +KLAG E +  N  ALLAQ YHL SK+S +L  NYGTRS
Sbjct: 475 TIDTVVKNGKF-NVKPCSTRKLKLAGGENYDPNLAALLAQKYHLPSKLSEHLANNYGTRS 533

Query: 421 SIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEYCR 480
            +IC+ F     N+LP+ LA KE N +Y       V+FD+FRYP++I E+KY + +EY R
Sbjct: 534 PLICDMFVADDHNRLPIYLAGKEENKVYGT-----VDFDSFRYPYSIAEVKYCVHHEYAR 588

Query: 481 TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538
           T LDFL+RR+RFAFLDAK+AL SV  TVK+MGDE NW +++R+ E + ++ +IKTFGV
Sbjct: 589 TTLDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWDEERRKQETDYSIEYIKTFGV 646

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/545 (64%), Positives = 432/545 (79%), Gaps = 13/545 (2%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKA ++ SKAQLDLVIEALNERKH++ TAPHLC +LPI+IP+YN W+VPY 
Sbjct: 127 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYF 186

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           YAGCK YDFFAG QNLKS+YLLSK++  + APML    LKA+LVYHDGSFND+R+N +LA
Sbjct: 187 YAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLA 246

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           +TA+ENGATVLNY+EV+KLIKDP +GK+ GA  RD ET++   + AK VVN+TGP+SD I
Sbjct: 247 VTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNI 306

Query: 181 LQMDRNASGQPN--SPLN-DNSKIKSA----FNQVAVMDPEMVIPSIGVHIVLPSFYCPK 233
           LQMDRN SG P+     N D SK+ S      +++AV +P+MV+PS GVHI+LPS+YCPK
Sbjct: 307 LQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYCPK 366

Query: 234 DIGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEF 293
           D+G+LDV+T+DGRVMFFLPWQ KVLAGTTDIP+K+VPENP+ TEADI+DIL ELQHY +F
Sbjct: 367 DMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKF 426

Query: 294 PVKREDVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTT 353
           PVKREDVLSAWAG+RPLVRDPR +    K   +TQG+VRSHF+FTS+N L+TIAGGKWTT
Sbjct: 427 PVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKWTT 486

Query: 354 YRQMAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV 413
           YR+MAEETID+ ++VG   N KP  T+D+ L+G E WT N  ALL+Q YH+ S +S YL 
Sbjct: 487 YRRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKYLS 545

Query: 414 ENYGTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYS 473
           ENYGTR+ IICE  K   +N+LP++LA KE+N I  N     V+F   RYP+T+ E+KY 
Sbjct: 546 ENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGN-----VDFQALRYPYTVAEVKYC 600

Query: 474 MQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFI 533
           +  EY RT LDFLLRRTRF FLDAKEA+N+V  TV +MGDE NW  +KR  E++K+  +I
Sbjct: 601 IDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYI 660

Query: 534 KTFGV 538
           KT GV
Sbjct: 661 KTLGV 665

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/542 (64%), Positives = 424/542 (78%), Gaps = 21/542 (3%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKAFWE SKAQLDLVIEALNER H+++TAPHLC +LPI+IP+Y  WQVPY 
Sbjct: 120 MAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYF 179

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           Y G K YDFFAGKQNLKSSYLLS +   + APML    LKA LVYHDGSFNDSR+N+TLA
Sbjct: 180 YVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLA 239

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           +TA+ENGAT+LNY+EV++L+K+P +GKV GA A D ET +   + AK VV+ATGP+SD I
Sbjct: 240 VTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRI 299

Query: 181 LQMDRNASGQPN----SPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIG 236
           LQM+ +  G P+    S  N+ + I +   +VAV DP+MV+PS GVHI+LPSFYCPKD+G
Sbjct: 300 LQMENHPKGLPDDLSLSKANEGATITT---KVAVADPKMVVPSSGVHIILPSFYCPKDMG 356

Query: 237 LLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVK 296
           LLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQDILKELQHYI+FPVK
Sbjct: 357 LLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVK 416

Query: 297 REDVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQ 356
           REDV SAWAG+RPLV+DPR      K  S TQ +VRSHFLFTSD+GL+TI+GGKWTTYR+
Sbjct: 417 REDVQSAWAGIRPLVKDPR------KDNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYRE 470

Query: 357 MAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENY 416
           MA+ETID+VV+VG F N KPC TR IKL G+E W  N  A+L+Q Y+L   +S YL ENY
Sbjct: 471 MAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENY 530

Query: 417 GTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQY 476
           GT+++ ICE F+    N+LP+SLA        + +    V++D FRYPFT+GELKY+++ 
Sbjct: 531 GTKAAAICEIFQSDKRNQLPVSLA--------AEKAAANVDYDAFRYPFTVGELKYNIRN 582

Query: 477 EYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTF 536
           EY R PLDFL+RRTR+AFLDAK+A+ +V  TVK+MGDE  W   KR+ E +  + FIKTF
Sbjct: 583 EYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTF 642

Query: 537 GV 538
           GV
Sbjct: 643 GV 644

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/542 (64%), Positives = 422/542 (77%), Gaps = 18/542 (3%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKA +E S+AQLDLVIEALNER H++ TAPHLC +LPI+IP+Y+ WQVPY 
Sbjct: 116 MAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYF 175

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           +AGCK YD+FAGKQNL+SSYLLSK+   E APML    LKA LVYHDGSFNDSR+N+TLA
Sbjct: 176 FAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLA 235

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           I+A+E+GATVLNYV+V +L+KD ++ KV GA   D ET +  ++ AK  VNATGPYSD I
Sbjct: 236 ISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLI 295

Query: 181 LQMDRNASG----QPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIG 236
           LQMD+N +G    QP  P N      S   +VAV  P MV+PS GVHI+LPS+YCPK +G
Sbjct: 296 LQMDKNKNGLPDPQPPQPAN-----VSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVG 350

Query: 237 LLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVK 296
           LLDV+T+DGRVMFFLPWQGKVLAGTTDIP+K VP+NP  TEADIQDIL+ELQHYI+FPV+
Sbjct: 351 LLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVR 410

Query: 297 REDVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQ 356
           REDVLSAWAG+RPLV DPR        G +T+G+VR+H +FTS+ GLIT+AGGKWTTYR+
Sbjct: 411 REDVLSAWAGIRPLVMDPRK---RKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYRE 467

Query: 357 MAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENY 416
           MAE+TID+VV+ GGF ++KPC TR IKLAG E WT N  ALLAQ+Y LS  MS +L  NY
Sbjct: 468 MAEQTIDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNY 526

Query: 417 GTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQY 476
           GTR+ IICE FK+   N+LP++   +EN T+  +     VNFD+FRYPFTIGE  YS+++
Sbjct: 527 GTRAPIICELFKEDERNQLPVAFGGRENVTVLHH-----VNFDSFRYPFTIGEFLYSIRH 581

Query: 477 EYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTF 536
           EY R   DFL+RRTR+AFLDA  AL +V  TVKVMGDE NW   +RQ E+E+   FIKTF
Sbjct: 582 EYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTF 641

Query: 537 GV 538
           GV
Sbjct: 642 GV 643

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/550 (65%), Positives = 430/550 (78%), Gaps = 23/550 (4%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKA ++ SKAQLDLVIEALNER HL+ TAPHLC +LPI+IP+Y  WQVPY 
Sbjct: 119 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQVPYF 178

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           Y G K YD FAG QNLKSSYLLSKS+  E APML +  LKA LVYHDGSFNDSR+NATLA
Sbjct: 179 YVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLKAGLVYHDGSFNDSRMNATLA 238

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           I+A+E GATVLNY+EV++L+KD  + K+ GA   D ET E  +I AK +VNATGPYSD I
Sbjct: 239 ISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTI 298

Query: 181 LQMDRNASGQPN------------SPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPS 228
           LQMD N +G P+            +PLN  +  +S   +VAV +P MV+PS GVHI+LPS
Sbjct: 299 LQMDNNKNGLPDMFKKEIETGNLKTPLNVITP-ESISKEVAVQNPNMVVPSAGVHIILPS 357

Query: 229 FYCPKDIGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQ 288
           +YCP ++GLLD  T+DGRVMFFLPWQGKVLAGTTDIP+K VPENP  TEADIQDILKELQ
Sbjct: 358 YYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQ 417

Query: 289 HYIEFPVKREDVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAG 348
           HYI+FPVKREDVLSAWAG+RPLV+DPR      +KG ATQ VVRSHF+FTSDNGL+TIAG
Sbjct: 418 HYIKFPVKREDVLSAWAGIRPLVQDPRV-----QKGGATQEVVRSHFIFTSDNGLVTIAG 472

Query: 349 GKWTTYRQMAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKM 408
           GKWTTYR+MAEETID+VV+ G F N KPC TR +KLAGAE W  N  ALL+Q Y++S+ M
Sbjct: 473 GKWTTYREMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDANLAALLSQKYNVSTPM 531

Query: 409 SNYLVENYGTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIG 468
           + +L  NYGTRS IICE  K+S ENKLP++LA +EN +I     N  V +D+FRYP+TI 
Sbjct: 532 AEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESI----SNAHVGYDSFRYPYTIA 587

Query: 469 ELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEK 528
           ELKYSM YEY RT LDFL+RRTR+AFLDAKEAL++V+ TVK+MGD  NW + +R+ E   
Sbjct: 588 ELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVY 647

Query: 529 TVNFIKTFGV 538
             ++IKTFGV
Sbjct: 648 ATDYIKTFGV 657

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/539 (63%), Positives = 417/539 (77%), Gaps = 16/539 (2%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           M HGGVRYLEKA WE SKAQLDLVIEALNER HL+ TAPHLC VLPI+IP+Y  WQVPY 
Sbjct: 108 MAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYF 167

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           Y G K YDFFAG QNLKSSYLLS SA  E APML    LKA LVYHDGSFNDSR+NAT+A
Sbjct: 168 YVGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIA 227

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           +TA+ENGATVLNY+EV++LIK+P  GKV GA A D ET +   + AK VVNATGP+SD +
Sbjct: 228 VTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRL 287

Query: 181 LQMDRNASGQPNSPLNDN-SKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLD 239
           LQMD +  G P+  + D  +K  +   +VAV +P+MV+PS GVHI+LPS+YCPK++GLLD
Sbjct: 288 LQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLD 347

Query: 240 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 299
             TSDGRVMFFLPWQGKVLAGTTDIP+KQVP NP  TEADIQDILKELQHYI+FPVKRED
Sbjct: 348 AETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKRED 407

Query: 300 VLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAE 359
           V SAWAG+RPLV+DPR      K  S TQG+VRSH +FTS NG++TI+GGKWTTYR+MAE
Sbjct: 408 VQSAWAGIRPLVKDPR------KNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREMAE 461

Query: 360 ETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTR 419
           ET+++VV+VG F N KPC TR +KL+GAE W  N  ALL+  Y++   ++ +L +NYGT+
Sbjct: 462 ETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYGTK 521

Query: 420 SSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEYC 479
           ++ +CE F+D   N LP+SLA  +  +I         +++ FRYP+TIGELK++M +EY 
Sbjct: 522 AAQVCELFEDDRANMLPVSLAADKPTSI---------DYNAFRYPYTIGELKFTMTHEYA 572

Query: 480 RTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538
           RTPLDFL+RRTR+AFLDAK+AL +V  TVKVMGD   W   KR  E +  + +IKTFGV
Sbjct: 573 RTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/541 (61%), Positives = 394/541 (72%), Gaps = 15/541 (2%)

Query: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60
           + HGGVRYLEKA +E SK QLDLV+EALNER HL+  APHL  +LPI+IP+Y  W+VPY 
Sbjct: 117 LAHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYF 176

Query: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120
           YAGCK YDFFAG QNLKSSYLLS+      APML    LK  LVYHDG FNDSRL ATLA
Sbjct: 177 YAGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLA 236

Query: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180
           I+AVE GATV NYV V++LIKD  +G + GA+  D ET     +NAK VVNATGPYSD I
Sbjct: 237 ISAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKI 296

Query: 181 LQMDRNASGQPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLDV 240
           LQMD N  G P     +  K       +AV +P+MV+PS GVHI LPSFYCP ++GLLD 
Sbjct: 297 LQMDANPQGLPE---KEPEKATPENALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDA 353

Query: 241 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 300
            TSDGRVMFFLPWQGKV+AGTTDIPLKQVP +P PTEADIQDIL+ELQHYI+FPV+REDV
Sbjct: 354 STSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDV 413

Query: 301 LSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 360
           LSAWAG+RPLVRDPR +  G      T+G+VRSHF+FTS   L+TIAGGKWTTYR+MAEE
Sbjct: 414 LSAWAGIRPLVRDPR-VAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEE 472

Query: 361 TIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYH-LSSKMSNYLVENYGTR 419
           T+D+V++VG F  LKPC TR  KL GA+ W  N+ A L Q Y  L   ++ +L  NYG R
Sbjct: 473 TVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDR 532

Query: 420 SSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFD--TFRYPFTIGELKYSMQYE 477
           + IICE F+    +KLP+ L        Y + ++ + N D   F YPFTI ELKY +++E
Sbjct: 533 APIICEMFEADKSSKLPVGL--------YGDGDDKVKNMDANAFDYPFTIAELKYCIRFE 584

Query: 478 YCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFG 537
           Y RT LDFLLRR+RFAFLDA+EALN+V  TV ++GDE  W  +KR  E  KT  +IKTFG
Sbjct: 585 YVRTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFG 644

Query: 538 V 538
           V
Sbjct: 645 V 645

>CAGL0M00770g Chr13 (86290..89556) [3267 bp, 1088 aa] {ON} weakly
           similar to uniprot|P06701 Saccharomyces cerevisiae
           YLR442c SIR3 silencing regulatory and DNA-repair protein
          Length = 1088

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 64/138 (46%), Gaps = 10/138 (7%)

Query: 357 MAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQ--NYVALLAQNYHLSSKMSNYLVE 414
           +  + IDK  E      LKP  T    L   +++ Q  N V L AQ     SK S  + E
Sbjct: 569 LCHQPIDKTPEKSNDEKLKPLLTALSDLTTNKQFVQLRNIVGLTAQ-----SKNSGSIFE 623

Query: 415 NYG--TRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKY 472
                T S  + +   DS+ + + LS+ +KE  TIY +  N ++N    +  +  G+ +Y
Sbjct: 624 KLRKCTTSESLIQCMSDSITSDIILSMRNKEFVTIYGSLFNAIINGRN-KSLYLTGDDEY 682

Query: 473 SMQYEYCRTPLDFLLRRT 490
           +++Y + +   + LL  T
Sbjct: 683 TIKYVFNKVAHELLLSAT 700

>Smik_13.408 Chr13 (648920..649690) [771 bp, 256 aa] {ON} YMR200W
           (REAL)
          Length = 256

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 63/159 (39%), Gaps = 30/159 (18%)

Query: 51  IYNTW--QVPYIYAGCKFYD----FFAGKQNLKSSYLLSKSATVEKAPMLTTDNL----- 99
           +Y TW  +   ++ G  FYD              SY  ++    E+A    + N      
Sbjct: 31  LYGTWSSKSNQVFTGPGFYDPVDELLIEPSLPGLSYSFTEDGWYEEATYQVSGNPRDPTC 90

Query: 100 -KASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEV--QKLIKDPASGKVVGAEARDV 156
            KASL+Y  G++N S           ENG   LN +EV  ++L  DP + + V   +R  
Sbjct: 91  PKASLIYQHGTYNIS-----------ENGTLTLNPIEVDGRQLFSDPCTDQGVSTYSRYN 139

Query: 157 ETNELVRINAKCVVNATGPYSDAILQMDRNASGQPNSPL 195
           +T      N   +    G Y+  + Q D    G P  PL
Sbjct: 140 QTEIFKEYNVG-IDPYHGIYTLQLYQFD----GTPMQPL 173

>Kwal_27.11082 s27 complement(631427..632938) [1512 bp, 503 aa] {ON}
           YBR250W - Hypothetical ORF [contig 31] FULL
          Length = 503

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 17/86 (19%)

Query: 42  CTVLPILIPIYNTWQVPYIYAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKA 101
           CT+L   I I  T  +P I +          ++ L SSY  S SAT+ +     T++L  
Sbjct: 333 CTLLFANISIVQTLSLPCIDS--------EKRELLPSSYCQSNSATISR-----TEDLDN 379

Query: 102 SLVYHDGSFND----SRLNATLAITA 123
           +L+YHD +F++    S L   L IT+
Sbjct: 380 NLLYHDLTFDELVVPSTLKKALQITS 405

>SAKL0G16610g Chr7 (1434140..1440040) [5901 bp, 1966 aa] {ON} similar
            to uniprot|Q06409 Saccharomyces cerevisiae YLR422W
            Hypothetical ORF
          Length = 1966

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 24/113 (21%)

Query: 123  AVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKC--VVNATGPYSDAI 180
             V    T++N  EV+K+ +   S       +  ++  EL  +   C  ++   G YS+  
Sbjct: 1679 TVSTFPTLMNRTEVKKISEKVLSPVENAIRSLQLKIQELTGLENMCYKLIKENGEYSEIF 1738

Query: 181  LQMDRNASGQPNSPLN----------------------DNSKIKSAFNQVAVM 211
             ++ RN SG  ++P+N                      D + ++SAF+++AV+
Sbjct: 1739 GELSRNISGTIDAPINGGVSRYREFFEATEAKAEFKESDTNLLQSAFDELAVV 1791

>Smik_13.510 Chr13 (839587..840723) [1137 bp, 378 aa] {ON} YMR294W
           (REAL)
          Length = 378

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 64/136 (47%), Gaps = 10/136 (7%)

Query: 284 LKELQHYIEFP---VKREDVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSD 340
           + E++HY+  P      ED  S  + V  L R+ + +   GK+G   Q   R   +  ++
Sbjct: 183 MSEMEHYVGAPDALENEEDRKSINSKVNELYRNIQLLQDDGKEGGKLQKF-RDRLVELNE 241

Query: 341 NGLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQ 400
           +   ++ G K     ++ +ET+ KV++      +K  ++    +    +  Q+ + LLA+
Sbjct: 242 DFENSLLGKKMQRDLRLRDETVKKVIKPES--KIKEINS----IYAMLKQYQDSLPLLAE 295

Query: 401 NYHLSSKMSNYLVENY 416
                +KM+N +VE Y
Sbjct: 296 RMKSLNKMNNRVVEVY 311

>KLLA0F16819g Chr6 (1548402..1550327) [1926 bp, 641 aa] {ON}
           uniprot|Q96WJ2 Kluyveromyces lactis PRM1 Paromomycin-
           resistance protein Prm1
          Length = 641

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 182 QMDRNASGQPNSPLNDNS-KIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCP 232
           Q DRN  G  N P ND+    +SA N      P MVIPS  +H V  + + P
Sbjct: 516 QSDRNILGVLNDPQNDDVISFQSALNNGPASSP-MVIPSKSMHSVPDTAFSP 566

>Kpol_1008.7 s1008 complement(9101..11500) [2400 bp, 799 aa] {ON}
           complement(9101..11500) [2400 nt, 800 aa]
          Length = 799

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 10/95 (10%)

Query: 17  SKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYAGCKFYDFFAGKQNL 76
           +  +L+  +E ++   +LIN      ++LP+     +   VP+IY G KF  F     +L
Sbjct: 404 TDEELEKYLEYVSHPMNLINLPRAEGSLLPVFGKRISGMTVPWIYVGSKFSTFCW---HL 460

Query: 77  KSSYLLSKSATVEKAPML-------TTDNLKASLV 104
           +  Y LS +   E AP +       + D+L++ LV
Sbjct: 461 EDQYTLSANYQHEGAPKVWYSIPEYSCDSLRSYLV 495

>SAKL0E06512g Chr5 (532120..533331) [1212 bp, 403 aa] {ON} conserved
           hypothetical protein
          Length = 403

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 157 ETNELVRINAKCVVNATGPYSDAILQM 183
           E+NE V IN + V+NA+G Y+D +  M
Sbjct: 222 ESNEKVEINVENVINASGLYADQVANM 248

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,473,376
Number of extensions: 2687329
Number of successful extensions: 8066
Number of sequences better than 10.0: 43
Number of HSP's gapped: 8260
Number of HSP's successfully gapped: 43
Length of query: 538
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 424
Effective length of database: 40,409,475
Effective search space: 17133617400
Effective search space used: 17133617400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)