Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.305.712ON1062106248420.0
Skud_9.125.712ON1064106541180.0
Smik_9.135.712ON1060106439730.0
YIL156W (UBP7)5.712ON1071106639360.0
CAGL0H06721g5.712ON108189920020.0
NDAI0F002005.712ON110549414860.0
TDEL0B020805.712ON102548114480.0
NCAS0G001705.712ON103047914231e-179
KNAG0L022005.712ON116150313631e-169
KLLA0A00396g5.712ON101248013261e-165
Kwal_55.196455.712ON97047713051e-162
KLTH0E00814g5.712ON97447712911e-160
Kpol_2001.785.712ON40344912251e-158
TPHA0D046605.712ON104547812621e-155
TBLA0E017605.712ON121250012531e-152
Ecym_40095.712ON151748212321e-147
AFR296C5.712ON116948012061e-146
Smik_11.3625.712ON72148011241e-139
Suva_11.3355.712ON72447711151e-138
YKR098C (UBP11)5.712ON71748611081e-137
Skud_11.3385.712ON71247910911e-134
KAFR0D021605.712ON84648210311e-124
KAFR0H001505.712ON6564899881e-120
ZYRO0B16544g5.712ON10444889351e-108
Kpol_304.65.712ON5624708381e-99
CAGL0G02563gsingletonON6314798161e-95
SAKL0E15136g5.712ON10374898297e-94
TBLA0F036108.188ON11442692775e-24
KNAG0D019308.188ON9862512695e-23
KAFR0C025908.188ON9782542685e-23
TPHA0C027708.188ON9702462686e-23
AFR007W8.188ON8482502669e-23
KLLA0E10275g8.188ON7962682595e-22
YER144C (UBP5)8.188ON8052482595e-22
TDEL0B042208.188ON8252552588e-22
Kpol_1032.288.188ON8822472589e-22
Kwal_14.20088.188ON4242502511e-21
Skud_4.3238.188ON9262412552e-21
Smik_4.3078.188ON9292412534e-21
Suva_2.2288.188ON9272602508e-21
Ecym_61848.188ON8512532481e-20
KLTH0H07678g8.188ON8612522491e-20
NDAI0A036808.188ON11162512481e-20
YDR069C (DOA4)8.188ON9262422462e-20
NCAS0B042808.188ON9222432418e-20
CAGL0I06765g8.188ON8872652372e-19
NDAI0C059008.188ON8262482345e-19
Smik_5.3098.188ON8052462337e-19
CAGL0G05247g8.188ON9472442338e-19
Skud_5.2818.188ON8232462311e-18
ZYRO0G06798g8.188ON8772692311e-18
SAKL0H18986g8.188ON8932572302e-18
Suva_5.2728.188ON7882632302e-18
NCAS0A039108.188ON7952562103e-16
NCAS0I031401.137ON12012052024e-15
AFR627C1.137ON12872201927e-14
ZYRO0C17908g1.137ON12042041837e-13
TPHA0A025401.137ON12862061783e-12
KAFR0F015601.137ON11712071773e-12
KLTH0F03674g1.137ON11982091774e-12
KNAG0G015908.188ON6712361764e-12
KNAG0C021801.137ON12312081764e-12
TDEL0C056401.137ON11782271722e-11
NDAI0B004801.137ON12532151722e-11
Kpol_2001.541.137ON12232001632e-10
CAGL0L01639g1.137ON11472101632e-10
Skud_10.221.137ON12552031595e-10
KLLA0C03476g1.137ON12522061587e-10
Smik_10.371.137ON12471991561e-09
Kwal_33.136281.137ON11602071542e-09
YJL197W (UBP12)1.137ON12542041533e-09
Ecym_81401.137ON12642201533e-09
Suva_6.2761.137ON12562031505e-09
NCAS0E026107.390ON7171311471e-08
TBLA0J006001.137ON14622321453e-08
SAKL0C04246g1.137ON12972081434e-08
KNAG0C035807.390ON7761331415e-08
Suva_2.507.390ON7501331407e-08
ZYRO0B03300g7.390ON8131291372e-07
KLLA0C06974g8.742ON4462441343e-07
NDAI0A016707.390ON8461351353e-07
KNAG0B023707.390ON7531311343e-07
Smik_2.497.390ON7451321335e-07
NDAI0E041807.390ON8271351336e-07
ZYRO0F01276g3.270ON7761931326e-07
TPHA0L022905.18ON11931221336e-07
Skud_2.387.390ON7481301326e-07
Suva_4.2953.270ON7821911319e-07
Ecym_46857.390ON7781331319e-07
YBL067C (UBP13)7.390ON7471331301e-06
NCAS0D023905.18ON12111121311e-06
Kpol_534.231.369ON4961121272e-06
CAGL0I05522g7.390ON7241271263e-06
TBLA0E025703.270ON7851291263e-06
Kpol_513.255.18ON11902331273e-06
TPHA0P006807.390ON7271291254e-06
YER098W (UBP9)7.390ON7541361254e-06
CAGL0A04477g7.390ON7701281255e-06
KAFR0A042108.742ON4401261236e-06
NCAS0A143707.390ON7291311246e-06
TDEL0D035503.270ON7801931247e-06
Kwal_26.91518.742ON4541281227e-06
YMR304W (UBP15)5.18ON12302361238e-06
SAKL0H04994g8.742ON4541321228e-06
Skud_5.2237.390ON7481331229e-06
NCAS0B005808.742ON4661311211e-05
TBLA0C012001.369ON5031111211e-05
TBLA0D010708.742ON4831941201e-05
NDAI0E008108.742ON4931371192e-05
Smik_13.5215.18ON12312351202e-05
CAGL0M11198g8.742ON4611311192e-05
ZYRO0A05962g8.742ON4651261182e-05
Suva_13.4955.18ON12302361202e-05
TDEL0C015707.390ON7651311192e-05
NCAS0I016203.270ON7952421192e-05
ZYRO0D07062g5.18ON11931181192e-05
YMR223W (UBP8)8.742ON4711371173e-05
Smik_5.2447.390ON7491331183e-05
Skud_13.4785.18ON12312351184e-05
TDEL0B036708.742ON4631301164e-05
NDAI0I025305.18ON11971121175e-05
SAKL0H18656g8.202ON7721521165e-05
NDAI0C059508.202ON10801441165e-05
Suva_5.2177.390ON7541361165e-05
Smik_13.4318.742ON4711351156e-05
KLTH0D12760g8.742ON4531281148e-05
CAGL0M13783g5.18ON11962331158e-05
CAGL0H10186g3.270ON7782451131e-04
Suva_13.4078.742ON4711351121e-04
KAFR0A069102.307ON6782581121e-04
Skud_2.1773.270ON7821911122e-04
Ecym_56715.18ON11762351122e-04
TPHA0E008707.390ON7151001112e-04
TBLA0C070205.18ON12471211112e-04
KLLA0D08459g2.69ON7501301112e-04
KNAG0C019401.369ON4991081102e-04
Skud_13.3928.742ON4731371092e-04
Kpol_1045.417.390ON7121261103e-04
Kpol_1018.937.390ON7551281103e-04
SAKL0H00418g5.18ON11901051103e-04
KAFR0L017307.390ON7011221094e-04
KNAG0E012905.18ON11962341094e-04
Ecym_27171.369ON4831111084e-04
KAFR0C004103.270ON7692411084e-04
TDEL0G004105.18ON11861121084e-04
AGL357W5.18ON11662171084e-04
KNAG0G029308.742ON4591261075e-04
TBLA0D006207.390ON11711331085e-04
KAFR0I026005.18ON12132341085e-04
TPHA0G005608.742ON4632441067e-04
Kwal_26.95985.18ON11912181077e-04
KAFR0K018107.390ON7141291068e-04
NCAS0C021108.540ON4942021058e-04
Kpol_1064.488.742ON4661061040.001
Kwal_34.162681.369ON4491251040.001
AEL242W8.540ON613871040.001
CAGL0K10494g1.369ON4951251040.001
Ecym_62488.742ON4661351030.001
KNAG0A054502.307ON7642741030.002
KLTH0B09944g5.18ON11891181030.002
Kwal_56.230843.270ON7621371020.002
NCAS0B061302.307ON7702751010.003
TPHA0A025101.369ON5051171000.003
KNAG0J008003.270ON7651201010.003
KLLA0E20351g7.390ON6971861000.004
Kpol_251.73.270ON480116990.005
NDAI0A074103.270ON810131990.005
KNAG0A019708.540ON471146990.005
Klac_YGOB_Anc_5.18b5.18ON1166114990.005
AEL029W1.369ON446108980.005
YPL072W (UBP16)8.540ON499163990.005
ZYRO0G01188g1.369ON500126980.005
Smik_5.3188.202ON909148990.006
NDAI0F034102.69ON870202980.008
NCAS0D006001.369ON493126960.009
CAGL0I06600g8.202ON816145960.011
Ecym_11668.540ON69677960.013
ZYRO0B11044g8.202ON826143960.013
SAKL0F12430g7.390ON754135950.014
CAGL0J11352g2.69ON771195950.015
YER151C (UBP3)8.202ON912146950.015
AGR023C3.270ON780127940.018
Suva_6.831.369ON50083940.018
KAFR0E009308.540ON498239930.026
NDAI0H035501.369ON502111930.027
KAFR0C045201.369ON499123920.028
Skud_16.2098.540ON50372920.029
TPHA0J026205.443ON122526930.033
KLLA0E02377g5.443ON1220137920.037
TBLA0B019308.202ON1019144920.038
ZYRO0D03982g8.540ON82181920.038
KLTH0H07370g8.202ON781137910.044
SAKL0H10076g8.540ON76781900.058
ZYRO0G01606g5.443ON130550900.059
Smik_2.1893.270ON782208900.060
Smik_7.3141.369ON49983890.063
YFR010W (UBP6)1.369ON49983890.064
AGR370W7.390ON74027900.068
Skud_6.941.369ON49983890.068
TBLA0H036008.540ON482207890.071
Kpol_1024.448.540ON496194890.076
KLTH0H13354g1.369ON49538890.077
AGR139C8.202ON789147890.085
TDEL0A016208.202ON795143890.090
Kwal_14.19578.202ON444148870.10
TDEL0B030608.540ON73481880.11
KLLA0E01013g8.202ON774146880.11
TPHA0E017105.443ON128331880.11
KLLA0A10791g1.369ON48425870.13
Smik_16.1638.540ON50172870.13
SAKL0D10120g1.369ON492113870.14
CAGL0K10252g5.443ON126730870.14
SAKL0E13002g2.69ON739254860.17
Kpol_1016.15.443ON125131860.18
KLTH0F15862g5.443ON124151860.19
TBLA0A064705.443ON132030860.19
Kwal_55.213935.443ON123330860.20
Suva_5.2808.202ON905146860.20
YBR058C (UBP14)3.270ON781100850.21
TDEL0D024001.369ON49472850.21
TDEL0D025805.443ON127249860.21
KLTH0C07326g3.270ON762117850.22
SAKL0D03322g3.270ON765129850.23
KLLA0E14125g8.97ON477129840.27
SAKL0G02728g5.443ON123726850.29
KNAG0B041905.443ON126230840.33
Skud_5.2898.202ON910146840.34
Suva_8.1765.443ON127031840.34
KLLA0F18700g3.270ON770112830.36
CAGL0H05335g8.540ON48386830.39
Smik_4.1152.307ON790307830.39
KLLA0E08801g2.307ON771164830.39
NDAI0C015505.443ON129547830.39
Ecym_55448.202ON83488830.41
Ecym_45145.443ON124626830.48
Skud_15.2865.443ON127826820.51
YOR124C (UBP2)5.443ON127226820.56
Smik_15.3015.443ON127226820.59
Kwal_27.108427.390ON711140810.60
ACL164C5.443ON138931820.61
KLLA0E23387g8.540ON78281810.62
TPHA0D043508.202ON854133810.70
KAFR0D050705.443ON122732810.70
KAFR0B023708.202ON829141810.73
Kwal_27.120308.540ON74981810.77
NCAS0A038408.202ON917141800.89
KLTH0C06732g7.390ON714126791.1
AFR551W8.742ON469131791.2
Kpol_1062.235.443ON126626791.2
KLTH0E12540g8.540ON75277781.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.30
         (1062 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...  1869   0.0  
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...  1590   0.0  
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...  1535   0.0  
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...  1520   0.0  
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   775   0.0  
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     577   0.0  
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   562   0.0  
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     552   e-179
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   529   e-169
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   515   e-165
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   507   e-162
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   501   e-160
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   476   e-158
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   490   e-155
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   487   e-152
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   479   e-147
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   469   e-146
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   437   e-139
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   434   e-138
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   431   e-137
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   424   e-134
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   401   e-124
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   385   e-120
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   364   e-108
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   327   1e-99
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   318   1e-95
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   323   7e-94
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....   111   5e-24
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   108   5e-23
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   107   5e-23
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...   107   6e-23
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   107   9e-23
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...   104   5e-22
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   104   5e-22
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   103   8e-22
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...   103   9e-22
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...   101   1e-21
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   102   2e-21
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...   102   4e-21
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...   100   8e-21
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   100   1e-20
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...   100   1e-20
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}             100   1e-20
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...    99   2e-20
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     97   8e-20
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    96   2e-19
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    95   5e-19
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    94   7e-19
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    94   8e-19
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    94   1e-18
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    94   1e-18
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    93   2e-18
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    93   2e-18
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     86   3e-16
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    82   4e-15
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    79   7e-14
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    75   7e-13
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    73   3e-12
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    73   3e-12
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    73   4e-12
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    72   4e-12
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    72   4e-12
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    71   2e-11
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    71   2e-11
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    67   2e-10
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    67   2e-10
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    66   5e-10
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    65   7e-10
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    65   1e-09
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    64   2e-09
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    64   3e-09
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    64   3e-09
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    62   5e-09
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    61   1e-08
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    60   3e-08
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    60   4e-08
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    59   5e-08
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    59   7e-08
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    57   2e-07
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    56   3e-07
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    57   3e-07
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    56   3e-07
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    56   5e-07
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    56   6e-07
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    55   6e-07
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    56   6e-07
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    55   6e-07
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    55   9e-07
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    55   9e-07
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    55   1e-06
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    55   1e-06
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    54   2e-06
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    53   3e-06
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    53   3e-06
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    54   3e-06
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    53   4e-06
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    53   4e-06
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    53   5e-06
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    52   6e-06
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    52   6e-06
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    52   7e-06
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    52   7e-06
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    52   8e-06
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    52   8e-06
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    52   9e-06
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       51   1e-05
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    51   1e-05
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    51   1e-05
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    50   2e-05
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    51   2e-05
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    50   2e-05
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    50   2e-05
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    51   2e-05
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    50   2e-05
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    50   2e-05
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    50   2e-05
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    50   3e-05
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    50   3e-05
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    50   4e-05
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    49   4e-05
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    50   5e-05
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    49   5e-05
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    49   5e-05
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    49   5e-05
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    49   6e-05
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    49   8e-05
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    49   8e-05
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    48   1e-04
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    48   1e-04
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    48   1e-04
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    48   2e-04
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    48   2e-04
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    47   2e-04
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    47   2e-04
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    47   2e-04
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    47   2e-04
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    47   2e-04
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    47   3e-04
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    47   3e-04
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    47   3e-04
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    47   4e-04
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    47   4e-04
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    46   4e-04
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    46   4e-04
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    46   4e-04
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    46   4e-04
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    46   5e-04
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    46   5e-04
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    46   5e-04
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    45   7e-04
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    46   7e-04
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    45   8e-04
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    45   8e-04
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    45   0.001
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    45   0.001
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    45   0.001
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    45   0.001
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    44   0.001
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    44   0.002
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    44   0.002
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    44   0.002
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    44   0.003
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    43   0.003
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    44   0.003
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    43   0.004
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    43   0.005
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    43   0.005
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    43   0.005
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    43   0.005
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    42   0.005
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    43   0.005
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    42   0.005
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    43   0.006
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    42   0.008
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    42   0.009
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    42   0.011
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    42   0.013
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    42   0.013
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    41   0.014
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    41   0.015
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    41   0.015
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    41   0.018
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    41   0.018
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    40   0.026
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    40   0.027
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    40   0.028
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    40   0.029
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    40   0.033
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    40   0.037
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    40   0.038
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    40   0.038
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    40   0.044
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    39   0.058
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    39   0.059
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    39   0.060
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    39   0.063
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    39   0.064
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    39   0.068
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    39   0.068
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    39   0.071
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    39   0.076
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    39   0.077
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    39   0.085
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    39   0.090
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    38   0.10 
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    39   0.11 
KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some s...    39   0.11 
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    39   0.11 
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    38   0.13 
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    38   0.13 
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    38   0.14 
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    38   0.14 
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    38   0.17 
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    38   0.18 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    38   0.19 
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    38   0.19 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    38   0.20 
Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON...    38   0.20 
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    37   0.21 
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    37   0.21 
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    38   0.21 
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    37   0.22 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    37   0.23 
KLLA0E14125g Chr5 (1250334..1251767) [1434 bp, 477 aa] {ON} simi...    37   0.27 
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    37   0.29 
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    37   0.33 
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    37   0.34 
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    37   0.34 
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    37   0.36 
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    37   0.39 
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    37   0.39 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    37   0.39 
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    37   0.39 
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    37   0.41 
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    37   0.48 
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    36   0.51 
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    36   0.56 
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    36   0.59 
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    36   0.60 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    36   0.61 
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    36   0.62 
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    36   0.70 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    36   0.70 
KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {O...    36   0.73 
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    36   0.77 
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    35   0.89 
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    35   1.1  
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    35   1.2  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    35   1.2  
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    35   1.5  
TPHA0M01090 Chr13 complement(217833..220175) [2343 bp, 780 aa] {...    35   1.7  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    34   2.0  
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    34   2.0  
Kpol_1058.39 s1058 complement(110901..114551) [3651 bp, 1216 aa]...    34   2.6  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    34   2.8  
NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.5...    33   3.7  
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     33   4.0  
Ecym_5625 Chr5 complement(1258119..1261397) [3279 bp, 1092 aa] {...    33   6.2  
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    33   6.5  
TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {...    32   9.3  

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
            YIL156W (REAL)
          Length = 1062

 Score = 1869 bits (4842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 926/1062 (87%), Positives = 926/1062 (87%)

Query: 1    MHPHTTSFTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRH 60
            MHPHTTSFTPEYSNELLRRVRDLYHEDIKHYYPQ           HTEYLFELYLDSMRH
Sbjct: 1    MHPHTTSFTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRH 60

Query: 61   ERPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKE 120
            ERPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKE
Sbjct: 61   ERPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKE 120

Query: 121  IGVVLDDSVKHVVGIEHRITKKRAFSVPGIXXXXXXXXXXXXXXGPRGHLHKTSSTEEDA 180
            IGVVLDDSVKHVVGIEHRITKKRAFSVPGI              GPRGHLHKTSSTEEDA
Sbjct: 121  IGVVLDDSVKHVVGIEHRITKKRAFSVPGIDLSDQLASLSLDAAGPRGHLHKTSSTEEDA 180

Query: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVPYTHNDND 240
            DQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVPYTHNDND
Sbjct: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVPYTHNDND 240

Query: 241  GTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQ 300
            GTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQ
Sbjct: 241  GTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQ 300

Query: 301  KQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKP 360
            KQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKP
Sbjct: 301  KQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKP 360

Query: 361  VYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLAT 420
            VYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLAT
Sbjct: 361  VYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLAT 420

Query: 421  VPTALLGGYEKWKKTLHTYAQQYHISIDDYLYRPYXXXXXXXXXXXXXXXXXXXXXXXXX 480
            VPTALLGGYEKWKKTLHTYAQQYHISIDDYLYRPY                         
Sbjct: 421  VPTALLGGYEKWKKTLHTYAQQYHISIDDYLYRPYSQKQQQQQQQQQQQQQPSSQDSSSS 480

Query: 481  XXXXAKIPEPPSWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIMVHPHDNFQLRQ 540
                AKIPEPPSWK                                KIMVHPHDNFQLRQ
Sbjct: 481  KESSAKIPEPPSWKPPDLPIRLRKRPPPPLPVTMPTTPENPPPLPPKIMVHPHDNFQLRQ 540

Query: 541  PPIPARQHVKKQQLNSNEIIXXXXXXXXXXXXXXXXXXXXXXVYHIPTIEQSSNAYVSLS 600
            PPIPARQHVKKQQLNSNEII                      VYHIPTIEQSSNAYVSLS
Sbjct: 541  PPIPARQHVKKQQLNSNEIIQKKRQHQHQHYDQQLLQPQPQRVYHIPTIEQSSNAYVSLS 600

Query: 601  ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLF 660
            ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLF
Sbjct: 601  ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLF 660

Query: 661  DKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAND 720
            DKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAND
Sbjct: 661  DKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAND 720

Query: 721  YPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 780
            YPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS
Sbjct: 721  YPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 780

Query: 781  TFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPXXXXX 840
            TFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCGP     
Sbjct: 781  TFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPTASTS 840

Query: 841  XXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNESTSNNPVHFERERSR 900
                    ENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNESTSNNPVHFERERSR
Sbjct: 841  LSASASALENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNESTSNNPVHFERERSR 900

Query: 901  SPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTINFVTLPKILVIHLSRFY 960
            SPFKMLGGGGKRSHSNTPFA               KLTTVKTINFVTLPKILVIHLSRFY
Sbjct: 901  SPFKMLGGGGKRSHSNTPFANSSNDGNNFNDFKNKKLTTVKTINFVTLPKILVIHLSRFY 960

Query: 961  YDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDI 1020
            YDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDI
Sbjct: 961  YDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDI 1020

Query: 1021 GRSKWYYFDDEVVKADKKHGSDKSLKISSSDAYVLFYERVHD 1062
            GRSKWYYFDDEVVKADKKHGSDKSLKISSSDAYVLFYERVHD
Sbjct: 1021 GRSKWYYFDDEVVKADKKHGSDKSLKISSSDAYVLFYERVHD 1062

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (REAL)
          Length = 1064

 Score = 1590 bits (4118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 805/1065 (75%), Positives = 856/1065 (80%), Gaps = 5/1065 (0%)

Query: 1    MHPHTTSFTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRH 60
            MHPHTT FTPEYSNELLRRV+DLYHEDIKHYYPQ           HTEYL+ELYLDSMRH
Sbjct: 1    MHPHTTLFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRH 60

Query: 61   ERPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKE 120
             RPNDALTAF+IGCYYVFLIIPQSLQFQTRNKSYSIY+DLKKMYENEMNMTNVVLMVKKE
Sbjct: 61   NRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120

Query: 121  IGVVLDDSVKHVVGIEHRITKKRAFSVPGIXXXXXXXXXXXXXXGPRGHLHKTSSTEEDA 180
            IGVVLD+SVKH VGIEHRITKKRAFSVP                GP GH  K S TEEDA
Sbjct: 121  IGVVLDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEEDA 180

Query: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVPYTHNDND 240
            +QSSPVWTAPNLEPNDQLKLALLPEVIPTP +PESGRKTS+PVR SVLLEDVPY   D  
Sbjct: 181  EQSSPVWTAPNLEPNDQLKLALLPEVIPTPIYPESGRKTSSPVRPSVLLEDVPYNCYDGG 240

Query: 241  GTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQ 300
             +SAS +  FGEIT DRS+THRKDSYHS+YMVDSDT K DNDDLL+VETD FIQSL+ILQ
Sbjct: 241  ASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQ 300

Query: 301  KQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKP 360
            KQSIITAPELF+ILSN  E EK+LLIDLRIP+RS +N+IVAPNLVKIDPNLLWD+KTN P
Sbjct: 301  KQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTP 360

Query: 361  VYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLAT 420
            VYQDDILE LLE NE FINRDKF+YVV Y+DVKTFM MNFDY FIFFYL+LTSQKT L +
Sbjct: 361  VYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTS 420

Query: 421  VPTALLGGYEKWKKTLHTYAQQYHISIDDYLYRPYXXXXXXXXXXXXXXXXXXXXXXXXX 480
            VPTALLGGYEKWKKTLHTYAQ+Y +SI+DYLYRPY                         
Sbjct: 421  VPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYRPYSQKAHQQQQQEQQQSNAQDSSSSKE 480

Query: 481  XXXXAKIPEPPSWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIMVHPHDNFQLRQ 540
                AK+PEPPSWK                                KIMV+ HDN   R+
Sbjct: 481  SS--AKVPEPPSWKPPDLPIRLRKRPPPPPPVSMPTTPGIPPPLPPKIMVYSHDNSFSRK 538

Query: 541  PPIPARQHVKKQQLNSNEIIXXXXXXXXXXX-XXXXXXXXXXXVYHIPTIEQSSNAYVSL 599
            PPIPA+QHVKKQQLNSNEII                        Y+IPTIEQSSN YVSL
Sbjct: 539  PPIPAKQHVKKQQLNSNEIIQRKRQQQKHRHYGQQLLQPQPQRAYNIPTIEQSSNVYVSL 598

Query: 600  SITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNR-LHSPRLSNSLNM 658
            SITGLRNLGNTCYINSMIQCLFAAK+FRTLFIS+ YK+YLQ  +G+R  HS +LSNSLNM
Sbjct: 599  SITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNM 658

Query: 659  LFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVA 718
            LF+KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ HVA
Sbjct: 659  LFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 718

Query: 719  NDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 778
            NDYPNLLLY+AD LKVSN EYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN
Sbjct: 719  NDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 778

Query: 779  YSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPXXX 838
            YSTFYVLSLAIPRRSMKLSKLGR  EKRVKLEDCINMFT DEVLSGENAWDCPRCGP   
Sbjct: 779  YSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCGPTAS 838

Query: 839  XXXXXXXXXXENDSN-IVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNESTSNNPVHFERE 897
                          + I KS+KKKSRFFTLHT SKRRHLDFFGD+ NES S+N V FERE
Sbjct: 839  SSSASASASAFESESPIAKSKKKKSRFFTLHTGSKRRHLDFFGDNINESNSSNTVTFERE 898

Query: 898  RSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTINFVTLPKILVIHLS 957
            RSRSPFKMLG  GKRS+S+TPFA               KLTTVKTINFVTLPKILVIHLS
Sbjct: 899  RSRSPFKMLGSSGKRSNSSTPFANNNNDGNNINDFKNKKLTTVKTINFVTLPKILVIHLS 958

Query: 958  RFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHN 1017
            RFYYDLTKKN+TVITYPLILNIILKNN+TMKYRLFGVVNHTGTL+SGHYTSLVNKDLEH+
Sbjct: 959  RFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHS 1018

Query: 1018 VDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSDAYVLFYERVHD 1062
            VDIGRSKWYYFDDEVVKAD KHGSDK+LKISSSD YVLFYERVHD
Sbjct: 1019 VDIGRSKWYYFDDEVVKADNKHGSDKNLKISSSDVYVLFYERVHD 1063

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (REAL)
          Length = 1060

 Score = 1535 bits (3973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 792/1064 (74%), Positives = 852/1064 (80%), Gaps = 6/1064 (0%)

Query: 1    MHPHTTSFTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRH 60
            MHPHTT FTPEYS+ELLRRV+DLYHEDIKHYYPQ           HTEYLFELYLDSM H
Sbjct: 1    MHPHTTLFTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHH 60

Query: 61   ERPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKE 120
             RPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIY+DLKKMYENEMNMTNVVLMVKKE
Sbjct: 61   GRPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120

Query: 121  IGVVLDDSVKHVVGIEHRITKKRAFSVPGIXXXXXXXXXXXXXXGPRGHLHKTSSTEEDA 180
            IGVVLD+SVKHVVGIEHRI KKRAFSVP                GP+ H  K   TE+D 
Sbjct: 121  IGVVLDESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDM 180

Query: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVPYTHNDND 240
            DQSSPVWTAPNLEPNDQLKLALLPEVIPT  F E  RK+++P R SVLLEDVP T++DND
Sbjct: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTSTFNEPERKSTSPARPSVLLEDVPCTYHDND 240

Query: 241  GTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQ 300
             ++AS + PF +ITADRSVTHRKDSYHSVYMVDSD  K DND+ L+VE DGFIQSL+ILQ
Sbjct: 241  ASTASLNPPFRDITADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQ 300

Query: 301  KQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKP 360
            KQSIITAPELF+ILSN+ E EK+LLIDLRIPQRSA+N+IVAPNLVK+DPNLLWDKKTN P
Sbjct: 301  KQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTP 360

Query: 361  VYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLAT 420
            VYQDDILE LL+ NE+F NRDKF Y+V YSDVKTFMT+NFDY FIFFYL+LTSQKT L T
Sbjct: 361  VYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTT 420

Query: 421  VPTALLGGYEKWKKTLHTYAQQYHISIDDYLYRPYXXXXXXXXXXXXXXXXXXXXXXXXX 480
            VPTALLGGYEKWKKTLH+YAQ+YHIS++DYLYRPY                         
Sbjct: 421  VPTALLGGYEKWKKTLHSYAQEYHISVEDYLYRPYSQKARAQQQQQQQQPNSQDSSSSKE 480

Query: 481  XXXXAKIPEPPSWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIMVHPHDNFQLRQ 540
                 K+PEPPSWK                                KIMV+PH+    R+
Sbjct: 481  TP--TKVPEPPSWKPPDLPIRLRKRPPPPPPASMPTTPEIPPPLPPKIMVYPHEGSVPRK 538

Query: 541  PPIPARQHVKKQQLNSNEIIXXXXXXXXXXXXXXXXXXXXXXVYHIPTIEQSSNAYVSLS 600
            PPIPA+QHVKK+Q NSNEII                       Y IPTIE++ N YVSLS
Sbjct: 539  PPIPAKQHVKKKQSNSNEIIQRKRQQQHYGQQLLQPLPPKD--YSIPTIERNPNVYVSLS 596

Query: 601  ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLH-SPRLSNSLNML 659
            ITGLRNLGNTCYINSMIQCLFAAK FRTLFISS YK+YL+    NR H SP+LSNSL+ML
Sbjct: 597  ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656

Query: 660  FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719
            F+KMYLNGGCSVVPTGFLKV+NQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ HVAN
Sbjct: 657  FNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAN 716

Query: 720  DYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY 779
            DYPNLLLY+AD LKVSN EYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY
Sbjct: 717  DYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY 776

Query: 780  STFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPXXXX 839
            STFYVLSLAIP RSMKLSKLGR  EKRVKLEDCINMFTSDEVLSGENAWDCPRCGP    
Sbjct: 777  STFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPTASF 836

Query: 840  XXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNESTS-NNPVHFERER 898
                     EN+S+I+KS+KKKSRFFTLHT SKRRHLD FGDS+ E  + NN + FERER
Sbjct: 837  TASASASALENESSILKSKKKKSRFFTLHTGSKRRHLDIFGDSNGEGNNINNTMIFERER 896

Query: 899  SRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTINFVTLPKILVIHLSR 958
            SRSPFKMLGG GKRS S+TPFA               K+TTVKTINFVTLPKILVIHLSR
Sbjct: 897  SRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSR 956

Query: 959  FYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNV 1018
            FYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEH+V
Sbjct: 957  FYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSV 1016

Query: 1019 DIGRSKWYYFDDEVVKADKKHGSDKSLKISSSDAYVLFYERVHD 1062
            DIGRSKWYYFDDEVVKADKKHGSDK+LKISSSD YVLFYERV+D
Sbjct: 1017 DIGRSKWYYFDDEVVKADKKHGSDKNLKISSSDVYVLFYERVYD 1060

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
            UBP7Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1071

 Score = 1520 bits (3936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 786/1066 (73%), Positives = 851/1066 (79%), Gaps = 8/1066 (0%)

Query: 1    MHPHTTSFTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRH 60
            MHPH T FTPEYSNELLRRV+DLYHEDIKHYYPQ           HTEYLFELYLDS+ H
Sbjct: 10   MHPHITPFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHH 69

Query: 61   ERPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKE 120
            +RPNDALTAF+IGCYYVFLIIPQSLQFQTRNKSYSIY+DLKKMYENEMNMTNVVLMVKKE
Sbjct: 70   DRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 129

Query: 121  IGVVLDDSVKHVVGIEHRITKKRAFSVPGIXXXXXXXXXXXXXXGPRGHLHKTSSTEEDA 180
            IGVVLD+SVKH  GIEHRITKKRAFSVP                 P+ H  K + TE+DA
Sbjct: 130  IGVVLDESVKHGAGIEHRITKKRAFSVPADDLSGQVASLSLDTAAPQDHGLKGTFTEDDA 189

Query: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVPYTHNDND 240
            +QSSPVWTAPNLEPNDQLKLALLPEVIPTPAF E  RKTS PVR SVLLEDVP  ++++D
Sbjct: 190  EQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFREPERKTSVPVRPSVLLEDVPSIYHEDD 249

Query: 241  GTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQ 300
             + AS + PF EITADRSVTHRKDSYHSVYMVDS   K DNDDL +VE DGFIQSL+ILQ
Sbjct: 250  TSFASLNPPFREITADRSVTHRKDSYHSVYMVDSGNLKEDNDDLFNVENDGFIQSLDILQ 309

Query: 301  KQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKP 360
            KQSIITAPELF+ILSN+ E EK+LLIDLRIPQRSA+N+IVAPNLV +DPNLLWDK+TN P
Sbjct: 310  KQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAINHIVAPNLVNVDPNLLWDKQTNTP 369

Query: 361  VYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLAT 420
            +Y+DDILE LL+ NE+FINR+KF Y+V Y+DVKTFMT+NFDY+FIFFYL+LTSQKT L T
Sbjct: 370  IYKDDILEHLLKENENFINRNKFDYIVYYTDVKTFMTINFDYAFIFFYLMLTSQKTPLTT 429

Query: 421  VPTALLGGYEKWKKTLHTYAQQYHISIDDYLYRPYXXXXXXXXXXXXXXXXXXXXXXXXX 480
            VPT LLGGYEKWKKTLH+YAQ+YHISI+DYLYRPY                         
Sbjct: 430  VPTTLLGGYEKWKKTLHSYAQEYHISIEDYLYRPYSQKARLQQEQQQQQQQPDSQDSFSA 489

Query: 481  XXXXAKIPEPPSWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIMVHPHDNFQLRQ 540
                 K+PEPPSWK                                KIMVH   +   R+
Sbjct: 490  KESSTKVPEPPSWKPPDLPIRLRKRPPPPPPVSMPTTPEIPPPLPPKIMVHSQVSSISRK 549

Query: 541  PPIPARQHVKKQQLNSNEIIXXXXXXXXXXXXXXXXXXXXXXVYHIPTIEQSSNAYVSLS 600
            PPIPA+QHVKK+QLNSNEII                       Y+IPTIE+S N YVSLS
Sbjct: 550  PPIPAKQHVKKEQLNSNEII--QRKRQHQHQHYDQQILQPQRAYNIPTIERSPNVYVSLS 607

Query: 601  ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLH-SPRLSNSLNML 659
            ITGLRNLGNTCYINSMIQCLFAAK FRTLFISSKYKSYLQ  R N  H SP+LSNSL+ML
Sbjct: 608  ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIRSNGSHYSPKLSNSLSML 667

Query: 660  FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719
            F+KMYLNGGCSVVPTGFLKV+NQLRPDLKIPDDQQDTQEFLMILLDRLHDELS+Q HVAN
Sbjct: 668  FNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSDQQHVAN 727

Query: 720  DYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY 779
            DYPNLLLY+AD LKVSN EYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY
Sbjct: 728  DYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY 787

Query: 780  STFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPXXXX 839
            STFYVLSLAIPRRSMKLSKLGR  EKRVKLEDCINMFTSDEVLSGENAWDCPRCGP    
Sbjct: 788  STFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGP--TA 845

Query: 840  XXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNE---STSNNPVHFER 896
                     EN+ +IVKS+KKKSRFFTLHT +KRRHLDFFGD   E   S +NN   FER
Sbjct: 846  SVSTSVSALENEPSIVKSKKKKSRFFTLHTGTKRRHLDFFGDGITEGHNSNNNNTTIFER 905

Query: 897  ERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTINFVTLPKILVIHL 956
            ERSRSPF+MLGG GKRS S+TPF+               KLTTVKTINFVTLPKILVIHL
Sbjct: 906  ERSRSPFRMLGGSGKRSSSSTPFSTGGNDSNNSSDYKNKKLTTVKTINFVTLPKILVIHL 965

Query: 957  SRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEH 1016
            SRFYYDLTKKNNTV+TYPLILNIILKNNDTMKY+LFGVVNHTGTLISGHYTSLVNKDLEH
Sbjct: 966  SRFYYDLTKKNNTVVTYPLILNIILKNNDTMKYKLFGVVNHTGTLISGHYTSLVNKDLEH 1025

Query: 1017 NVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSDAYVLFYERVHD 1062
            NV+IGRSKWYYFDDEVVKAD+KHGSDK+LKISSSD YVLFYERV+D
Sbjct: 1026 NVNIGRSKWYYFDDEVVKADRKHGSDKNLKISSSDVYVLFYERVYD 1071

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/899 (48%), Positives = 536/899 (59%), Gaps = 95/899 (10%)

Query: 173  TSSTEED-ADQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLED 231
            T S EE   +  SP+WTAP+L+PNDQLKLAL  E++  P     G           L +D
Sbjct: 266  TDSDEEYYVEHGSPIWTAPDLDPNDQLKLALGTELLSPPVMGLDG---------DTLGDD 316

Query: 232  VPYTHNDNDGTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDG 291
            + Y         +   + F ++ A+R +THRKDSYHS+YM+D D   S N    D  ++ 
Sbjct: 317  IYYETVSKGDDVSYRGKDFEDLHANRLITHRKDSYHSIYMIDDDNNNSKN--YFD-GSNA 373

Query: 292  FIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNL 351
            FIQ LE LQKQSIITAPELF+ILSN  E  KLLLIDLR+ +RS  N+IVAPN+V IDP  
Sbjct: 374  FIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTN 433

Query: 352  LWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLL 411
            LWD + N P+Y+D ILEQ L  N  F  R K+ Y+V YSD+KT+M   +DYSFI FYLL 
Sbjct: 434  LWDNEANSPIYKDTILEQRL-NNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLT 492

Query: 412  TSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDDYLYRPYXXXXXXXXXXXXXXXX 471
            TS K  L++VPTALLGGYEKWKK ++TY  QY I +DDYLYRPY                
Sbjct: 493  TSGK-HLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNNKGEQNN----- 546

Query: 472  XXXXXXXXXXXXXAKIPEPPSWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIMVH 531
                         A+IP+ P+WK                                KI + 
Sbjct: 547  -------------AQIPDVPTWKPPPVPVMVRKRPPPPVPVSIPIPPETPPPLPQKIKLE 593

Query: 532  ------PHDNFQLRQPPIPARQHVKKQQLNSNEIIXXXXXXXXXXXXXXXXXXXXXXVYH 585
                  P DN Q  +PP     H      N                            + 
Sbjct: 594  SIEESAPSDNSQYIRPPAKLPIHALHSPRNQ----------------------TLTRKFS 631

Query: 586  IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645
            IPTIE++SN YV+ S+TGLRNLGNTCYIN M+Q LFA    + LFIS KY+ Y  +   N
Sbjct: 632  IPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDN 691

Query: 646  RLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLD 705
            +  +  +SN+   LF+KMY+NGGC+VVP+GFLK+ N LRPDL+IPDDQQDTQEFL+ +L+
Sbjct: 692  KESA--ISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILN 749

Query: 706  RLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
            RLHDELSNQ +V NDYPNLLLYD D + V  ++YK WFDK V+ NG+SP+D +FQGQMEN
Sbjct: 750  RLHDELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMEN 809

Query: 766  SLQCKRCGYTTFNYSTFYVLSLAIPRRSM-KLSKLGRPNEKRVKLEDCINMFTSDEVLSG 824
            +LQC+RCGY + NYSTFYVLSLA+P+ S     K GR     VKLEDCINMFTSDEVL+G
Sbjct: 810  ALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGR-----VKLEDCINMFTSDEVLTG 864

Query: 825  ENAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSN 884
            ENAWDCP+CG              +          KKS+FF L                 
Sbjct: 865  ENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGL----------------- 907

Query: 885  ESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXX-XXXXXXKLTTVKTI 943
                  P      RS+SPF+ LG   K                         KL T+KTI
Sbjct: 908  ------PTGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTI 961

Query: 944  NFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLIS 1003
            NF++LPK+L+IHLSRFYYDLTKKN+ V++YPL+LNI+LKN + ++Y+L+ +VNHTG LIS
Sbjct: 962  NFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLIS 1021

Query: 1004 GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFYERV 1060
            GHYTSLVNKD  HN+     KWYYFDDEVVKA+K HG+ DK + K+SS + YVLFYERV
Sbjct: 1022 GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080

 Score =  103 bits (257), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 81/117 (69%), Gaps = 1/117 (0%)

Query: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDAL 67
           FTPE+S +LL +++ +Y ++I+  +PQ             + + E Y+  +  +  + A+
Sbjct: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCVDVDT-SKAV 62

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVV 124
             F+ GC+Y++L++P+S+QFQTR+KSYS+Y++L+ +YE+++NMTNV+ MVK+E+  +
Sbjct: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQI 119

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/494 (60%), Positives = 351/494 (71%), Gaps = 63/494 (12%)

Query: 584  YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643
            + IPTIE+S N YVSLSITGLRNLGNTCYINSM+QCLFA ++FR LFISSK++S++  S+
Sbjct: 660  FSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSK 719

Query: 644  GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
                ++P++SNS N+LF KMYLNGGCSVVPT FLK  N LRPDL+IPDDQQDTQEFLMI+
Sbjct: 720  FP--NTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMII 777

Query: 704  LDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763
            LDRLHDELSNQ  V N+YPNLLLYD + LKV NKEYKHWFDKNVIGNG+SPID IF GQM
Sbjct: 778  LDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQM 837

Query: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823
            ENSLQC+RCG +++NYSTFYVLSLAIP+ S   +   R   KRVKLE+CINMFTSDEVLS
Sbjct: 838  ENSLQCQRCGNSSYNYSTFYVLSLAIPKPSS--TTFSR--SKRVKLEECINMFTSDEVLS 893

Query: 824  GENAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKK-----------KSRFFTLHTRSK 872
            GENAWDCP+CG              E   N+  S+KK           KS+FFTLHTRS 
Sbjct: 894  GENAWDCPKCG----SSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRS- 948

Query: 873  RRHLDFFGDSSNESTSNNPVHFERERSRSPF--KMLGGGGKRSHSNTPFAXXXXXXXXXX 930
                                     RS SPF  K        S  N P+           
Sbjct: 949  ------------------------HRSISPFRKKTSPAAVPSSTKNEPWKSK-------- 976

Query: 931  XXXXXKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYR 990
                 KL T+KT+NF+ LP ILVIHLSRFYYDLTKKNNTVITYPLILNI+LKNN+  KYR
Sbjct: 977  -----KLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYR 1031

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKS-LKIS 1048
            L+G+VNH+G LISGHYTSLVNK+  H++   + +WYYFDDE VK ++ HG  DK  L++S
Sbjct: 1032 LYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVS 1091

Query: 1049 SSDAYVLFYERVHD 1062
            S D YVLFYER+++
Sbjct: 1092 SRDVYVLFYERIYE 1105

 Score =  214 bits (544), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 110/208 (52%), Positives = 147/208 (70%), Gaps = 7/208 (3%)

Query: 252 EITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELF 311
           +   DR+  HRKDSYHS+YMVD     S +      +++ +I SLE LQKQ IITA ELF
Sbjct: 327 QTNPDRASNHRKDSYHSIYMVDDG---SADGITQYYDSNPYIHSLERLQKQCIITAQELF 383

Query: 312 TILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLL 371
           +ILSN  E  KLLLIDLR P+R + N+IVAPNL+ IDP LLW+ KTN P+Y    LE LL
Sbjct: 384 SILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLL 443

Query: 372 ---EGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTR-LATVPTALLG 427
              +  +   NR +F+Y+V Y+D KT+M  NFDYSF FFYLL+TS+  + + + PT LLG
Sbjct: 444 YEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLG 503

Query: 428 GYEKWKKTLHTYAQQYHISIDDYLYRPY 455
           GY+KWKK L++Y++QY+ ++ DYLY+P+
Sbjct: 504 GYDKWKKVLYSYSEQYNFNMGDYLYKPH 531

 Score =  178 bits (451), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 103/225 (45%), Positives = 135/225 (60%), Gaps = 31/225 (13%)

Query: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPN-DA 66
           FTPEYSNELL++V+ +YH+DIKHYYPQ           HTEYL EL+    ++   N D 
Sbjct: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKDV 68

Query: 67  LTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLD 126
           LTAF++GCYY+FLIIPQS+QFQ++NKSY IY++LKK+YENE +MTNV+LMVK EI  VLD
Sbjct: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128

Query: 127 -DSVKHVVGIEHRITKK-RAFSVPGIXXXXXXXXXXXXXXGPRGHLHKTSST-------- 176
            D   +   + HRI K+ RA+S+                   + H++  + T        
Sbjct: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188

Query: 177 -----------EE---------DADQSSPVWTAPNLEPNDQLKLA 201
                      EE         D D++SP+WTAP+LEP DQLKLA
Sbjct: 189 HHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLA 233

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/481 (59%), Positives = 348/481 (72%), Gaps = 50/481 (10%)

Query: 584  YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643
            Y IPTIE+SSN YVSLSITGLRNLGNTCYINSM+QCLFA   FR LF+S K++ +  Q+ 
Sbjct: 590  YSIPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVSGKFEEFFNQNY 649

Query: 644  GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
             NR   P+LS S N+LF KMY+NGGCSVVPT FLKV++ LRPDL+IPDDQQDTQEFLM+ 
Sbjct: 650  SNR---PQLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFLMVT 706

Query: 704  LDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763
            LDRLHDELSNQ  VAN+YP+LLLYD   + V+ KEYK WF+++VIGNG++PID IFQGQ+
Sbjct: 707  LDRLHDELSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPIDHIFQGQI 766

Query: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823
            EN L+C+RCG ++F+YSTFYVLSLAIP+ S   S   R   KRVKLEDCINMFT+DE+LS
Sbjct: 767  ENILECQRCGNSSFSYSTFYVLSLAIPKPST--STFSR--AKRVKLEDCINMFTNDEILS 822

Query: 824  GENAWDCPRCGPXXXXX--XXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGD 881
            GENAWDCP+CG                +  S + + R+ KS FF +H++SK         
Sbjct: 823  GENAWDCPKCGSAVTDMGPNHLKKSKKKKKSELGEERRSKSGFFRIHSKSK--------- 873

Query: 882  SSNESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVK 941
                            RS+SPF+MLG       +  P A               +L+T K
Sbjct: 874  ----------------RSKSPFRMLGS------TKFPLA--------MEDWKSKELSTKK 903

Query: 942  TINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTL 1001
            T+NF+ LP +L+IHLSRFYYDLTKKN+T++TYPL+LNIILKNN+T +YRL+ VVNHTG L
Sbjct: 904  TLNFIFLPPVLIIHLSRFYYDLTKKNDTIVTYPLVLNIILKNNETARYRLYAVVNHTGNL 963

Query: 1002 ISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKS-LKISSSDAYVLFYER 1059
            ISGHYTSLVNK+  H +D GR KWYYFDDEVVK + KHG+ D+  LK+SSSD YVLFYER
Sbjct: 964  ISGHYTSLVNKEPMHKLDKGRQKWYYFDDEVVKEETKHGNIDQGILKVSSSDVYVLFYER 1023

Query: 1060 V 1060
            +
Sbjct: 1024 L 1024

 Score =  393 bits (1009), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/480 (44%), Positives = 291/480 (60%), Gaps = 38/480 (7%)

Query: 7   SFTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDA 66
           SFTPEYSNELLR V++LY +DIKHY+ Q           HTEYLFE YL  +  +   DA
Sbjct: 7   SFTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQDA 66

Query: 67  LTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLD 126
           LTAF+IGCYY++LI+PQS++FQTRNKSYSI++DL KMY+N+ NMTNV+LMVK E+  +LD
Sbjct: 67  LTAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDSILD 126

Query: 127 DSVKHVVGIEHRITKKRAFSVP--GIXXXXXXXXXXXXXXGPRGHLHKTSSTE------- 177
            + +     EH+  + RA+SVP                   P G     S +E       
Sbjct: 127 RNAREFKEFEHQKARTRAYSVPDRNFESRLTNLNIHNENPLPLGDHQAASKSEQGREDMN 186

Query: 178 --EDADQSSPVWTAPNLEPNDQLKLAL-----------LPEVIPTPAFPESGRKTSTPVR 224
             ++ + SSPVWTAP LEPNDQL++AL           L + + T     S  + +   R
Sbjct: 187 NLQNDEDSSPVWTAPPLEPNDQLRIALDATPLSPSIMALDQPMATKELAISTSRKALSRR 246

Query: 225 QSVLLEDVPYTHNDNDGTSASSDQPFGEI---------TADRSVTHRKDSYHSVYMVDSD 275
            S  +   PY   + D +    +  + E+           DR  THRKDSYHSVYM    
Sbjct: 247 ASA-MGPTPYPIEELDISGQDGNSHYDELGFNKTLWNANVDRQTTHRKDSYHSVYM---- 301

Query: 276 TFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSA 335
            F+  +DD +   +  F Q LE LQKQSIITAPELFTILS+  ESEKLLLID R+ +RS 
Sbjct: 302 -FEGGSDDHMPSISKDFTQGLERLQKQSIITAPELFTILSSSEESEKLLLIDFRLSKRSK 360

Query: 336 LNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTF 395
           +N+I+AP  V+IDP  LWD KTN P+     L+++++    F+ R  + Y+V Y+D+KT+
Sbjct: 361 VNHIIAPTTVEIDPRQLWDPKTNTPISNAATLDEIIK-KPAFLERGSYDYIVYYTDMKTY 419

Query: 396 MTMNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDDYLYRPY 455
           MT+++DY F  FYLL  S    L ++PT LLGGYEKWKK +  Y+  + +++D+Y+YRPY
Sbjct: 420 MTIDYDYMFTLFYLLTASPTVNLRSLPTHLLGGYEKWKKIMKNYSVDHGVNMDNYIYRPY 479

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  552 bits (1423), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 285/479 (59%), Positives = 338/479 (70%), Gaps = 42/479 (8%)

Query: 586  IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645
            IPTIE+S N YVSLSITGLRNLGNTCYINSM+QCLFA + FR LF++SKY S+L  S+  
Sbjct: 592  IPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYSSFLNGSKFP 651

Query: 646  RLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLD 705
              +SP +SNS N+LF KMYLNGGCSVVPT FLK  N LRPDLKIPDDQQDTQEFLMI+LD
Sbjct: 652  --NSPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMIILD 709

Query: 706  RLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
            RLHDELSNQ  V N+YP+L+LYD + L+V ++EYKHWF+K+VIGNG+SPID+IFQGQ+EN
Sbjct: 710  RLHDELSNQQEVVNEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSPIDEIFQGQIEN 769

Query: 766  SLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGE 825
             LQC+RCG+++FNYSTFYVLSLAIP    K S  G    KRVKLEDCINMFT+DE+LSGE
Sbjct: 770  GLQCQRCGHSSFNYSTFYVLSLAIP----KPSPTGFSRSKRVKLEDCINMFTNDEMLSGE 825

Query: 826  NAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNE 885
            NAWDCP CG                     +  + KSRFF L TR               
Sbjct: 826  NAWDCPNCGSNAQDRVRVNTDQSVKKKRQGEEHRHKSRFFGLPTRP-------------- 871

Query: 886  STSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTINF 945
                        RS SPF+  G     S S                    KL T+KT+NF
Sbjct: 872  -----------HRSLSPFRKSGSSSTNSTSKI---------KHEQQWKTKKLITIKTLNF 911

Query: 946  VTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGH 1005
            + LP +LVIHLSRF+YDLTKKN TVITYPLILNI+LKNN+  KY+L+G+VNHTG LISGH
Sbjct: 912  IMLPPVLVIHLSRFFYDLTKKNKTVITYPLILNIVLKNNEVAKYKLYGIVNHTGNLISGH 971

Query: 1006 YTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFYERVHD 1062
            YTSLVNK+  HN++  + +WYYFDDEVVKA+  HG  D  + K+SS D YVLFYER+++
Sbjct: 972  YTSLVNKEPGHNLNHNQQRWYYFDDEVVKAEGNHGDIDNGISKVSSKDVYVLFYERLYE 1030

 Score =  408 bits (1049), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 236/486 (48%), Positives = 306/486 (62%), Gaps = 40/486 (8%)

Query: 6   TSFTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPND 65
           ++FTPEYSNELLRR++ +Y EDIKHYYPQ           HTEYLFEL+L         D
Sbjct: 8   STFTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKD 67

Query: 66  ALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVL 125
           ALT+F++GCYY+FLI+PQS+QFQ+RNKSY IYSDLKK+YEN+ +MTNV+LMVK EI  +L
Sbjct: 68  ALTSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETIL 127

Query: 126 DDSVKHVVG-IEHRITKKRAFSVPGIXXXXXXXXXXXXX-----XGPRGHLHKTSSTEED 179
           + + +  +    +RI ++RA+SVP                      PR  L   S    D
Sbjct: 128 EKTAEREINETNNRIVRQRAYSVPDSNDLTEQLHSLSVSDRNLKSPPRKILMNNSFEHSD 187

Query: 180 A-------DQSSPVWTAPNLEPNDQLKLALLP-EVIPTPAFPESG--RKTSTPVRQSVLL 229
           +       D SSP+WTAP LEP DQLKLA+L  E +P P  P     ++ +  ++Q  + 
Sbjct: 188 SDVINEENDMSSPLWTAPPLEPTDQLKLAVLGNETLPPPVIPYEADIQERTDLLKQPSIP 247

Query: 230 EDVPYTHN-----------------DND---GTSASSDQPFGEITADRSVTHRKDSYHSV 269
           E  P T +                 DND       S+++ F E  ADRS THRKDSYHSV
Sbjct: 248 ELSPTTTSLKNSKDFNSPFQSVISLDNDIPLVREPSNNRSFRETNADRSQTHRKDSYHSV 307

Query: 270 YMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLR 329
           YM+D ++  +D  +     TD +IQ L+ LQKQSIITA EL +ILS   E  KLLLIDLR
Sbjct: 308 YMIDEES--TDKLNQFYDSTD-YIQDLQRLQKQSIITAQELLSILSCPPERIKLLLIDLR 364

Query: 330 IPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCY 389
             +R+ALN+IVAPN+V IDP+LLWD  T+ P+Y  + LE+LL+ NE F  R +F+YVV Y
Sbjct: 365 WSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMETLEKLLD-NELFNRRHEFEYVVYY 423

Query: 390 SDVKTFMTMNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDD 449
           +D+KT+M  +FDY+F  FYLL T     L + PT LLGGY+KWK  LH YA++Y I+I D
Sbjct: 424 TDMKTYMHSDFDYNFTLFYLLTTETTNILRSTPTYLLGGYDKWKVFLHHYAKEYDINIPD 483

Query: 450 YLYRPY 455
           YLYRPY
Sbjct: 484 YLYRPY 489

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1161

 Score =  529 bits (1363), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 281/503 (55%), Positives = 338/503 (67%), Gaps = 38/503 (7%)

Query: 583  VYHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQS 642
             Y IPTIEQ+ N YVSLSITGLRNLGNTCYINSMIQCLFA K FR LFIS KYK +L++ 
Sbjct: 672  TYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEV 731

Query: 643  R---GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEF 699
                G     P +S +  +LF KMYLNGGCSVVP  FLK  + LRPD KIPDDQQDT EF
Sbjct: 732  APKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEF 791

Query: 700  LMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIF 759
            LM++LDRLHDELSNQ  V N+YP+L+LYD   L V NKEYK WFDK+VIGNG+SPIDDIF
Sbjct: 792  LMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIF 851

Query: 760  QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSD 819
            QGQMENSL C+RCG+++FNYSTFYVLSLAIP+ +   S   R   KRV LE+C+NM+TSD
Sbjct: 852  QGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATS--STFSR--SKRVSLEECLNMYTSD 907

Query: 820  EVLSGENAWDCPRCGPXXXXXXXXXXXXXENDS-------NIVKSRKKKSRFFTLHTRSK 872
            EVLSGENAWDCP C                N +           S  KK + F+     +
Sbjct: 908  EVLSGENAWDCPNCCKITKDYKGMVEKTKRNKAARDTLSPGSSSSSSKKGKLFSFSLHHR 967

Query: 873  RRHLDFFGDSSNESTSNNPVHFERERSRSPFKMLGGGGKR-------SHSNTPFAXX--- 922
              H    G+  N S  N        RS SPF++LGG   +       SHS          
Sbjct: 968  HHHRSELGE-LNVSKIN--------RSLSPFRVLGGSSSKSVRKSEDSHSRADVDAQRDI 1018

Query: 923  ---XXXXXXXXXXXXXKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNI 979
                            KL T+KT+NF+ +P+ L+IHLSRFYYDLTKKN+T++TYPLILNI
Sbjct: 1019 DELREMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNI 1078

Query: 980  ILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKH 1039
            +LK+N+ +KY+L+GVVNHTG LISGHYTS+V+K L+H+++     WYYFDDEVVK + +H
Sbjct: 1079 VLKSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRH 1138

Query: 1040 GSDKS--LKISSSDAYVLFYERV 1060
            G  K   +KISSSD YVLFYER+
Sbjct: 1139 GDVKHGVMKISSSDVYVLFYERI 1161

 Score =  345 bits (886), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 213/536 (39%), Positives = 287/536 (53%), Gaps = 94/536 (17%)

Query: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDAL 67
           FTPE S+EL +RV  +Y +DI    PQ           HTE+L+ELYL  +  ++  DAL
Sbjct: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDD 127
            +F+ GC+YV+L++PQS+QF TRN+++++YSD++ +YE+++NMTNV+LMVK+E+ VVL +
Sbjct: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVL-E 132

Query: 128 SVKHVVGIEHRITKKRAFSVP-------GIXXXXXXXXXXXXXXGPRGH----------- 169
           S      +  RI + RA+SVP        +               PR             
Sbjct: 133 SQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPG 192

Query: 170 -----------------LHKTSSTEEDA-DQSSPVWTAPNLEPNDQLKLALLPEVIPTPA 211
                            LH   S   D  DQSSP+W AP LEPNDQLKLA     +P  A
Sbjct: 193 NVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAEVHDLPPGA 252

Query: 212 -------------------FPESG---------------------------RKTSTPVRQ 225
                              + E G                               TP   
Sbjct: 253 ISRGSDADEEEDVDDLEIGYEEMGIYGLAHHSVAPPQHAPPPVPLSSQSPITSGGTPAAI 312

Query: 226 SVLLEDVPYTHNDNDGTSASS--------DQPFGEITADRSVTHRKDSYHSVYMVDSDTF 277
             L+     TH     T A+         D+ F + T DRS+THRK+SYHSVYM++    
Sbjct: 313 DDLMMRRRRTHTMTQMTPAAQTVPPGGAHDRSFKDFTPDRSLTHRKNSYHSVYMLEES-- 370

Query: 278 KSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALN 337
           +S   +L   E++ +IQSLE LQKQSIITAPELF+ILSN+ +S++LLLIDLR+  R   +
Sbjct: 371 ESSQGNLYYDESNAYIQSLERLQKQSIITAPELFSILSNEQQSKQLLLIDLRLDYRYNTS 430

Query: 338 NIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMT 397
            I+APN V IDP +LW+  +  P+Y+   LE  L  N  F  RD+F YVV +SD+KTFM 
Sbjct: 431 KIIAPNTVHIDPKMLWNSNSGAPMYEITELESKL-NNPLFNRRDEFDYVVYFSDMKTFMK 489

Query: 398 MNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDDYLYR 453
           +NFDY F FFYLL T++   L  VPT LLGGYEKWKK +  Y +QY+I + DYL R
Sbjct: 490 LNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKVILEYGKQYNICVTDYLVR 545

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  515 bits (1326), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 263/480 (54%), Positives = 328/480 (68%), Gaps = 41/480 (8%)

Query: 584  YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643
            + IPTIE+S N +VSLSITGLRN+GNTCYINSM+QCLF    FR LF+  KY  YL   R
Sbjct: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629

Query: 644  GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
             N +    +S   ++LF KMYLNGGCSVVP GFLK  + LRPD  IP DQQDTQEFL+ L
Sbjct: 630  SNTI----ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFL 685

Query: 704  LDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763
            LD LHDELS    VANDYPNLLL+D + L V NKEY  WFD+ +  NG+SPIDDIFQGQM
Sbjct: 686  LDTLHDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQM 745

Query: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823
            ENSL+C+RCG+T++NYSTFYVLSLAIP  +M   K    ++K ++LEDCIN++T DE+L+
Sbjct: 746  ENSLKCQRCGFTSYNYSTFYVLSLAIP--AMPPPKTFSRSKKIIRLEDCINLYTQDELLT 803

Query: 824  GENAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSS 883
            GENAWDCP+CG                +S+    +KKK  F +++   K R   FF  SS
Sbjct: 804  GENAWDCPKCGTHSNSSDGSM------NSDETVDKKKKKNFLSVNGDHKSRS-KFFKLSS 856

Query: 884  NESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTI 943
            + S          +RS SPFK      ++ H  +                  K+TT+KT+
Sbjct: 857  SRSG---------KRSLSPFKSNSVKPEKLHIKS-----------------KKMTTIKTL 890

Query: 944  NFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLIS 1003
            NF+T+P ILVIHLSRF+YDLTKKN T+I YPLIL+++LKNN+  +YRL+G++NH G L+S
Sbjct: 891  NFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVS 950

Query: 1004 GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFYERVH 1061
            GHYTSLVNK L H +  G+ KWYYFDDEVVK +  HG  D+ +  ISS D YVLFYER+H
Sbjct: 951  GHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIH 1010

 Score =  241 bits (616), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 168/500 (33%), Positives = 248/500 (49%), Gaps = 96/500 (19%)

Query: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDAL 67
           +TPEYS+ELL  V+++Y +D+KHYY +             E LFE Y +S+  E+  D L
Sbjct: 5   YTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKYEDCL 64

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDD 127
             +VIG +YVFLIIP S+QF  RNKSYSIYSDLKK+Y++E+NM+NV+LMV  ++  VL+ 
Sbjct: 65  CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124

Query: 128 SVKHVVGIEHRITKKRAFSV--PGIXXXXXXXXXXXXXXGPRGHLHKTSSTEEDADQ--- 182
           +++ +       ++KRAFSV  P I                R  LH       D      
Sbjct: 125 NMEILAKQHLDPSRKRAFSVEEPII----------------RYQLHNLQLNNADQKSVDD 168

Query: 183 -----SSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVPYT-H 236
                +S  W AP L+PND+L LA+            S + T +    S+ L++  Y   
Sbjct: 169 DYKSFASTEWKAPQLDPNDRLHLAI-----------ASSKTTESSSLNSISLDENLYKEQ 217

Query: 237 NDNDGTSASSDQPFGEI------------------------------------------- 253
           +D D   + SD+  G I                                           
Sbjct: 218 DDTDALDSVSDKLLGSIHKPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMD 277

Query: 254 TADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTI 313
           + DRS THRKDSYHSVY+ D      + +DL ++ T      L   Q+++ I    LF++
Sbjct: 278 SFDRSRTHRKDSYHSVYLGD------ELEDLNNIST-----GLARHQQENTIDCFALFSL 326

Query: 314 LSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEG 373
           L +    E LLLIDLR+P+R   N++VAPNL+ IDP LL+D +    +   + L++++  
Sbjct: 327 LKDAESRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIV-A 385

Query: 374 NEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWK 433
           N       ++  +V Y+D K+FM + F+Y  I F LL     T    +P +LLGGYE+WK
Sbjct: 386 NPILDKISQYDNIVYYTDYKSFMHLTFNYELILFELLFKKTGT---AIPKSLLGGYEQWK 442

Query: 434 KTLHTYAQQYHISIDDYLYR 453
             L+   +        +L+R
Sbjct: 443 AFLNKQLRDSEFDKSLFLFR 462

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
            (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  507 bits (1305), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 267/477 (55%), Positives = 319/477 (66%), Gaps = 48/477 (10%)

Query: 586  IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645
            IPTIEQSSN YV+LSITGLRN+GNTCYINSM+QCLFA + FR LF+S KY+ Y  +   N
Sbjct: 540  IPTIEQSSNEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYFSKRYSN 599

Query: 646  RLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLD 705
                 +LS   N+LF KMY+NGGCSVVPTGFLK  N LRPDLKIP +QQDTQEFL+ LL 
Sbjct: 600  ---PHQLSKYFNILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLS 656

Query: 706  RLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
            +LHDELS   HVANDYPNLLL+D + L V  KEY  WF+ N+  NGISPID IFQGQMEN
Sbjct: 657  QLHDELSESNHVANDYPNLLLHDDESLAVDQKEYDKWFESNISENGISPIDAIFQGQMEN 716

Query: 766  SLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGE 825
             L C+RCG++++NYS FYVLSLAIP     +S  G+  +K+++LEDCIN+FTSDE L+ E
Sbjct: 717  GLLCQRCGHSSYNYSMFYVLSLAIP---ASMSSFGQ--KKKMRLEDCINLFTSDEKLTNE 771

Query: 826  NAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNE 885
            NAWDCP+CG                  N     KKK +F                     
Sbjct: 772  NAWDCPKCGSAV-------------SGNGPDGDKKKRKFL-------------------- 798

Query: 886  STSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTINF 945
            STS+N       RSRS F  L     RS S +PF                KL+T+KT+NF
Sbjct: 799  STSDN----SNGRSRSRFFKL-RSKSRSRSVSPFHKPSSQSPASEKWKSKKLSTIKTLNF 853

Query: 946  VTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGH 1005
            V+LP +L IHLSRF YDLT KNN VITYPL L+I+LKNN+ + YRL+ + NH G LISGH
Sbjct: 854  VSLPSVLTIHLSRFLYDLTNKNNKVITYPLTLSIVLKNNEVVNYRLYAIANHFGNLISGH 913

Query: 1006 YTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFYERV 1060
            YTSLVNKDL H++  GR KWYYFDDEV K D  HG+ D  +  +SSSD YVLFYE++
Sbjct: 914  YTSLVNKDLSHDLGNGRQKWYYFDDEVAKRDLNHGNIDAGITSVSSSDVYVLFYEKI 970

 Score =  280 bits (716), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 177/471 (37%), Positives = 252/471 (53%), Gaps = 55/471 (11%)

Query: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDAL 67
           ++PEYSNELL+ V+++Y +DI HYYP+           H EYLFE Y  S+  ++ ++ L
Sbjct: 5   YSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQNSELL 64

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDD 127
           TAFV+GC+Y++LIIP S+QF +R+KSY+IY+DL+K Y++E NMTNV+LMV   I  V  D
Sbjct: 65  TAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTGVIESVSRD 124

Query: 128 SVKHVVGIEHRITKKRAFSVPGIXXXXXXXXXXXXXXGPRGHLHKTSSTEEDADQSSPVW 187
            ++       +I +KRA+SVP                 P       +  E D +  S +W
Sbjct: 125 ELESA-----KIMRKRAYSVP---HKKLSDKMQALTLSPETASSTNAGPETDNENDSTMW 176

Query: 188 TAPNLEPNDQLKLAL-------LPEVIPTPAFPESGRKTST-----------------PV 223
           TAP LEPND LK+ L               AF       S+                 P 
Sbjct: 177 TAPELEPNDHLKVNLGGHNSSVSSRSSNEQAFKVGNEGNSSSSDDIEMAVHSTTQDQRPR 236

Query: 224 RQSVLLE-DVPYTHNDNDGTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFKSDND 282
           R SV ++ + P      +   ++ D  + +   DR  THRK SYHSV+M           
Sbjct: 237 RSSVPIKVEAP-----QNSLQSTVDDIYCQ-KVDRYNTHRKGSYHSVHMTGD-------- 282

Query: 283 DLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAP 342
                E D F  +   LQKQSIIT  +L  IL ++ E+E+LLL+DLR  +R   N+IVAP
Sbjct: 283 -----EYDSFTFNTARLQKQSIITCDKLLRILDSE-EAERLLLVDLRFIKRFETNHIVAP 336

Query: 343 NLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDY 402
           NLV +DP  LWD    + +  D  LE +L  N    +  +F+++V Y+D+KTFM ++FDY
Sbjct: 337 NLVNLDPMNLWDFAKGRAIEGDAPLE-VLNKNHALKDLSQFKHIVYYTDMKTFMRLDFDY 395

Query: 403 SFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDDYLYR 453
             +FF +L TS   R++  P  LLGGYE+WKK L    Q      + +L+R
Sbjct: 396 QLVFFQMLYTSN-WRISCTPKVLLGGYEQWKKFLAKVPQSRVPIKEAFLFR 445

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 974

 Score =  501 bits (1291), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 261/477 (54%), Positives = 316/477 (66%), Gaps = 48/477 (10%)

Query: 586  IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645
            IPTIEQS N YV+LSITGLRN+G TCY+NSM+QCLFA K FR LF+S+KY+ Y  +   N
Sbjct: 540  IPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTN 599

Query: 646  RLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLD 705
                 +LS   N+LF KMY+NGGCSVVPTGFLK  N LRPD +IP DQQDTQEFL+ LL 
Sbjct: 600  ---PNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLS 656

Query: 706  RLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
            +LHDELS    VANDYP LLL+D   L V  KEY  WF+K++  NGISPID+IFQGQMEN
Sbjct: 657  QLHDELSESNRVANDYPGLLLHDDKKLDVDQKEYDTWFEKHISENGISPIDNIFQGQMEN 716

Query: 766  SLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGE 825
             L C+RCG+++FNYS FYVLSLAIP  +   S+      K+V+LEDCIN+FTSDE L+ E
Sbjct: 717  GLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQ-----RKKVRLEDCINLFTSDEQLTNE 771

Query: 826  NAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNE 885
            NAWDCP+CG                 S      +KK + F L+  ++             
Sbjct: 772  NAWDCPKCGTSA--------------SGTGPEEEKKKKRFLLNPDTR------------- 804

Query: 886  STSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTINF 945
              S N   F        FK+      RS S +PF                KLTT+KT+NF
Sbjct: 805  -ASGNRSRF--------FKLRSK--SRSRSVSPFRKQSSQQQNLEKLKSKKLTTIKTLNF 853

Query: 946  VTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGH 1005
            ++LP +L IHLSRF+YDLTKKNN VITYPLIL+I+LKN   MKYRL+ + NH G LISGH
Sbjct: 854  ISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLISGH 913

Query: 1006 YTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFYERV 1060
            YTSLVNKDL+H+++ G+ KWYYFDDE VK D  HG  D  +  ISSSD YVLFYE++
Sbjct: 914  YTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970

 Score =  306 bits (784), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 186/474 (39%), Positives = 258/474 (54%), Gaps = 64/474 (13%)

Query: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDAL 67
           ++PEYSNELL+ V+D+Y +DI HY+P+           H EYLFE Y  ++   +  D L
Sbjct: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDD 127
           TAFV GC+Y++LIIP S+QFQ+R+KSY+IY+DLKK Y++E NMTNV+LMV + I  +  D
Sbjct: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSKD 124

Query: 128 SVKHVVGIEHRITKKRAFSVPGIXXXXXXXXXXXXXXGPRGHLHKTSSTEEDADQSSPVW 187
            V+       RI +KRA+SVP                     +   + TE + +  + +W
Sbjct: 125 EVETA-----RIMRKRAYSVP---YGKSPVTIQALSKANSATVEPDAPTETEFENGTTMW 176

Query: 188 TAPNLEPNDQLKLALL-----------------------------PEVIPTPAFPESGRK 218
           TAP LEPND LK++L                              PE+          R+
Sbjct: 177 TAPELEPNDHLKVSLGSHHSSTSSASSNEQFPKIHNESHSFPFEEPELHALSLGGSRTRR 236

Query: 219 TSTPVRQSVLLEDVPYTHNDNDGTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFK 278
           +S P R S  L            T AS+   F +   +R  THRKDSYHSV+M       
Sbjct: 237 SSVPARASRKL----------GTTQASNSSDFNDQKINRYATHRKDSYHSVHM------- 279

Query: 279 SDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNN 338
             NDD      D F  +L  LQKQS++T  +L  IL +Q + + LLLIDLR  +R   N+
Sbjct: 280 -SNDDY-----DAFTFNLARLQKQSVVTCDQLMRILCSQ-DRDNLLLIDLRFSKRFQTNH 332

Query: 339 IVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTM 398
           I+APNL+ +DP LLW++    P+  D  LE+ L+ N+    R +F+Y+V Y+D+KTFM +
Sbjct: 333 ILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLD-NKLLNARSQFEYIVYYTDMKTFMKL 391

Query: 399 NFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDDYLY 452
           +FDY  +FF L+ TS K  L   P  LLGGYE+WKK L   +Q Y    D +LY
Sbjct: 392 DFDYQLVFFQLIYTSNKN-LKCTPKVLLGGYEQWKKFLSKSSQAY-CDKDAFLY 443

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] {ON}
            complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  476 bits (1225), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 244/449 (54%), Positives = 301/449 (67%), Gaps = 48/449 (10%)

Query: 616  MIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTG 675
            M+QCLF  K+ R LFISSKY+ YL + R +R  S  LS S ++LF KMYLNGGCSVVPT 
Sbjct: 1    MVQCLFGTKLLRDLFISSKYEKYLSK-RIDR--SSNLSRSFSILFKKMYLNGGCSVVPTS 57

Query: 676  FLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVS 735
            FLK  NQLRPDL+IPDDQQDTQEFLM++LDRLHDELSNQ  V  DYP+L+LYD   L+V+
Sbjct: 58   FLKTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVN 117

Query: 736  NKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMK 795
            NKEY  WFDK +  NG+SPID IFQGQ+EN+L C+RCG+ ++NYSTFYVLSLAIP+ S  
Sbjct: 118  NKEYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSS- 176

Query: 796  LSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPXXXXXXXXXXXXXENDSNIV 855
                 R   KRVKLEDCINMFT+DEVLSGENAWDC  CG                     
Sbjct: 177  -GTFSR--SKRVKLEDCINMFTNDEVLSGENAWDCSNCGSS------------------- 214

Query: 856  KSRKKKSRFFTLHTRSKRRHLDFFGDSSNESTSNNPVHFERERSRSPFKMLGGGGKRSHS 915
                      ++H   +R+          + T+ N    +R R    F +    G+ S S
Sbjct: 215  ----------SVHNVEQRK----------DKTTGNGEEKKRSRKSRLFLLPNINGRSSRS 254

Query: 916  NTPFAXXXXXXXXXXXXXXXKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPL 975
             +PF                KL T+K++NF++LP  LVIHLSRFYYDL+KKN T++TYPL
Sbjct: 255  ISPFRKSASPRPPHEKLKHKKLVTIKSMNFISLPPTLVIHLSRFYYDLSKKNETIVTYPL 314

Query: 976  ILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKA 1035
            ILNI+L NN+T KYRL+G+VNHTG LISGHYT+LVNK+  H +   + KWYYFDDEVVK 
Sbjct: 315  ILNIVLNNNETAKYRLYGIVNHTGNLISGHYTTLVNKEKNHELKKDKQKWYYFDDEVVKE 374

Query: 1036 DKKHGS--DKSLKISSSDAYVLFYERVHD 1062
            +  HG+  +  +K+SSS  YVLFYERV++
Sbjct: 375  ENNHGNIDEGVIKVSSSQVYVLFYERVYN 403

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  490 bits (1262), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 253/478 (52%), Positives = 323/478 (67%), Gaps = 45/478 (9%)

Query: 586  IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645
            +PTIEQ+ N YVSLSITGLRNLGNTCYI+SM+QCLFA    R LFI++KY+SY+     +
Sbjct: 609  VPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYINHKVTD 668

Query: 646  RLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLD 705
            +++   LS S ++LF KMYLNGGCSVVP  FLK  NQLRPDLKIPDDQQDTQEFLM++LD
Sbjct: 669  KIN---LSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVLD 725

Query: 706  RLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
            RLHDELS +  V NDY NLLLYDA+ + V   +YK WF+ + +  G+SPIDDIFQGQ+EN
Sbjct: 726  RLHDELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIFQGQIEN 785

Query: 766  SLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGE 825
            S+ C+RCGY++FNYS+FYVLSLAIP    K+S +      RVKLEDCINMFT DEVLSGE
Sbjct: 786  SINCQRCGYSSFNYSSFYVLSLAIP----KISVMSFSRTNRVKLEDCINMFTRDEVLSGE 841

Query: 826  NAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNE 885
            NAWDC RCG                  N VK+                 H D   + ++E
Sbjct: 842  NAWDCSRCG--------------SQSDNFVKT----------------SHNDHHKEHTSE 871

Query: 886  STSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTINF 945
            +T ++    ++ R    F +       S S +PF                K+ T+K++NF
Sbjct: 872  TTDDS----KQNRKSRLFLLPKKYNPTSRSLSPFG-RHSSHKSSEKWKSKKMETIKSLNF 926

Query: 946  VTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLI-SG 1004
            + +PKILVIHLSRF+YD++KKN TV+ YPLILNI+LKN +  KYRL+ +VNH G  + SG
Sbjct: 927  IKMPKILVIHLSRFFYDMSKKNETVVAYPLILNIVLKNEEVCKYRLYAIVNHMGNQVASG 986

Query: 1005 HYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFYERV 1060
            HYT+LVNK+  H++     +WYYFDDEVVK +  HG+ D+ + K+SSS  YVLFYE++
Sbjct: 987  HYTTLVNKNRNHDLGKNEQQWYYFDDEVVKHELNHGNIDEGVNKVSSSHVYVLFYEKI 1044

 Score =  355 bits (911), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 203/496 (40%), Positives = 302/496 (60%), Gaps = 58/496 (11%)

Query: 6   TSFTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPND 65
           ++FTPEYSNELL+RV D Y+ +IK ++PQ           HT YL E YLD +  ++ ++
Sbjct: 5   STFTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYDE 64

Query: 66  ALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVL 125
            L+A+++GC+Y++LIIP S QFQ RNKS+ IY++LK +Y+N+ NMTNV+ +VK E+  +L
Sbjct: 65  CLSAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSIL 124

Query: 126 DDSVKHVVGIEHRITKKRAFSVPG-------------IXXXXXXXXXXXXXXGPRGHLHK 172
           D+S+  + GIE  I + RA+S P              I                + H  +
Sbjct: 125 DESILELEGIEKVIKRDRAYSSPAPKVNNISKFSKLSINDNHHNGETISTDNKLQSHFPQ 184

Query: 173 T-------------------SSTEEDADQSSPVWTAPNLEPNDQLKLALLP------EVI 207
           T                   S++ E+A+ ++P+W  P+LEPNDQLKLAL        E I
Sbjct: 185 TPNYSNSNNSTGSFNNVKSNSNSSEEAEDTAPIWHIPSLEPNDQLKLALEQPVEFSDEEI 244

Query: 208 PTPAFPES-GRKTS--TPVRQ-------SVLLEDVPYTHNDNDGTSASSDQPFGEITADR 257
              +  E  GR+ S  +P ++       S  L  VP+ HN+ND    +S     ++  DR
Sbjct: 245 DASSISEPLGRRYSPLSPYQKKRNSSISSAFL--VPFPHNENDKVHDNS-MLIEDLPVDR 301

Query: 258 SVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQ 317
           SVTHRKDSYHSVYM + D  +SD+     + ++ +IQS++ LQKQ++IT  EL++ILS+ 
Sbjct: 302 SVTHRKDSYHSVYMNNQDE-ESDSGAHYGL-SNSYIQSMDRLQKQNVITCSELYSILSSP 359

Query: 318 SESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLE--GNE 375
           +E +KLLL+DLRIP+ S  N+I+AP+++KIDPNLLW+++T  P+Y     E+L++   N 
Sbjct: 360 TERQKLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNEETQTPIYS---FEELVKRINNP 416

Query: 376 HFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKT 435
                +KF Y+V YSD++TFM  ++D+ F FFYLLL+++   L  VPT LLGG+EKWKK 
Sbjct: 417 LISEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYLLLSTKSLNLKQVPTNLLGGFEKWKKV 476

Query: 436 LHTYAQQYHISIDDYL 451
           L TY ++Y I I  ++
Sbjct: 477 LKTYNKEYGIDITPFI 492

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1212

 Score =  487 bits (1253), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 257/500 (51%), Positives = 322/500 (64%), Gaps = 46/500 (9%)

Query: 584  YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643
            + IP +E+S N YVSLSITGLRNLGNTCYINSM+QCLFA   FR +F+S KY+ Y+    
Sbjct: 735  FSIPILEKSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEKYMDHDI 794

Query: 644  GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
                 + RLS S NMLF KMY+NGGCSVVPTGFLK  N LRPDL+IPDDQQDTQEFLM++
Sbjct: 795  PT---NQRLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEFLMLI 851

Query: 704  LDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763
            LDRLHDELSNQ  V  DYP+L+ YD D ++V   +Y  W++++V  NG+SPID +FQGQ 
Sbjct: 852  LDRLHDELSNQHEVKLDYPDLVDYDVDDMEVQPGQYIKWYNESVKSNGLSPIDHVFQGQT 911

Query: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823
            E+ L C+RCG ++F YSTFY+LSLAIP+ S   +  G+   KRV LEDCI MFT+DE+LS
Sbjct: 912  EDGLVCQRCGCSSFTYSTFYILSLAIPKAST--NAFGK--IKRVNLEDCIKMFTNDEILS 967

Query: 824  GENAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKK-------------------SRF 864
             ENAWDCPRCG                   I + R+KK                    RF
Sbjct: 968  DENAWDCPRCG-----------SAAPKQEPIHRHREKKHIHDISPPPRSPSSPEPRSKRF 1016

Query: 865  FTLHTRSK--RRHLDFFGDSSNESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXX 922
            F L+   +  R +           + + P   +   SRS  + L    +  +  TP    
Sbjct: 1017 FLLNAPREVVRSYSPLRILPGGRHSFDKPRELKEHYSRSADENLSDDKENQNHTTPNG-- 1074

Query: 923  XXXXXXXXXXXXXKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILK 982
                         K+ T+K++NFV  P+ILVIHLSRFYYDLTKKNNTVITYPL LNI LK
Sbjct: 1075 ---RAGRVRHYSGKMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNISLK 1131

Query: 983  NNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSD 1042
            N +  +Y+L+G+VNHTGTL+SGHYTSLVNKD +H +   + KW+YFDDE+VK +K HG  
Sbjct: 1132 NGEVARYKLYGLVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHGDI 1191

Query: 1043 KS--LKISSSDAYVLFYERV 1060
            +     ISSS  YVLFY+R+
Sbjct: 1192 EGGVTSISSSHVYVLFYQRI 1211

 Score =  221 bits (564), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 147/199 (73%), Gaps = 3/199 (1%)

Query: 255 ADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTIL 314
            DRSVTHRKDSYHSVYM + D+ + +N+   D ET  +I+SLE +QKQ +IT PELF++L
Sbjct: 446 VDRSVTHRKDSYHSVYMFN-DSNEDNNNHGYD-ETSEYIESLEHIQKQDVITCPELFSLL 503

Query: 315 SNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGN 374
           SN  E EK+LLIDLR P+R   N+IVAPN+++++P LLWD  TN PVY  + LEQ++  N
Sbjct: 504 SNNVEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTAEKLEQII-NN 562

Query: 375 EHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKK 434
             F  RD F+YVV YSD+KT+M M FDY F  FYLL+T     + ++PT+LLGGYEKW K
Sbjct: 563 PLFSKRDTFKYVVYYSDMKTYMNMTFDYLFTLFYLLVTCTSKPVKSLPTSLLGGYEKWYK 622

Query: 435 TLHTYAQQYHISIDDYLYR 453
            +++Y  QY I+++DY+YR
Sbjct: 623 VINSYVNQYSITMNDYVYR 641

 Score =  128 bits (322), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/150 (42%), Positives = 98/150 (65%), Gaps = 7/150 (4%)

Query: 7   SFTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDA 66
           ++TPEYS+ELL+ V+++Y+ + K +YPQ           H+ +LFE Y  S+R    +DA
Sbjct: 9   NYTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDA 68

Query: 67  LTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLD 126
           L+AF++G +Y++ IIPQS QF T+N+ Y +Y +LK +YE+E+NMTNV+ MVK EI  +LD
Sbjct: 69  LSAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILD 128

Query: 127 -------DSVKHVVGIEHRITKKRAFSVPG 149
                  +S  ++      I ++RAFSVP 
Sbjct: 129 SNYKSQNESSNNLFVDSKFIRRERAFSVPN 158

 Score = 39.7 bits (91), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 20/24 (83%)

Query: 178 EDADQSSPVWTAPNLEPNDQLKLA 201
           ED D+SSP+WTAP L+  +QLKLA
Sbjct: 260 EDTDESSPLWTAPQLDSKNQLKLA 283

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  479 bits (1232), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 253/482 (52%), Positives = 317/482 (65%), Gaps = 54/482 (11%)

Query: 584  YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643
            + IPTIE S N YV+LSITGLRN+ NTCYINSM+QCLF+   FR LF+S+KY  YL+   
Sbjct: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE 1146

Query: 644  GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
             + +     S S  MLF KMY+NGGCSVVP+GFLK+ N L+PDL+IP  QQDTQEFL+ L
Sbjct: 1147 MDTM-----SRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFL 1201

Query: 704  LDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763
            LD+LHDELS+   V+NDY +LLL+D   L V + +Y  WFD+N+  NG+SPIDD+FQGQM
Sbjct: 1202 LDKLHDELSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQM 1261

Query: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823
            EN L C+RCGY+++ YSTFYVLSLA+P    K    G+   K+++LEDCIN FT DEVLS
Sbjct: 1262 ENQLSCQRCGYSSYTYSTFYVLSLALPNPVAK--AFGK--TKKLRLEDCINFFTCDEVLS 1317

Query: 824  GENAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSS 883
             +NAWDCPRC                            S + +   + KR+    F +S 
Sbjct: 1318 DQNAWDCPRCC-------------------------SPSDYMSYDHKGKRKISTSF-ESL 1351

Query: 884  NESTSNNPVHFERERSRSPFKMLGGGGK-RSHSNTPFAXXXXXXXXXXXXXXXKLTTVKT 942
            N   S          SRS  K+   G K RS S  P                 K  TVK+
Sbjct: 1352 NGGNS----------SRS--KLFKFGYKMRSRSEAP----KFSSKLSDKVSNGKPATVKS 1395

Query: 943  INFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLI 1002
            +NF+T+P+ILVIHLSRF YDLTKKNN V++YPLILNI+LKN++  K+RL+ +VNH GTLI
Sbjct: 1396 LNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKFRLYSIVNHFGTLI 1455

Query: 1003 SGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFYERV 1060
            SGHYTSLVNK+L H +  G+ KWYYFDDE+VK D  HG  D  +  +SSS+ YVLFYER+
Sbjct: 1456 SGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYERI 1515

Query: 1061 HD 1062
             D
Sbjct: 1516 FD 1517

 Score =  197 bits (502), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 152/488 (31%), Positives = 240/488 (49%), Gaps = 65/488 (13%)

Query: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDAL 67
           + PEYS EL + V ++Y E+++  Y +           H  YL E Y + +   +    +
Sbjct: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGI 64

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDD 127
           TA+V+G +Y++LIIPQS++F TRN SYSIY DLK+ YE++ NM NV+L+V  ++G V+  
Sbjct: 65  TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQL 124

Query: 128 SVKHVVGIEH--RIT-KKRAFSVPGIXXXXXXXX---XXXXXXGPRGHLHKTSSTEEDA- 180
            +      ++  R T +KRA+S+                      RG       TE+ A 
Sbjct: 125 YLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQGAF 184

Query: 181 -------DQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVP 233
                  +    VW+APNLEP+DQLKLA+     P+                   + D  
Sbjct: 185 GQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPS-------------------IHDTS 225

Query: 234 YTHNDNDGTSASSDQPFGEITADRSVTHRKDSYHSVYM-VDSDTFKS--------DNDDL 284
            +   + G   +S   F  +  +  V+ R+  + S  + VDS   K+        D++D+
Sbjct: 226 DSKTKDSGLENNSAAEFS-VLDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDV 284

Query: 285 LD------------VETDGFI----QSLEILQKQSIITAPELFTILSNQSESEKLLLIDL 328
           LD            +  DG +     S+  L + S I   +L + L++ SE   +LLIDL
Sbjct: 285 LDRFYTHGQDLRYPICNDGVVPCENSSIMWLYESSSIKCLDLLSKLTS-SERSSMLLIDL 343

Query: 329 RIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVC 388
           R+P+R   ++I+A N++ IDP LLWD +   PV     LE +++ N  F +R +F  +VC
Sbjct: 344 RLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVID-NHLFRSRRQFATIVC 402

Query: 389 YSDVKTFMTMNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISID 448
           Y+D  T+M ++FD+ F+ F LL      R   V   L GGYE+WK  L    +   I + 
Sbjct: 403 YTDNYTYMQIDFDFVFLLFRLLYLG---RPQLVLKTLSGGYEQWKSFLKELKRTESIILS 459

Query: 449 DYLY-RPY 455
           D+L+ RP+
Sbjct: 460 DFLWKRPH 467

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  469 bits (1206), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 254/480 (52%), Positives = 330/480 (68%), Gaps = 42/480 (8%)

Query: 584  YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643
            + +PTIE++ N Y++LSITGLRN+ NTCYINSM+QCLF+   FR LF+S+KY  YL+ S 
Sbjct: 728  FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN 787

Query: 644  GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
             + +     S S  MLF KMY+NGGCSVVP+GFLK+ + L+PDL+IP  QQDTQEFL+ L
Sbjct: 788  MDNM-----SRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLLFL 842

Query: 704  LDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763
            LDRL DELS    V NDYP LLL+++  LKV++KEY  WFD+N   NG+SPID IFQGQ+
Sbjct: 843  LDRLRDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQI 902

Query: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823
            E+ L C+RC +++++YSTFYVLSLA+P    K    G+   K+++LEDCIN FT DEVL+
Sbjct: 903  EHQLSCQRCDFSSYSYSTFYVLSLALPNPGSK--AFGK--AKKLRLEDCINFFTCDEVLT 958

Query: 824  GENAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSS 883
            G+N WDCP+CG                  N    R+  S       +SKR++  F G  +
Sbjct: 959  GQNPWDCPKCG-----------------VNSSGDRQMNSE------KSKRKNKFFMGSEN 995

Query: 884  NESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPF-AXXXXXXXXXXXXXXXKLTTVKT 942
              S ++N  H  R      FK+  G   RS S++PF +               KL T+K+
Sbjct: 996  ANSANSNRDHLPRL-----FKI--GSKSRSRSSSPFISGPKSSGKTHEKRYNKKLATIKS 1048

Query: 943  INFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLI 1002
            +NF+TLP+IL+IHLSRF YDLTKKNNTV+TYPLILNI+LKNN+  KYRL+  +NH GTLI
Sbjct: 1049 LNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLI 1108

Query: 1003 SGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFYERV 1060
            SGHYTSLVNKDL+H +  G+ KWYYFDDE+VK D  HG+ D+ +  +SSSD Y+LFYER+
Sbjct: 1109 SGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168

 Score =  127 bits (318), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 110/196 (56%), Gaps = 4/196 (2%)

Query: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDAL 67
           + PEYS+EL   V++ Y + ++  YP+               LFE Y D +R  +  + L
Sbjct: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEI-GVVLD 126
            A+VIG +Y++LIIPQS++F TRN SYS+Y+DL+K YE E NMTNVV MV +++  V+L 
Sbjct: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLR 124

Query: 127 DSVKHVVGIEHRITKKRAFSVP--GIXXXXXXXXXXXXXXGPRGHLHKT-SSTEEDADQS 183
            + +     + ++ +KRA+SVP  G+                RG  H    +  E A Q+
Sbjct: 125 QTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEVAVQA 184

Query: 184 SPVWTAPNLEPNDQLK 199
             +W+AP LE ND L+
Sbjct: 185 DTLWSAPKLEENDLLR 200

 Score =  105 bits (261), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 117/236 (49%), Gaps = 22/236 (9%)

Query: 219 TSTPVRQSVLLEDVPYT-HNDNDGTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTF 277
           T    R SVL  D+P    N  +  SA S   F +   DR    R + Y+     ++   
Sbjct: 379 TGQQSRWSVLPNDLPNAGQNKYNQESAVS---FEQQELDRPHNSRVEPYNPFANGNAAGL 435

Query: 278 KSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALN 337
           +S N              L  L + S I   +L  IL +  + +++L IDLR P+R  LN
Sbjct: 436 ESCN-------------PLTRLYETSSIKCSDLMIILESDIQ-DRVLFIDLRPPKRYELN 481

Query: 338 NIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMT 397
           +IVA +L+ IDP LLWD + + P+   +  E+ L+ N  F  R +F Y+VCY+D  T M 
Sbjct: 482 HIVARHLINIDPLLLWDTERSAPITSVNEFERRLD-NPLFTTRGQFSYLVCYTDNHTSMN 540

Query: 398 MNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDDYLYR 453
           M+F +   FF L+    K RL T    L GGY++W+  L T  +  H  I D+++R
Sbjct: 541 MDFKFELTFFELVYMG-KPRLLT--KCLQGGYDQWRLYLKTNTKSIHAKISDFMWR 593

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
            YKR098C (REAL)
          Length = 721

 Score =  437 bits (1124), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 232/480 (48%), Positives = 310/480 (64%), Gaps = 56/480 (11%)

Query: 586  IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645
            +PTIE S++    LSITGL+N  NTCYINS+IQCLF   +FR LF++ KY+ +LQ  +  
Sbjct: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346

Query: 646  RLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLD 705
            R    +LS S+ +LF KMYLNGG ++ P GFLK+  +LRPDL IPDDQQDTQEFL+I+L 
Sbjct: 347  R--EVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILA 404

Query: 706  RLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
            RLH+ELSN   V   YP+L+ YDA+  +V+  +Y+ W++ +V+ +G+SPID IF+GQMEN
Sbjct: 405  RLHEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMEN 463

Query: 766  SLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGE 825
             L+C+RCG ++ +YSTFYVLSLAIP+ S+          K++KLEDCIN+FTSDE LSG+
Sbjct: 464  ILKCQRCGNSSHSYSTFYVLSLAIPKISLYS---FTSKSKKIKLEDCINLFTSDEELSGD 520

Query: 826  NAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNE 885
            N+WDCP CG              +   N   S+KKKS FF+ H+RS+ +         + 
Sbjct: 521  NSWDCPNCG----------TTDLKTKINESTSQKKKSTFFSFHSRSRSKSPHHHHHHHHH 570

Query: 886  STSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTINF 945
            S  N   H ++  SR                                   KLTTVK+ +F
Sbjct: 571  SHDNTEKHSKKWNSR-----------------------------------KLTTVKSSDF 595

Query: 946  VTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGH 1005
            + LP ILVIHLSRFYYDLT+KNNTVITYPLILN+ILKNN  ++Y+L+G VNH G L++GH
Sbjct: 596  IVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGTVNHIGNLVNGH 655

Query: 1006 YTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSD---KSLKISSSDAYVLFYERVHD 1062
            YTS VNK+  H + + R  W  FDD+ +K  + H  D      ++SSS+ YVLFYER+ +
Sbjct: 656  YTSDVNKEKNHEIGLNRQVWITFDDDYIK--QHHHDDFEAGKTEVSSSEVYVLFYERMDE 713

 Score =  109 bits (273), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 85/135 (62%)

Query: 14  NELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDALTAFVIG 73
           ++++  VR++Y  DIK +Y Q           H  +LFE+YL      +  +ALTAF+IG
Sbjct: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65

Query: 74  CYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDDSVKHVV 133
            YY++L+IPQSLQFQTRN  YS Y+ LK  Y++E  M+ V+ +VK+E  +++D  +    
Sbjct: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125

Query: 134 GIEHRITKKRAFSVP 148
            I   IT+KRA+S+P
Sbjct: 126 RISRTITRKRAYSLP 140

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
            YKR098C (REAL)
          Length = 724

 Score =  434 bits (1115), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 233/477 (48%), Positives = 306/477 (64%), Gaps = 46/477 (9%)

Query: 584  YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643
            + +P IE S N    LSITGLRN  NTCYINSM+QCLF+  +FR LF++ KYK +L+  +
Sbjct: 278  FKLPVIENSDNLLSELSITGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLENEK 337

Query: 644  GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
              +    +LS+S+ +LF KMYLNGG +++P GFLKV  +LRPDL IPDDQQDTQEFLMI+
Sbjct: 338  YPK--GLQLSHSIYVLFKKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMII 395

Query: 704  LDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763
            L R+H+ELSN  +V   Y +L+L DA  L+V+  +Y+ W ++ V+ +G+SPID IFQGQM
Sbjct: 396  LARIHEELSNN-NVTKYYSDLILNDATALQVNPSKYQKWCEETVLSDGLSPIDHIFQGQM 454

Query: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823
            EN L+C+RCG ++++YSTFYVLSLAIP+ S+          K++KLEDCIN FTSDE LS
Sbjct: 455  ENILKCQRCGNSSYSYSTFYVLSLAIPKASL---YSFTSKSKKIKLEDCINFFTSDEELS 511

Query: 824  GENAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSS 883
             +NAWDCP+C               + D N+  S+KK+S  F LH+R             
Sbjct: 512  DDNAWDCPKC--------RTAEYKLKKDENL--SQKKRSILFNLHSRP------------ 549

Query: 884  NESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTI 943
                          RS+SP +         H N                   KLTT+K++
Sbjct: 550  --------------RSKSP-RHRHHHHHHRHKNDDAKKNDDATKNSKKWKSKKLTTIKSL 594

Query: 944  NFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLIS 1003
            +F+ LP ILVIHLSRFYYDLTKKNNTVITYPLILNIILKNN  ++Y+L+  VNH+G LI+
Sbjct: 595  DFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNKVVRYKLYATVNHSGNLIN 654

Query: 1004 GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSD---KSLKISSSDAYVLFY 1057
            GHYTS+VNK+  H + + R  W  FDD+V+K   K   D      +ISS++ YVLFY
Sbjct: 655  GHYTSVVNKEKSHEIGLNRQVWVTFDDDVIKQHHKDRDDFETGRTEISSNEVYVLFY 711

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 84/135 (62%)

Query: 14  NELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDALTAFVIG 73
           N++L  VR++Y  DIK  Y Q           H  YLF++Y+  +++ +  +ALTAF++G
Sbjct: 6   NQILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFIVG 65

Query: 74  CYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDDSVKHVV 133
            +Y++L+IP SLQFQTRN  YS Y+ LK  Y++E  M+ V+ +VK E  +++D  +    
Sbjct: 66  GFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQCLSDSK 125

Query: 134 GIEHRITKKRAFSVP 148
            I   + +KRA+S+P
Sbjct: 126 RISRSMKRKRAYSLP 140

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
            UBP11Ubiquitin-specific protease that cleaves ubiquitin
            from ubiquitinated proteins
          Length = 717

 Score =  431 bits (1108), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 224/486 (46%), Positives = 317/486 (65%), Gaps = 61/486 (12%)

Query: 583  VYHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQS 642
             Y++P IE S++    LSITGL+N  NTCYINS+IQCLF   +FR LF++ KY+ +L  +
Sbjct: 279  AYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTN 338

Query: 643  RGNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMI 702
            +  +    +LS S+ +LF KMYLNGG +++P  FLK+  +LRPDL IPDDQQDTQEFL+I
Sbjct: 339  KYPK--EVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLI 396

Query: 703  LLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQ 762
            +L R+H+ELSN+ +V   YP+L+ YDA+ L+V+  +Y+ W+++NVI +G+SPID I++GQ
Sbjct: 397  VLARIHEELSNE-NVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQ 455

Query: 763  MENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVL 822
            +EN L+C+RCG ++++YSTFYVLSLAIP+ S+          +++KLEDCIN+FT DE L
Sbjct: 456  LENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFT---SKSRKIKLEDCINLFTGDEEL 512

Query: 823  SGENAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRH---LDFF 879
            SG+NAWDCP C               ++    + S+KKKS  F  H+RS+ +        
Sbjct: 513  SGDNAWDCPNC----------RITDSKSKKEEITSQKKKSTIFGFHSRSRSKSPHHHHHH 562

Query: 880  GDSSNESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTT 939
              SS++ST N                     K+ +S                    KLTT
Sbjct: 563  HHSSDDSTKN--------------------AKKRNSK-------------------KLTT 583

Query: 940  VKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTG 999
            +K+++F+ LP ILVIHLSRFYYDLTKKN+TVITYPLILNIILKN   ++Y+L+G VNH+G
Sbjct: 584  IKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSG 643

Query: 1000 TLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV---KADKKHGSDKSLKISSSDAYVLF 1056
             LI+GHYTS+VNK+  H + + R  W  FDD+ +   + D+ +      ++SS + YVLF
Sbjct: 644  NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLF 703

Query: 1057 YERVHD 1062
            YER+ +
Sbjct: 704  YERMDE 709

 Score =  113 bits (282), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 58/135 (42%), Positives = 83/135 (61%)

Query: 14  NELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDALTAFVIG 73
           +++L  VR +Y  DIK +Y Q           H  +LF +YL  +   +  +ALTAF+IG
Sbjct: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65

Query: 74  CYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDDSVKHVV 133
           CYY++LIIPQSLQFQTRN  YS Y+ LK  Y++E  M  V+ +V+ E  V++D  +    
Sbjct: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125

Query: 134 GIEHRITKKRAFSVP 148
           GI   I +KRA+S+P
Sbjct: 126 GICRTIKRKRAYSLP 140

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
            YKR098C (REAL)
          Length = 712

 Score =  424 bits (1091), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 225/479 (46%), Positives = 303/479 (63%), Gaps = 54/479 (11%)

Query: 587  PTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNR 646
            PTIE S      LSITGL+N  NTCYINS+IQCLF +  FR LF++ KY+ +L+     +
Sbjct: 277  PTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEEYPK 336

Query: 647  LHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDR 706
                +LS S+  LF KMY NGG ++VP GFLK+  +LRPDL IPDDQQDTQEFL+I+L R
Sbjct: 337  --EVQLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILAR 394

Query: 707  LHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENS 766
            +H+ELSN+ +V   Y +L+ YD + L+V+  +Y+ W+++ ++ +G+SPID IF+GQMEN 
Sbjct: 395  IHEELSNE-NVTKYYCDLVSYDTNALQVNPIKYQKWYEETILADGLSPIDHIFRGQMENI 453

Query: 767  LQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGEN 826
            L+C+RCG ++F+YSTFYVLSLAIP+ S+          K++KLEDCIN+FTSDE L+G+N
Sbjct: 454  LKCQRCGNSSFSYSTFYVLSLAIPKNSV---HSFTSKSKKIKLEDCINLFTSDEELTGDN 510

Query: 827  AWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNES 886
            AWDCP C               EN      S+KK+S  F+ H+RS               
Sbjct: 511  AWDCPEC-----RIDDSKLKTGEN-----SSQKKRSPLFSFHSRS--------------- 545

Query: 887  TSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTINFV 946
                       RS+SP          S + T                  +LTT+K+++F+
Sbjct: 546  -----------RSKSPHHHHHYHHHGSDNTT---------KNSNKWKSKRLTTIKSLDFI 585

Query: 947  TLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHY 1006
             LP ILVIHLSRFYYDLTKKNN VITYPLILNIILKNN  ++Y+L+G VNH+G LI+GHY
Sbjct: 586  FLPPILVIHLSRFYYDLTKKNNAVITYPLILNIILKNNKVVRYKLYGTVNHSGNLITGHY 645

Query: 1007 TSLVNKDLEHNVDIGRSKWYYFDDEVV---KADKKHGSDKSLKISSSDAYVLFYERVHD 1062
            TS+VNK+  H + + +  W  FDD+ +     D+        K+SSS+ YVLFYER+ +
Sbjct: 646  TSVVNKERSHEIGLNKQVWVTFDDDFIIQHHKDRDGFEAGKTKMSSSEVYVLFYERMDE 704

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/135 (42%), Positives = 85/135 (62%)

Query: 14  NELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDALTAFVIG 73
           +++L  VRD+Y  DIK +Y Q           HT +LF++YL  +   R  +ALTAF+IG
Sbjct: 6   DQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALTAFIIG 65

Query: 74  CYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDDSVKHVV 133
            YY++LIIPQSLQFQTR+  YS Y+ LK  Y++E  M+ V+ +V+ E   ++D  +    
Sbjct: 66  GYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQYLSDSN 125

Query: 134 GIEHRITKKRAFSVP 148
            I   IT+KRA+S+P
Sbjct: 126 RITVTITRKRAYSLP 140

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
            YIL156W
          Length = 846

 Score =  401 bits (1031), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 224/482 (46%), Positives = 300/482 (62%), Gaps = 70/482 (14%)

Query: 584  YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643
            Y +P +  SSN YV LSI+GLRNLGNTCYINSM+QCLFA   FR LF+S++YK Y+    
Sbjct: 428  YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI---- 483

Query: 644  GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
            G ++  P LSNS ++LF KMYLNGGC+V+P  FLK  N LRPDL+IPD QQDTQEFL++L
Sbjct: 484  GTKV-DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILL 542

Query: 704  LDRLHDEL-SNQPHVANDYPNLLLYDADGLKVSNK-EYKHWFDKNVIGNGISPIDDIFQG 761
            LD+LH+EL SNQ  + +++P+L+ YD D + V N  EYK WF +++   G+S I +IFQG
Sbjct: 543  LDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQG 602

Query: 762  QMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEV 821
            Q+ENSL+C+RC YT+ NYS F  LSL+IP +  K  KL       V LEDCI++F  +E+
Sbjct: 603  QLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKL-------VDLEDCISLFIENEM 655

Query: 822  LSGENAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGD 881
            L+GENAW+CP+C                       + K+KSR              FF  
Sbjct: 656  LTGENAWNCPKCSSSSN----------------NNTSKRKSR-------------GFFKF 686

Query: 882  SSNESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVK 941
            S +++ S+N + F      S           S  +  F+               KL T K
Sbjct: 687  SKHKNRSHNDLTFSEYNHNS-----------SSDDVKFS-------------KKKLVTRK 722

Query: 942  TINFVTLPKILVIHLSRFYYD-LTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGT 1000
            + +F+ LP +L+IHLSRF    L  KNNT I YP IL I LKN +  +++L+GVVNH G 
Sbjct: 723  STSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFGN 782

Query: 1001 LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFYE 1058
            L +GHYTSL+NK+  H+++  R KW+YFDDE VK    +   DK++ +ISSSD YVLFYE
Sbjct: 783  LNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYE 842

Query: 1059 RV 1060
            ++
Sbjct: 843  KI 844

 Score =  160 bits (404), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 133/445 (29%), Positives = 203/445 (45%), Gaps = 106/445 (23%)

Query: 13  SNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDALTAFVI 72
           S+EL + V  +Y+  IK  Y Q           +TE LFE +L         D+L +F+I
Sbjct: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKG-----NTDSLDSFII 67

Query: 73  GCYYVFLIIPQS-LQFQTRNKSY-SIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDDSVK 130
           G +Y+ L+IP S    ++ N  Y +IY DLKK YE++ N+++++ +++ E   +L     
Sbjct: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENIL----- 122

Query: 131 HVVGIEHRITKKRAFSVPGIXXXXXXXXXXXXXXGPRGHLHKTSSTEED--ADQSSPVWT 188
                       ++F V                  P  H    S  EED  AD S+ +W 
Sbjct: 123 ------------QSFDVDA----------------PSSH----SQHEEDNTADSSTTIWQ 150

Query: 189 APNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVPYTHNDNDGTSASSDQ 248
           AP LEPNDQLKLA++       +  E   +      +S       YT+  ND T      
Sbjct: 151 APFLEPNDQLKLAIISSESELESETEVEAEIDINANES------KYTNFINDKT------ 198

Query: 249 PFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAP 308
                                 + D DT+                  L+ L ++  IT  
Sbjct: 199 ----------------------INDEDTY------------------LKHLYEECFITPH 218

Query: 309 ELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILE 368
           ELF+ILSN S+  K+L+IDLR+ +   L  I +PNL+K DP  LW+ +   PV       
Sbjct: 219 ELFSILSNPSDRLKILIIDLRLSRYFNLQTIRSPNLIKFDPIELWNNRDQTPVLH----R 274

Query: 369 QLLEGNEHFINRDKFQYVVCYSDVKTFMTM-NFDYSFIFFYLLLTSQKTRLATVPTALLG 427
             L  N  F   D F Y++ YSD +T     +F+Y+F FF LL++S    +   P  LLG
Sbjct: 275 TSLFSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNFSFFKLLMSSS---MKVTPNFLLG 331

Query: 428 GYEKWKKTLHTYAQQYHISIDDYLY 452
           G+EKW++ + +Y++QY I   +Y++
Sbjct: 332 GFEKWEQLISSYSEQYGIETSNYIF 356

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
            YIL156W possible pseudogene; NNN added to avoid internal
            stop codon
          Length = 656

 Score =  385 bits (988), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 221/489 (45%), Positives = 286/489 (58%), Gaps = 67/489 (13%)

Query: 586  IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSK-YKSYLQQSRG 644
            +P I+ + N    LS+ GLRN GNTCYINSM+QCLF  KV R LFIS   YK ++++   
Sbjct: 222  VPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAE 281

Query: 645  NRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILL 704
             ++  P        L   MY NGG SV+P  FL+  + LRPDL IP DQQDTQEFL+ILL
Sbjct: 282  TKISEP-----FARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILL 336

Query: 705  DRLHDELS-NQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763
            D LHDEL      ++N+Y       +D + +  KEY  W   N+  NG SPID IFQGQ+
Sbjct: 337  DILHDELVYTDDLISNNYV------SDDINLG-KEYMPWLQNNLKANGKSPIDLIFQGQI 389

Query: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEK-RVKLEDCINMFTSDEVL 822
            EN LQC+RCG T++NYS FY+LSLAIP       K+ + N K RVKLEDCIN FTSDE+L
Sbjct: 390  ENCLQCQRCGNTSYNYSMFYMLSLAIP-------KIAKENSKNRVKLEDCINFFTSDEIL 442

Query: 823  SGENAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDS 882
            +GENAW+CP+C P                   +++  +     T+  R K + +      
Sbjct: 443  TGENAWNCPKCCPTT-----------------IETYDEADSPATVENRVKNKSI------ 479

Query: 883  SNESTSNNPVHFER-ERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVK 941
                   NP++F +  +  SP       G     +                   KL T+K
Sbjct: 480  -------NPLNFFKLHKVLSP-----SSGNHHRHHHHHHHHKSDGKNKNKYKNEKLITLK 527

Query: 942  TINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNN-DTMKYRLFGVVNHTGT 1000
             +NF+ LP ILVIHLSRFYY+ TKKNN VITYPLILNII+KNN D +KY+L+G++NH G 
Sbjct: 528  QLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGG 587

Query: 1001 LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVK---ADKKHGSDKSLKIS-----SSDA 1052
            L  GHYTS+VNKDL H++D+   +WY FDDEV+K   ++      +S  I      SS  
Sbjct: 588  LTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKV 647

Query: 1053 YVLFYERVH 1061
            YVLFYER+ 
Sbjct: 648  YVLFYERIE 656

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 76/132 (57%), Gaps = 4/132 (3%)

Query: 20  VRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHE-RPNDALTAFVIGCYYVF 78
           V  ++  DIK YY +           HT YL +L+     H+ R   A  AFV G +Y+F
Sbjct: 34  VDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQATLAFVNGSFYLF 93

Query: 79  LIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDDSVKHVVGIEHR 138
           LIIP  +QFQT+NK ++ Y DLK  YE +++M N++  VK++   +L+   + + GI  R
Sbjct: 94  LIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILE---QDLSGINRR 150

Query: 139 ITKKRAFSVPGI 150
           I KKRA++ P I
Sbjct: 151 ILKKRAYTEPSI 162

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score =  364 bits (935), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 208/488 (42%), Positives = 287/488 (58%), Gaps = 43/488 (8%)

Query: 1   MHPHTTSFTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRH 60
           M  +TT FTPEYS+ELLR V D+Y +DIK +Y             HT YL+E + D M++
Sbjct: 1   MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKN 60

Query: 61  ERPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKE 120
               DALTA++IGCY+++LIIPQS QFQ RNK++ +++ LKK+YEN++NMTNV+LMVK E
Sbjct: 61  RNKQDALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE 120

Query: 121 IGVVLDDSVKHVVGIEHRITKKRAFSVPGIXXXXXXXXXXXXXXG---PRGH-----LHK 172
           +  VLD   + +  +E    +KRAFS P                G   P+ H     +  
Sbjct: 121 VDSVLDRDFRKLKDVE----RKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRS 176

Query: 173 TSSTEEDADQSSPVWTAPNLEPNDQLKLAL----------------LPEVIPTP-AFPES 215
            S+       + P+W APNLEPNDQLKLAL                 PE+  +P  +P+ 
Sbjct: 177 DSNFHSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPKH 236

Query: 216 GRKTSTPVRQSVLLEDVPYTHNDNDGTSASS--------DQPFGEITADRSVTHRKDSYH 267
             K+   V +    E     H  + G    +        +Q F +   DR+V HRKDSYH
Sbjct: 237 KSKSELTVEEK---EHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYH 293

Query: 268 SVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLID 327
           SVYM D D    +N      E++  +Q+++ LQKQSIIT+PELF+ILSN+ E  +LLLID
Sbjct: 294 SVYMDDGDHDFGENKGATFPESE--VQAMKRLQKQSIITSPELFSILSNKKERNRLLLID 351

Query: 328 LRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVV 387
           LR+  R   N I+APN+V IDP +LWD  T  PV    +L++ L+ N  F  R  F ++V
Sbjct: 352 LRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLK-NSIFNKRGSFDFIV 410

Query: 388 CYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISI 447
            Y+D+KT+M M+FDY F+F+ L++ SQ+  L ++P+ LLGGYEKWK  L  Y  Q+ I +
Sbjct: 411 YYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRV 470

Query: 448 DDYLYRPY 455
           DDYLYRPY
Sbjct: 471 DDYLYRPY 478

 Score =  316 bits (809), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 153/251 (60%), Positives = 188/251 (74%), Gaps = 5/251 (1%)

Query: 584 YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643
           + +PTIE+S+N YV+LSITGLRNLG TCYINSM+QCLFA  +FR LF  S Y+ +     
Sbjct: 581 FSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPEL 640

Query: 644 GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
            +   + +LS S ++L  KMY+NGGCSVVPT FLK+ N LRPD  IPDDQQD QEFLM+ 
Sbjct: 641 ED---TGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLT 697

Query: 704 LDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763
           +DRLHDELSNQ  V N +P LLLYDA+  KV  +EYK WF+ ++I    SPID IFQGQ+
Sbjct: 698 IDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQL 757

Query: 764 ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823
           EN L CK+CGY++++YSTFY+LSLAIP+ S       + N   V LEDCINMFTSDEV+S
Sbjct: 758 ENGLHCKKCGYSSYSYSTFYILSLAIPKPSSSFLSSSKGN--WVNLEDCINMFTSDEVMS 815

Query: 824 GENAWDCPRCG 834
            ENAWDCP+CG
Sbjct: 816 RENAWDCPKCG 826

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  327 bits (838), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 197/470 (41%), Positives = 274/470 (58%), Gaps = 36/470 (7%)

Query: 5   TTSFTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPN 64
           +++FTPEYS EL  RV+D+Y  DIK   PQ           HT YL E +   +   R +
Sbjct: 8   SSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYD 67

Query: 65  DALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVV 124
           DAL+A+++GCYY++LIIPQS QFQT+NKSYS+Y+D K +Y+NE NMTNV  MV+ E+  +
Sbjct: 68  DALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSI 127

Query: 125 LDDSVKHVVGIEHRITKKRAFSVP-------GIXXXXXXXXXXXXXXGPRGHLHKTSSTE 177
           LD S +     +  I + RAFSV                         P        S  
Sbjct: 128 LDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSLP 187

Query: 178 EDADQSSPVWTAPNLEPNDQLKLAL-LPEVIPTPAFPESGRKTSTPVRQSVLLED----- 231
            + D S+P+WTAP+L PNDQLKLAL  PE+       +          Q  L++D     
Sbjct: 188 MELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKT--------QHNLIDDKYNNF 239

Query: 232 -VPYTHN---DNDGTSASSDQPFGEI-TADRSVTHRKDSYHSVYMVDSDT--FKSDNDDL 284
            +P  H        T  + D+   +I   DRS THRKDSYHSVYM + ++  +   ND  
Sbjct: 240 TIPLPHQIPLPVKVTDFNHDKKIQKIYPVDRSETHRKDSYHSVYMDNDNSAGYVRKND-- 297

Query: 285 LDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNL 344
              E + +IQ+LE LQKQ++IT PELF+ILS+ +  + +LLI L +P+R+  N IVA N 
Sbjct: 298 ---EANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNT 354

Query: 345 VKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFIN-RDKFQYVVCYSDVKTFMTMNFDYS 403
           + IDPN+LWD + N P+ +D  LE++L  N+   N R  F YVV Y+D+KT+M +NFDY+
Sbjct: 355 INIDPNVLWDFENNCPISEDTKLEKIL--NDQLFNIRKSFAYVVYYTDLKTYMKINFDYN 412

Query: 404 FIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDDYLYR 453
           F  FYLL +S+ + L T PT+LLGG EKWKK + TY  +  I+  +YL++
Sbjct: 413 FTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHK 462

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
            weakly similar to uniprot|P36026 Saccharomyces cerevisiae
            YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  318 bits (816), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 172/479 (35%), Positives = 263/479 (54%), Gaps = 44/479 (9%)

Query: 584  YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643
            Y +P I  +      LS+ G+RN+GNTCY+NSM+QCLF +  FR LF++ K++ +  ++ 
Sbjct: 195  YTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFLTDKFEMFKAETN 254

Query: 644  GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
               L    ++N L++LF KMY NGGC+++P  F++   +LRPD KIP  QQDTQEFLM +
Sbjct: 255  SESLS---IANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFLMFV 311

Query: 704  LDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763
            L+RL  EL+N      D   +     +     NK Y  W+++ +  N +SPID +F+G +
Sbjct: 312  LERLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNLSPIDLLFRGDV 371

Query: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823
            E+ L CK C  +   +S+FY+LSL IP+    L        K ++LEDCIN+FT  E+L+
Sbjct: 372  ESKLICKHCNESASTFSSFYILSLNIPKEKSSLF----FKSKTIRLEDCINLFTRKEILT 427

Query: 824  GENAWDCPRCGPXXXXXXXXXXXXXENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSS 883
            GEN+W CP C               +     +    K  RFF+ H  + +   +   +  
Sbjct: 428  GENSWACPSCETKARYNVIDNDKTYQQKHTNIGKHSKFPRFFS-HIEAGKTERNSGANKF 486

Query: 884  NESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFAXXXXXXXXXXXXXXXKLTTVKTI 943
            ++   +N  + +R R +                                   K  T+ ++
Sbjct: 487  SQLKYDNLENEQRHRQQK----------------------------------KSETILSV 512

Query: 944  NFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLIS 1003
            +FV+LP ILVIHLSRF YD++KKN + I+YP+ L +   +N ++ YRL+G +NH G+   
Sbjct: 513  SFVSLPPILVIHLSRFCYDISKKNTSNISYPMSLTVETLDNSSVTYRLYGTINHIGSPRG 572

Query: 1004 GHYTSLVNKDLEHNVDIGRSKWYYFDDEVV--KADKKHGSDKSLKISSSDAYVLFYERV 1060
            GHYT+LVNK+  H  D+   KW  FDD++V  + D      +   I+++DAYVLFYER+
Sbjct: 573  GHYTALVNKEKNHFTDLELQKWVEFDDDLVFNRTDFFKSKTEINSITNNDAYVLFYERI 631

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 70  FVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMY 104
           +  GC+Y++L++P + QFQ  +  Y  Y  LK  Y
Sbjct: 67  YAAGCFYIYLLVPNANQFQLEDTEYGTYLQLKNNY 101

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  323 bits (829), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 197/489 (40%), Positives = 265/489 (54%), Gaps = 54/489 (11%)

Query: 7   SFTPEYSNELLRRVRDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMRHERPNDA 66
           S+TPEYSNELL+ V+D+Y +DIKHYYP+           H EYLFE Y   ++     DA
Sbjct: 4   SYTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQEDA 63

Query: 67  LTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLD 126
           LTAF+IG +YV+LIIPQS+QF TRNKSY IY DL+K Y++E +MTNV+LMV K++  +L 
Sbjct: 64  LTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAIL- 122

Query: 127 DSVKHVVGIEHRITKKRAFSVPGIXXXXXXXXXXXXXXGPRGHLHKTSSTEED----ADQ 182
              K     + +IT+KRA+SVP                     L + S   +     AD 
Sbjct: 123 --CKSRDFDDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADD 180

Query: 183 SSPVWTAPNLEPNDQLKLALLP---------------------------------EVIPT 209
            + +W+AP LEP+DQLKLAL P                                 E IPT
Sbjct: 181 YTTIWSAPKLEPDDQLKLALNPPSKSSSATSSLSSFVMDQHSKKFSIGESSSDEFEPIPT 240

Query: 210 PAFPESGRKTSTPVRQSVLLEDVPYTHNDNDGTSASSDQPFGEI---TADRSVTHRKDSY 266
                    T + + Q      +  + ND   +   S +    I     DR  THRKDSY
Sbjct: 241 QEALPMDHATPSEISQRTRHHSI-VSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSY 299

Query: 267 HSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLI 326
           HSVYM++ D   ++ D         F Q+L  LQKQ +I+  EL  IL +  E   +LL+
Sbjct: 300 HSVYMLNEDDDTNEYD---------FFQNLSRLQKQYVISCEELMDILQS-DERNNVLLV 349

Query: 327 DLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYV 386
           DLRI +R   N+IVAPNL+ IDP  LWD     P+  D  LE+ +   + F +R KF+Y+
Sbjct: 350 DLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYI 409

Query: 387 VCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHIS 446
           V Y+D+KTF+ ++FDY  +FF LL  S  TRL + P ALLG YE+WK  +  YA+ + I 
Sbjct: 410 VYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIV 469

Query: 447 IDDYLYRPY 455
             DYL+RPY
Sbjct: 470 TGDYLFRPY 478

 Score =  195 bits (496), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 2/129 (1%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVV 995
            KLTT+KT NF+T+P ILVIHLSRF+YDLTKKN+TVITYPLILNI+LKNN+  KYRL+G+V
Sbjct: 909  KLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIV 968

Query: 996  NHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAY 1053
            NH G LISGHYTSLVNKDL+H +  G+ KWYYFDDEVVK D  HG  D  +  +SSSD Y
Sbjct: 969  NHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVY 1028

Query: 1054 VLFYERVHD 1062
            VLFYER++D
Sbjct: 1029 VLFYERIYD 1037

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score =  111 bits (277), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 86/269 (31%), Positives = 126/269 (46%), Gaps = 45/269 (16%)

Query: 588 TIEQSSNAYV-SLSI---TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643
           TI QSSN Y   L +    GL N+GN+CY+N +IQCL        +F+++ Y+ ++  + 
Sbjct: 717 TISQSSNGYTPDLDLDFKVGLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHI--NI 774

Query: 644 GNRLHSPR-LSNSLNMLFDKMYLNGGCS-----------VVPTGFLKVVNQLRPDLKIPD 691
            ++L S   L+ S   L   MY NG  S           V P  F      +    K   
Sbjct: 775 NSKLGSKGILAKSFARLVHSMYQNGTLSIKNHSNKKNPPVQPITFKTACGSINSLFK-GS 833

Query: 692 DQQDTQEFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLK-------VSNKEYKHWFD 744
           +QQD QEF   LLD LH++L NQ   AN     L  +A+ ++        S+ E++ +  
Sbjct: 834 NQQDCQEFCQFLLDGLHEDL-NQCG-ANPPLKELSTEAERMREKLSLRIASSIEWERF-- 889

Query: 745 KNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNE 804
              +    S I D++QGQ  + L+C+ CG T+  Y TF VLS+ +P+             
Sbjct: 890 ---LTTDFSVIIDLYQGQYASQLKCQVCGTTSTTYQTFSVLSVPVPKN------------ 934

Query: 805 KRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           K + L DC N FT  E L  +  W C  C
Sbjct: 935 KSIHLLDCFNEFTKTEFLGKDELWSCTEC 963

 Score = 72.4 bits (176), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 70/142 (49%), Gaps = 34/142 (23%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND--------- 985
            K  + KT+    LPK L+IHL RF  ++  KNN  + YPLIL++     ND         
Sbjct: 966  KQPSTKTLTITRLPKNLIIHLKRFD-NMLHKNNVFVKYPLILDLTNYWANDFDGKLPPGV 1024

Query: 986  -----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVK 1034
                         KY L GV  H G+L  GHYT+ VNK L       ++ WYYFDD V +
Sbjct: 1025 TEELPARGQIPPFKYELSGVALHMGSLYGGHYTAYVNKGL-------KNGWYYFDDTVYR 1077

Query: 1035 ADKKHGSDKSLKISSSDAYVLF 1056
            + K      S ++ + +AYVLF
Sbjct: 1078 SIK-----YSSEMITQNAYVLF 1094

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 303 SIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVY 362
           S IT+  L TIL  Q++ +  LLID+R      LN+I + +++ I+P    +  ++  + 
Sbjct: 178 SHITSSVLATIL--QTDPDSTLLIDVRTRHDFELNHIKSNSIICIEPISFKNNYSDVDIE 235

Query: 363 QDDILEQLLEGNEHFINRDKFQYVVCYSD 391
           +  ++       E F NR+ +++++ Y+D
Sbjct: 236 RKSLITSPNSEIEIFKNRENYKFIILYTD 264

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score =  108 bits (269), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 118/251 (47%), Gaps = 40/251 (15%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR-LSNSLNML 659
           + GL N+GN+CY+N +IQCL        +F+ + ++ Y+  +  ++L S   L+   + L
Sbjct: 619 MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYV--NLNSKLGSKGVLARYFSRL 676

Query: 660 FDKMYLN------GG--CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 711
              MY N      GG    V P  F      +    K    QQD QEF   LLD LH++L
Sbjct: 677 IHTMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK-GGSQQDCQEFCQFLLDGLHEDL 735

Query: 712 SNQPHVANDYPNLLLYDADGLK-------VSNKEYKHWF--DKNVIGNGISPIDDIFQGQ 762
            NQ    N     L  +A+ L+        S+ E++ +   D +VIG       D+FQGQ
Sbjct: 736 -NQCG-GNKRLAELTEEAENLREKLSLRIASSIEWERFLTTDFSVIG-------DLFQGQ 786

Query: 763 MENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVL 822
             + LQCK CG T+  Y  F VLS+ +P + +           +  + DC + FT  E L
Sbjct: 787 YASRLQCKTCGKTSTTYQPFSVLSIPVPSKHI----------SKCSIIDCFDEFTKVENL 836

Query: 823 SGENAWDCPRC 833
             +  W CPRC
Sbjct: 837 EVDEQWSCPRC 847

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 71/146 (48%), Gaps = 33/146 (22%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND--------- 985
            K  + K +    LP+ L+IHL RF   L K NN ++ YP  L++     ND         
Sbjct: 850  KQPSTKKLTITRLPRNLIIHLKRFDNRLNK-NNILVQYPFTLDLTTFWANDFDGKLPLNV 908

Query: 986  ----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKA 1035
                         Y+L+GV  H G+L  GHYT+ V+K +++        WYYFDD   + 
Sbjct: 909  SELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDKGIKNG-------WYYFDDTSCRP 961

Query: 1036 DKKHGSDKSLKISSSDAYVLFYERVH 1061
             K      S++  +S AYVLFY+R++
Sbjct: 962  IK-----NSMEPITSSAYVLFYKRIY 982

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score =  107 bits (268), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 124/254 (48%), Gaps = 39/254 (15%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR-LSNSLNML 659
           I GL N+GN+CY+N +IQC+        +F+++ Y+ ++  S  +RL S   L+ +   L
Sbjct: 604 IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHINLS--SRLGSKGVLAKNFARL 661

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRP-----------DLKIPDDQQDTQEFLMILLDRLH 708
              MY++   S +     K +  ++P            L     QQD+QEF   LLD LH
Sbjct: 662 IHTMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFRDSQQQDSQEFCQFLLDGLH 721

Query: 709 DELSNQPHVANDYPNL--LLYDADGLK-------VSNKEYKHWFDKNVIGNGISPIDDIF 759
           ++L NQ       P L  L  +A+ L+        S+ E++ +   +      S I D+F
Sbjct: 722 EDL-NQ---CGGNPPLKELSLEAERLRENLSLRIASSIEWERYLTTD-----FSVIVDLF 772

Query: 760 QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSD 819
           QGQ  + L+CK C +T+  Y +F VLS+ +P++         P  +++ L DC N FT  
Sbjct: 773 QGQYASRLECKVCHHTSTTYQSFSVLSVPLPKK-------FDPQTRKIDLIDCFNEFTKI 825

Query: 820 EVLSGENAWDCPRC 833
           E L  +  W CP C
Sbjct: 826 ENLEVDEQWSCPTC 839

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 73/147 (49%), Gaps = 34/147 (23%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII--------------- 980
            K  + K +    LP+ L+IHL RF  ++  KNN+ I YP  L++                
Sbjct: 842  KQPSTKKLTITRLPRNLIIHLKRFD-NMLNKNNSFIDYPFNLDLTEFWADDFDGNLPPGV 900

Query: 981  ---LKNNDTMK---YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVK 1034
               L     +K   YRL+GV  H G+L  GHYT+ V+K + +        WYYFDD   +
Sbjct: 901  SNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGNG-------WYYFDDTTYR 953

Query: 1035 ADKKHGSDKSLKISSSDAYVLFYERVH 1061
              K   +DK   ISSS AYVLFY RV+
Sbjct: 954  PLK---NDKE-PISSS-AYVLFYTRVY 975

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 53/103 (51%), Gaps = 2/103 (1%)

Query: 290 DGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDP 349
           +  I++L +    S I+  +L  ++ N ++S  LL+ID+R       ++I + N++ I+P
Sbjct: 171 NDIIKNLHLPSNGSFISTIQLNELMRNFNDS--LLIIDIRSRSEFIKSHIKSKNIICIEP 228

Query: 350 NLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDV 392
               D  ++  + +  I+         F NR  F+++V Y+++
Sbjct: 229 ISFKDSYSDYELERKSIITSPNNEIRLFNNRQSFKFIVLYTEI 271

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score =  107 bits (268), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 117/246 (47%), Gaps = 36/246 (14%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSY--LQQSRGNRLHSPRLSNSLNMLF 660
           GL N+GN+CY+N +IQCL ++  F  +F+++ Y+ +  L+   G++     L+ +   L 
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSK---GVLARNFARLI 665

Query: 661 DKMYLNGG--------CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 712
           + MY  G           V P  F      +    +  D QQD+QEF   LLD LH++L+
Sbjct: 666 NTMYTEGSEQSKNDRNGPVKPAQFKLACGSINSIFR-SDLQQDSQEFCQFLLDGLHEDLN 724

Query: 713 N---QPHVANDYPNL-LLYDADGLKVSNK-EYKHWFDKNVIGNGISPIDDIFQGQMENSL 767
                P +    PN   + +   L++++  E++ +   +      S I D FQGQ  + L
Sbjct: 725 QCGANPPLKELSPNAEKMREKLSLRIASSIEWERYLTTD-----FSVIVDQFQGQYASQL 779

Query: 768 QCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENA 827
           +CK CG T+  Y  F VLS+ +PR             K   + DC N FT  E L  +  
Sbjct: 780 RCKVCGGTSTTYQAFSVLSVPVPRG------------KSCNIIDCFNEFTKVENLETDEL 827

Query: 828 WDCPRC 833
           W CP C
Sbjct: 828 WACPHC 833

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 68/147 (46%), Gaps = 35/147 (23%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND--------- 985
            K  + K +    LP+ L+IHL RF  ++  KNN  + YP +L++     ND         
Sbjct: 836  KQPSTKKLTITRLPRNLIIHLKRF-DNMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPGV 894

Query: 986  -----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVK 1034
                          Y+L  V  H G+L  GHYTS V+K        G+  W YFDD  ++
Sbjct: 895  TEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDK--------GKFGWRYFDDTKIR 946

Query: 1035 ADKKHGSDKSLKISSSDAYVLFYERVH 1061
              K      S +  +S+AYVLFY RV+
Sbjct: 947  PLK-----NSYECITSNAYVLFYHRVY 968

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score =  107 bits (266), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 117/250 (46%), Gaps = 42/250 (16%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRL-SNSLNMLFD 661
           GL N GN+CY++ +IQCL   +   T+F+++ Y++++  +  +RL S  L +   + L  
Sbjct: 489 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHI--NLNSRLGSKGLLARYFSQLIH 546

Query: 662 KMYLNGG----------CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 711
           +MY  G            +V+PT F      +    K  + QQD QEF   LLD LH++L
Sbjct: 547 QMYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-DNTQQDCQEFCQFLLDGLHEDL 605

Query: 712 SNQPHVANDYP-NLLLYDADGLK-------VSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763
           +      N+ P   L  +A+ ++        S  E++ +   +      S I D+FQGQ 
Sbjct: 606 N---QCGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTD-----FSVIVDLFQGQY 657

Query: 764 ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823
            + LQCK C  T+  Y  F VLS+ +            P+ +   L DC   FT  E L 
Sbjct: 658 ASQLQCKVCQRTSTTYQPFSVLSVPV------------PSTRTCTLTDCFTEFTKIETLE 705

Query: 824 GENAWDCPRC 833
            E  W CP C
Sbjct: 706 QEEQWSCPSC 715

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 28/112 (25%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII----------LKNNDT-- 986
            + K I    LP+ L+IHL RF  ++  KNN  ++YP +L++           + NN+   
Sbjct: 721  STKKITITRLPRNLIIHLKRFD-NMLNKNNVFVSYPSVLDLTAFWANDYDKKVTNNNVEL 779

Query: 987  --------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDD 1030
                      Y+L+G+  H GTL +GHYT+ VNK       +G   W Y+DD
Sbjct: 780  PSRGQVPPFNYQLYGIACHDGTLRAGHYTAYVNK----GAVLG---WCYYDD 824

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score =  104 bits (259), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 79/268 (29%), Positives = 122/268 (45%), Gaps = 46/268 (17%)

Query: 588 TIEQSSNAYVSLSIT-GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNR 646
           ++ +S +  ++L    GL NLGN+CY+N +IQCL        +F+++ Y+ ++  +  +R
Sbjct: 417 SVAKSGHPSINLDFAIGLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHV--NVNSR 474

Query: 647 LHSPRL-SNSLNMLFDKMYLNG-----------GCSVVPTGFLKVVNQLRPDLKIPDDQQ 694
           L S  L +N  + L  KMY  G             +V PT F      +    K    QQ
Sbjct: 475 LGSKGLLANYFSQLVQKMYQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLFK-GKQQQ 533

Query: 695 DTQEFLMILLDRLHDELSNQPHVANDYPNL--LLYDADGLK-------VSNKEYKHWFDK 745
           D QEF   LLD LH++L+         P L  L  +A+ ++        S  E++ +   
Sbjct: 534 DCQEFCQFLLDGLHEDLNQ----CGTNPPLKELSPEAEKMRETMPMRIASAIEWERYLTT 589

Query: 746 NVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEK 805
           +      S I D+FQGQ  + L+CK C +T+  Y  F VLS+ +PR             +
Sbjct: 590 D-----FSVIVDLFQGQYASQLRCKICAHTSTTYQAFSVLSVPVPR------------AR 632

Query: 806 RVKLEDCINMFTSDEVLSGENAWDCPRC 833
              + DC   FT  E L  +  W CP C
Sbjct: 633 SCTIYDCFKEFTKLETLEKDELWYCPYC 660

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 68/144 (47%), Gaps = 35/144 (24%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNI-----------ILKNNDT- 986
            + K I    LP  L+IHL RF  ++  KNN  + YP  L++           + K+N   
Sbjct: 666  STKQIIITRLPNNLIIHLKRFD-NMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKDNGVS 724

Query: 987  ---------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADK 1037
                       YRLF V +H+GTL  GHYTS V+K        GR  W  FDD  V   K
Sbjct: 725  LPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFDD--VSWRK 774

Query: 1038 KHGSDKSLKISSSDAYVLFYERVH 1061
                D+ +   + +AYVLFY RV+
Sbjct: 775  IRRKDEYI---TPNAYVLFYRRVN 795

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 46/88 (52%)

Query: 305 ITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQD 364
           ++  +L +++ + ++S  +LL+D+R        +I   N++ I+P    +  T+  + + 
Sbjct: 156 VSISQLHSLIRHDNDSSGILLVDIRPRMDFNDGHIKHNNVICIEPISFKESYTDSDILRK 215

Query: 365 DILEQLLEGNEHFINRDKFQYVVCYSDV 392
            ++       + F NRDKF+ +V Y+D 
Sbjct: 216 SLITASDREVDLFKNRDKFRLIVLYTDT 243

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score =  104 bits (259), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 117/248 (47%), Gaps = 36/248 (14%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQ--QSRGNRLHSPRLSNSLNM 658
           I GL N+GN CY+N ++QCL        +F+ + Y +++    SRG++     L+ +  +
Sbjct: 445 IVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSRGSK---GLLAKNFAI 501

Query: 659 LFDKMYLNGGCS--------VVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDE 710
           L + M+ +G  +        V    F K+   + P +     QQD QEF   LLD LH++
Sbjct: 502 LVNNMHRHGAFTPPNVRTIPVQTIQFKKICGHINP-MYSDSMQQDCQEFCQFLLDGLHED 560

Query: 711 LS---NQPHVA--NDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
           L+   ++ H+   +D    +       K S  E++ +     +    S I D+FQGQ  +
Sbjct: 561 LNQNGSKKHLKQLSDEEERMREKMSIRKASALEWERF-----LLTDFSAIIDLFQGQYAS 615

Query: 766 SLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGE 825
            LQC+ C +T+  Y TF VLS+ +PR             K   + DC   FT  E L  +
Sbjct: 616 RLQCQVCEHTSTTYQTFSVLSVPVPR------------VKTCNILDCFREFTKCERLGVD 663

Query: 826 NAWDCPRC 833
             W CP+C
Sbjct: 664 EQWSCPKC 671

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 67/144 (46%), Gaps = 32/144 (22%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-----------LKNN 984
            K  + K +    LPK L+I+L RF   + K NN  + YP  L++            + N 
Sbjct: 674  KQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYSLDLTPYWARDFNHEAIVNE 732

Query: 985  DT--------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
            D          +YRL+GV  H+G+L  GHYTS V K         +  WY+FDD + +  
Sbjct: 733  DIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PKKGWYFFDDSLYRP- 784

Query: 1037 KKHGSDKSLKISSSDAYVLFYERV 1060
                   S +  +  AYVLFYER+
Sbjct: 785  ----ITFSTEFITPSAYVLFYERI 804

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%)

Query: 320 SEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFIN 379
            + LLLID+R        +I   N++ IDP    D  T++ +    ++         F N
Sbjct: 160 GDALLLIDVRPRSEFVRAHIKCKNIICIDPASFKDSFTDQQIESVSLITSPHSDITFFSN 219

Query: 380 RDKFQYVVCYSDVK 393
           RDKF++++ Y+D +
Sbjct: 220 RDKFKFIILYTDTQ 233

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  103 bits (258), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 110/255 (43%), Gaps = 33/255 (12%)

Query: 592 SSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR 651
           S+N Y      GL N+GN+CYIN ++QCL        +F++  Y+ ++  +  +RL S  
Sbjct: 453 SANKYDLDFAVGLENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHINMN--SRLGSKG 510

Query: 652 -LSNSLNMLFDKMYLNG-------GCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
            L+     L   MY N        G  V P  F      +   L     QQD QEF   L
Sbjct: 511 VLAKYFAKLTHSMYQNASHKLNEKGKPVQPMEFKMACGTIN-SLFRESGQQDCQEFCQFL 569

Query: 704 LDRLHDELSNQPHVANDYPNLLLYDA-----DGLKVSNKEYKHWFDKNVIGNGISPIDDI 758
           LD LH++L+       + P   L D      + L +       W  +  +    S I D+
Sbjct: 570 LDGLHEDLN---QCGGNPPLKELSDEAEKMREKLSLRIASSIEW--ERFLTTDFSVIVDL 624

Query: 759 FQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTS 818
           FQGQ  + L+C+ CG T+  Y  F VLS+ +            P+ K   + DC   FT 
Sbjct: 625 FQGQYASQLRCQVCGLTSTTYQPFSVLSVPV------------PHAKSCNIIDCFKEFTK 672

Query: 819 DEVLSGENAWDCPRC 833
            E L  +  W CPRC
Sbjct: 673 VEKLETDEQWSCPRC 687

 Score = 65.9 bits (159), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 66/147 (44%), Gaps = 34/147 (23%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII--------------- 980
            K  + K +    LP+ L+IHL RF  ++  KNN  + YP  L++                
Sbjct: 690  KQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFTLDLTPYWANDFDGRLPPGV 748

Query: 981  ------LKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVK 1034
                     +    Y+L+G+ +H G+L  GHYTS V+K         +  W YFDD   +
Sbjct: 749  TEELPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDKG-------PKRGWCYFDDTSFR 801

Query: 1035 ADKKHGSDKSLKISSSDAYVLFYERVH 1061
              +      + +  + +AYVLFY RV+
Sbjct: 802  PVR-----NATECITPNAYVLFYHRVY 823

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score =  103 bits (258), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 115/247 (46%), Gaps = 38/247 (15%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR-LSNSLNMLFD 661
           GL N+GN+CY+N +IQCL +      +F+++ Y+ ++  +  ++L S   L+     L  
Sbjct: 520 GLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHI--NLNSKLGSKGVLAKYFARLVH 577

Query: 662 KMYLNGGCS--------VVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN 713
            MY  G           + P  F      +    K  + QQD+QEF   LLD LH++L N
Sbjct: 578 TMYREGSFKRPLEKNKPIQPIQFKMACGSINSLFK-DNTQQDSQEFCQFLLDGLHEDL-N 635

Query: 714 QPHVANDYPNLLLYDADGLK-------VSNKEYKHWFDKNVIGNGISPIDDIFQGQMENS 766
           Q   AN     L  DA+ ++        S+ E++ +   +      S I D+FQGQ  + 
Sbjct: 636 QCG-ANPPLKELSEDAEKMREKLSMRIASSIEWERFLTTD-----FSVIVDLFQGQYASQ 689

Query: 767 LQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGEN 826
           L+CK CG T+  Y TF VLS+ +P  S               + DC N FT  E L  + 
Sbjct: 690 LKCKVCGCTSTTYQTFSVLSVPVPHVS------------SCHILDCFNEFTKVEKLGTDE 737

Query: 827 AWDCPRC 833
            W CP C
Sbjct: 738 LWSCPTC 744

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 67/147 (45%), Gaps = 34/147 (23%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND--------- 985
            K  + K +    LP+ L+IHL RF  ++  KNN  + YP +L++     ND         
Sbjct: 747  KQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPGV 805

Query: 986  -----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVK 1034
                         +Y+L  V +H G+L  GHYT+ VNK +          W+YFDD   +
Sbjct: 806  TDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNKGINRG-------WHYFDDTSYR 858

Query: 1035 ADKKHGSDKSLKISSSDAYVLFYERVH 1061
              K        +  + +AYVLFY RV+
Sbjct: 859  PIKNET-----ECITPNAYVLFYHRVY 880

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score =  101 bits (251), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 112/250 (44%), Gaps = 39/250 (15%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSY--LQQSRGNRLHSPRLSNSL--NM 658
           GL NLGN+CY+N +IQCL   +    +F+   YK++  L    G++    +  + L  NM
Sbjct: 57  GLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHVNLNSRLGSKGVLAKYFSQLIHNM 116

Query: 659 LFDKMYLNGGCS--------VVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDE 710
               +  +G  S        V P  F      +    K    QQD QEF   LLD LH++
Sbjct: 117 QQQAISASGRKSTSGNERNAVQPLHFKVACGSINSLFKT-TSQQDCQEFCQFLLDGLHED 175

Query: 711 LSNQPHVANDYPNLLLYDADGLK-------VSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763
           L NQ    N     L  +A+ ++        S+ E++ +   +      S I D+FQGQ 
Sbjct: 176 L-NQCG-GNPALKELSEEAEAIREKLCMRIASSIEWERYLTTD-----FSVIVDLFQGQY 228

Query: 764 ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823
            + L CK CG T+  Y  F VLS+ +PR +            R  L DC   FT  E L 
Sbjct: 229 ASQLMCKVCGRTSTTYQPFSVLSVPVPRGA------------RCNLLDCFEEFTKIETLE 276

Query: 824 GENAWDCPRC 833
            +  W CPRC
Sbjct: 277 KDEQWSCPRC 286

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 65/144 (45%), Gaps = 33/144 (22%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND--------- 985
            K  + K I    LP+ L+IHL RF  +L  KNN  ++YP  L++     ND         
Sbjct: 289  KQPSTKKITITRLPRNLIIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGSLPKGV 347

Query: 986  ----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKA 1035
                         Y L+ V  H GTL  GHYT+ VNK+        ++ W YFDD   + 
Sbjct: 348  AELPTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNKE-------DKNGWCYFDDTCWR- 399

Query: 1036 DKKHGSDKSLKISSSDAYVLFYER 1059
             K    D+ +  S   AYVLFY R
Sbjct: 400  -KAKSEDECITTS---AYVLFYHR 419

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score =  102 bits (255), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 112/241 (46%), Gaps = 26/241 (10%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQ-----QSRGNRLHSPRLSNSLN 657
           GL NLGN+CY+N +IQC+        +F+   Y  ++       S+G  + +   +  ++
Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKG--ILAKYFARLVH 620

Query: 658 MLF-DKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL----S 712
           M++ +++  +   S+ P  F      +    K    QQD QEF   LLD LH++L    S
Sbjct: 621 MMYKEQVDASKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLNQCGS 679

Query: 713 NQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 772
           N P            +   L++++     W  +  +    S I D+FQGQ  + L+CK C
Sbjct: 680 NPPLKELSQEAEARREKLSLRIASS--IEW--ERFLTTDFSVIVDLFQGQYASRLKCKIC 735

Query: 773 GYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPR 832
           G+T+  Y  F VLS+ IPR+           +  + +EDC   FT  E L  +  W CP 
Sbjct: 736 GHTSTTYQPFTVLSIPIPRKVP---------QNEITIEDCFKEFTKCENLEVDEQWLCPH 786

Query: 833 C 833
           C
Sbjct: 787 C 787

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 69/145 (47%), Gaps = 35/145 (24%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-------------LKNND 985
            + K +    LP+ L+IHL RF  +L  KNN  + YP +L++                N+D
Sbjct: 793  STKQLTVTRLPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDD 851

Query: 986  TM---------KYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
             +         KY L+GV  H GTL  GHYT+ V K L       R  W YFDD   K  
Sbjct: 852  ELPVRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------RKGWLYFDDTKFKPV 904

Query: 1037 KKHGSDKSLKISSSDAYVLFYERVH 1061
            K         +++S+AYVLFY RV+
Sbjct: 905  KNKTD-----VTNSNAYVLFYHRVY 924

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score =  102 bits (253), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 114/241 (47%), Gaps = 26/241 (10%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQ-----QSRGNRLHSPRLSNSLN 657
           GL NLGN+CY+N +IQC+        +F+   Y  ++       S+G  + +   +  ++
Sbjct: 566 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKG--ILAKYFARLVH 623

Query: 658 MLF-DKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL----S 712
           M++ +++  +   S+ P  F      +    K    QQD QEF   LLD LH++L    S
Sbjct: 624 MMYKEQVDSSKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLNQCGS 682

Query: 713 NQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 772
           N P            +   L++++     W  +  +    S I D+FQGQ  + L+CK C
Sbjct: 683 NPPLKELSQEAEARREKLSLRIASS--IEW--ERFLTTDFSVIVDLFQGQYASRLRCKVC 738

Query: 773 GYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPR 832
            +T+  Y  F VLS+ IP+++         ++ ++ +EDC   FT  E L  E  W CP 
Sbjct: 739 NHTSTTYQPFTVLSIPIPKKN---------SQNKITIEDCFKEFTKCENLEVEEQWLCPH 789

Query: 833 C 833
           C
Sbjct: 790 C 790

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 66/145 (45%), Gaps = 35/145 (24%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-------------LKNND 985
            + K +    LP+ L++HL RF  +   KNN  + YP +L++                N+D
Sbjct: 796  STKQLTVTRLPRNLIVHLKRFD-NFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPGVNDD 854

Query: 986  TM---------KYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
             +         KY L+GV  H GTL  GHYT+ V K L       +  W YFDD   K  
Sbjct: 855  ELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTKYKPV 907

Query: 1037 KKHGSDKSLKISSSDAYVLFYERVH 1061
            K           +S+AYVLFY RV+
Sbjct: 908  KNQTD-----AINSNAYVLFYHRVY 927

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score =  100 bits (250), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 119/260 (45%), Gaps = 27/260 (10%)

Query: 585 HIPTIEQSSNAYVSLSIT-GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQ--- 640
           HI   + SS+    L    GL NLGN+CY+N +IQC+        +F+   Y  ++    
Sbjct: 545 HIDASQTSSSRNYDLDFAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININS 604

Query: 641 --QSRGNRLHSPRLSNSLNMLFDKMYLNGGC-SVVPTGFLKVVNQLRPDLKIPDDQQDTQ 697
              S+G  + +   +  ++M++ K   +    S+ P  F      +    K    QQD Q
Sbjct: 605 KLGSKG--ILAKYFARLVHMMYKKQVDSSKKDSISPIKFKLACGSVNSLFKTAS-QQDCQ 661

Query: 698 EFLMILLDRLHDEL----SNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGIS 753
           EF   LLD LH++L    SN P            +   L++++     W  +  +    S
Sbjct: 662 EFCQFLLDGLHEDLNQCGSNPPLKELSQEAETRRERLSLRIASS--IEW--ERFLTTDFS 717

Query: 754 PIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCI 813
            I D+FQGQ  + L+CK C +T+  Y  F VLS+ IP+++         ++ ++ +EDC 
Sbjct: 718 VIVDLFQGQYASRLKCKTCNHTSTTYQPFTVLSIPIPKKN---------SQNKITIEDCF 768

Query: 814 NMFTSDEVLSGENAWDCPRC 833
             FT  E L  +  W CP C
Sbjct: 769 KEFTKCENLEIDEQWLCPHC 788

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 66/145 (45%), Gaps = 35/145 (24%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-------------LKNND 985
            + K +    LP+ L+IHL RF  +L  KNN  + YP +L++                N+D
Sbjct: 794  STKQLTITRLPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDD 852

Query: 986  TM---------KYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
             +         KY L+GV  H GTL  GHYTS V K L          W YFDD   +  
Sbjct: 853  ELPIRGQIPPFKYELYGVACHFGTLYGGHYTSYVKKGLSRG-------WLYFDDTKYRPA 905

Query: 1037 KKHGSDKSLKISSSDAYVLFYERVH 1061
            K           +S+AYVLFY RV+
Sbjct: 906  KNQTD-----AINSNAYVLFYHRVY 925

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 119/253 (47%), Gaps = 48/253 (18%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR-LSNSLNMLFD 661
           GL N GN+CY++ +IQCL   +   T+F+++ Y++++  +  +RL S   L+   + L  
Sbjct: 487 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHI--NLNSRLGSKGVLARYFSQLIH 544

Query: 662 KMYLNGG----------CSVVPTGF---LKVVNQLRPDLKIPDDQQDTQEFLMILLDRLH 708
           +MY  G            +V+P  F      +N L  D      QQD QEF   LLD LH
Sbjct: 545 QMYQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFRD----RSQQDCQEFCQFLLDGLH 600

Query: 709 DELSNQPHVANDYP-NLLLYDADGLK-------VSNKEYKHWFDKNVIGNGISPIDDIFQ 760
           ++L+      N+ P   L   A+ ++        S+ E++ +   +      S I D+FQ
Sbjct: 601 EDLN---QCGNNPPLKELSEKAEKMREMMPMRIASSIEWERYLTTD-----FSVIVDLFQ 652

Query: 761 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDE 820
           GQ  + L+CK CG T+  Y  F VLS+ +            P+ ++  + DC   FT  E
Sbjct: 653 GQYASQLRCKVCGRTSTTYQPFSVLSVPV------------PSSRQCTIIDCFTEFTKVE 700

Query: 821 VLSGENAWDCPRC 833
            L  +  W CP C
Sbjct: 701 TLDLDEQWSCPDC 713

 Score = 74.7 bits (182), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 71/144 (49%), Gaps = 34/144 (23%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNI-----------ILKNNDT- 986
            + K I    LP+ L+IHL RF  ++  KNN  ++Y  +LN+           ++ NN+  
Sbjct: 719  STKKITITRLPRNLIIHLKRFD-NMLNKNNVFVSYSAVLNLTSFWANDYDKKVMNNNNVE 777

Query: 987  ---------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADK 1037
                       Y+L+GV  HTGTL  GHYT+ VNK       +G   W Y+DD   +  +
Sbjct: 778  LPSRGQVPPFNYQLYGVACHTGTLYGGHYTAYVNK----GATLG---WCYYDDTNWRQIR 830

Query: 1038 KHGSDKSLKISSSDAYVLFYERVH 1061
                  S +  S +AYVLFY R+H
Sbjct: 831  -----SSNEYISQNAYVLFYHRIH 849

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 65/151 (43%), Gaps = 16/151 (10%)

Query: 285 LDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALN-NIVAPN 343
            DVE    I SL +    ++IT P   T          +LLID+R P+   +N +I   +
Sbjct: 151 FDVENGSSISSLML---HNLITTPATAT---------SVLLIDIR-PRVDFVNFHIKFES 197

Query: 344 LVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYS 403
           L+ I+P    D  ++  + +  ++         F  RDKF+Y++ Y+        N    
Sbjct: 198 LICIEPVSFKDSHSDIDIAKKSMITSPDNEIALFQERDKFEYIILYTQGSEKNDYNIHQQ 257

Query: 404 FIFFYLLL--TSQKTRLATVPTALLGGYEKW 432
            +   LL+  + QK+   T    L GG+  W
Sbjct: 258 EVLVDLLINRSFQKSLYNTKILTLDGGFSSW 288

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score =  100 bits (249), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 111/252 (44%), Gaps = 45/252 (17%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR-LSNSLNMLFD 661
           GL NLGN+CY+N +IQCL        +F+   YK+++  +  ++L S   L+   + L  
Sbjct: 496 GLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHV--NLNSKLGSKGVLAKYFSQLIH 553

Query: 662 KMYLNGG-----------CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDE 710
            M                 +V P  F KV       L     QQD QEF   LLD LH++
Sbjct: 554 TMQQQAASASTKQNSGDKTAVQPLHF-KVACGSINSLFRSSSQQDCQEFCQFLLDGLHED 612

Query: 711 LSNQPHVANDYPNL--LLYDADGLK-------VSNKEYKHWFDKNVIGNGISPIDDIFQG 761
           L+         P L  L  +A+G++        S+ E++ +   +      S I D+FQG
Sbjct: 613 LNQ----CGGNPALKELSEEAEGIREKLCMRIASSIEWERYLTTD-----FSVIVDLFQG 663

Query: 762 QMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEV 821
           Q  + L CK CG T+  Y  F VLS+ +P  S            +  + DC   FT  E 
Sbjct: 664 QYASQLTCKVCGRTSTTYQPFSVLSVPVPSGS------------KCDIIDCFKEFTKVET 711

Query: 822 LSGENAWDCPRC 833
           L  +  W CPRC
Sbjct: 712 LEKDEQWSCPRC 723

 Score = 68.2 bits (165), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 65/147 (44%), Gaps = 33/147 (22%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND--------- 985
            K  + K I    LP+ LVIHL RF  +L  KNN  ++YP  L++     ND         
Sbjct: 726  KQPSTKKITITRLPRNLVIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGRLPPGV 784

Query: 986  ----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKA 1035
                         Y L+ V  H GTL  GHYTS V+K         ++ W YFDD   + 
Sbjct: 785  AELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDKG-------DKAGWCYFDDTSWRK 837

Query: 1036 DKKHGSDKSLKISSSDAYVLFYERVHD 1062
             K  G   +L      AYVLFY R ++
Sbjct: 838  AKSQGECITL-----SAYVLFYHRKYN 859

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 60/130 (46%), Gaps = 6/130 (4%)

Query: 305 ITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQD 364
           I+  EL ++L  Q+     LLIDLR   +   ++I    ++ I+P    D  ++  + + 
Sbjct: 164 ISPSELQSLLGAQNA----LLIDLRPRIKFVESHIKTDKIMCIEPISFKDSYSDTEITRR 219

Query: 365 DILEQLLEGNEHFINRDKFQYVVCYSDV--KTFMTMNFDYSFIFFYLLLTSQKTRLATVP 422
            ++    E  + F  RDKF Y+V Y+D   +T        S +   +  + +K    T+ 
Sbjct: 220 SLITSPNEEVQLFQERDKFDYIVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKPLQRTII 279

Query: 423 TALLGGYEKW 432
             L GG+E W
Sbjct: 280 LTLQGGFENW 289

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/251 (30%), Positives = 123/251 (49%), Gaps = 36/251 (14%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSY--LQQSRGNR-LHSPRLSNSLN 657
           I GL+N+GN+CY+N +IQCL        +F++  ++ Y  L    G++ + +  LS  ++
Sbjct: 746 IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKLIH 805

Query: 658 MLFDKMYL--NGGCSVVPTG--FLKVVNQLRPDLKIPDD------QQDTQEFLMILLDRL 707
           ++++   L  NG  +   +G  F+K + Q R      ++      QQD QEF   LLD L
Sbjct: 806 LMYNHSTLKNNGDKTKKKSGNNFIKPI-QFRMACGSINNLFKNCSQQDCQEFCQFLLDAL 864

Query: 708 HDEL----SNQPHVANDYPNLLLYDADGLKV-SNKEYKHWFDKNVIGNGISPIDDIFQGQ 762
           H++L    SN P          + +   L++ S+ E++ +     +    S I D+FQGQ
Sbjct: 865 HEDLNQCGSNPPLKELSTKAESMREKLSLRIASSIEWERY-----LTTDFSVIVDLFQGQ 919

Query: 763 MENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVL 822
             + LQCK C +T+  Y  F VLS+ IP++            K + L DC   FT  E L
Sbjct: 920 YASRLQCKTCIHTSTTYQPFSVLSVPIPKK------------KNLNLLDCFKDFTKIENL 967

Query: 823 SGENAWDCPRC 833
             +  W CP C
Sbjct: 968 EVDEQWFCPNC 978

 Score = 65.9 bits (159), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 68/147 (46%), Gaps = 34/147 (23%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNND---------- 985
            K  + K +    LP+ L+IHL RF  +L K N  +I YP IL++     D          
Sbjct: 981  KQPSTKKLTITRLPRNLIIHLKRFDNNLNKNN-NLIDYPFILDLTQFWADDFDGELPPGV 1039

Query: 986  -----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVK 1034
                         KYRL+G   H G+L  GHYT+ VNK +       R+ WYYFDD   +
Sbjct: 1040 TDELPKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNKGI-------RNGWYYFDDTNYR 1092

Query: 1035 ADKKHGSDKSLKISSSDAYVLFYERVH 1061
              K           SS+AYVLFY R++
Sbjct: 1093 PIKNEREP-----ISSNAYVLFYHRIY 1114

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 112/242 (46%), Gaps = 28/242 (11%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQ-----QSRGNRLHSPRLSNSLN 657
           GL NLGN+CY+N +IQC+        +F+   Y  ++       S+G  + +   +  ++
Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKG--ILAKYFARLVH 620

Query: 658 MLFDKMYLNGG--CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL---- 711
           M++ K  ++G    S+ P  F      +    K    QQD QEF   LLD LH++L    
Sbjct: 621 MMY-KEQVDGSKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLNQCG 678

Query: 712 SNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKR 771
           SN P            +   L++++     W  +  +    S I D+FQGQ  + L+CK 
Sbjct: 679 SNPPLKELSQEAEARREKLSLRIASS--IEW--ERFLTTDFSVIVDLFQGQYASRLKCKV 734

Query: 772 CGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCP 831
           C +T+  Y  F VLS+ IP+++ +           + +EDC   FT  E L  +  W CP
Sbjct: 735 CSHTSTTYQPFTVLSIPIPKKNSR---------NNITIEDCFREFTKCENLEVDEQWLCP 785

Query: 832 RC 833
            C
Sbjct: 786 HC 787

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 71/145 (48%), Gaps = 35/145 (24%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-------------LKNND 985
            + K +    LP+ L++HL RF  +L  KNN  + YP +L++                N+D
Sbjct: 793  STKQLTITRLPRNLIVHLKRFD-NLLNKNNDFVIYPFLLDLTPFWANDFDGVFPPGVNDD 851

Query: 986  TM---------KYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
             +         KY L+GV  H GTL  GHYT+ V K L       +  W YFDD   K  
Sbjct: 852  ELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTKYKPV 904

Query: 1037 KKHGSDKSLKISSSDAYVLFYERVH 1061
            K    +K+  I +S+AYVLFY RV+
Sbjct: 905  K----NKADAI-NSNAYVLFYHRVY 924

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 97.4 bits (241), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 112/243 (46%), Gaps = 26/243 (10%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR-LSNSLNML 659
           I GL+N+GN+CY+N +IQCL        +F+++ Y+ ++  +  ++L S   L+     L
Sbjct: 558 IVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHI--NLNSKLGSKGVLAKYFARL 615

Query: 660 FDKMYLNGGCS-----VVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL--- 711
              M+ +         V P  F   V  +    K    QQD QEF   LLD LH++L   
Sbjct: 616 IHLMHNHANPKLKNNYVRPAQFKMAVGSVNTLFK-NCSQQDCQEFCQFLLDGLHEDLNQC 674

Query: 712 -SNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCK 770
            SN P    +  +    + + L +       W  +  +    S I D+FQGQ  + LQC+
Sbjct: 675 GSNPP--LKELSSAAEKNREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLQCE 730

Query: 771 RCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDC 830
            C +T+  Y  F VLS+ IPR          P   +V + DC   FT  E+L  +  W C
Sbjct: 731 VCKHTSTTYQPFSVLSVPIPR---------VPKGVKVNILDCFKDFTKLELLDTDEQWLC 781

Query: 831 PRC 833
           P C
Sbjct: 782 PTC 784

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 73/148 (49%), Gaps = 34/148 (22%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTM-------- 987
            K  + K +    LP+ L+IHL RF      KNN  I YP IL++     D          
Sbjct: 787  KQRSTKKLTITRLPRNLIIHLKRFDN-NLNKNNNFIDYPFILDLTQFWVDDFDGKLPPGV 845

Query: 988  -------------KYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVK 1034
                         KY+L+GV +H G+L  GHYT+ V+K  +H        WYYFDD   +
Sbjct: 846  RDELPKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGPKHG-------WYYFDDTNYR 898

Query: 1035 ADKKHGSDKSLKISSSDAYVLFYERVHD 1062
            + K    +K+  I+SS AY+LFY R++D
Sbjct: 899  SIK----NKNEPITSS-AYLLFYHRIYD 921

 Score = 36.2 bits (82), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 64/119 (53%), Gaps = 2/119 (1%)

Query: 294 QSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLW 353
           Q L  ++  S+I++ +L  +L  ++++  +LLID+R     + ++I    ++ ++P    
Sbjct: 154 QELFSMKNGSLISSYQLKQLLYGKNDNTSVLLIDIRPRLEFSKSHIKHEEIICVEPISFK 213

Query: 354 DKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLT 412
           D  +++ V +  ++    E  + F  R++F++++ Y++ K      ++   +F  +LLT
Sbjct: 214 DSYSDEEVAKKSLITSPNEEIDLFNKRNEFEFIILYTNDKE--KAYYNQQMVFLEILLT 270

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/265 (30%), Positives = 113/265 (42%), Gaps = 51/265 (19%)

Query: 592 SSNAYVSLSIT-GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSP 650
           S N  +  S T GL N+GN+CYIN +IQC+FA      +F++  Y  ++  ++ ++L S 
Sbjct: 514 SCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHI--NKQSKLGSK 571

Query: 651 R-LSNSLNMLFDKMYLNGGCSVVPT--GFLKV---------VNQLRPDLKIPDDQQDTQE 698
             LS++   L   MY       +    G +K          VN L  D      QQD  E
Sbjct: 572 GVLSHNFAKLLKDMYEENSSKKIGKKHGAVKTLQFKMACASVNSLFKDA----SQQDCLE 627

Query: 699 FLMILLDRLHDELSN----------QPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVI 748
           F   LLD LH++L+            P       NL L  A  ++        W  +  +
Sbjct: 628 FCQFLLDGLHEDLNQCGANPPLKELSPEAEKMRENLSLRVASSIE--------W--ERYL 677

Query: 749 GNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVK 808
               S I D+FQGQ  + L+CK C  T+  Y  F VLS+ +            P+ K   
Sbjct: 678 TTDFSIIVDLFQGQYASQLRCKVCNRTSTTYQAFSVLSVPV------------PSGKSCG 725

Query: 809 LEDCINMFTSDEVLSGENAWDCPRC 833
           L DC   FT  E L  +  W CP C
Sbjct: 726 LLDCFIEFTKTENLEVDEQWFCPSC 750

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 65/146 (44%), Gaps = 34/146 (23%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNNDT-------- 986
            K  + K +    LP+ L+IHL RF  ++  KNN  + YP IL++     ND+        
Sbjct: 753  KQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNIFVRYPQILDLTPFWANDSDGKLPPGI 811

Query: 987  ------------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVK 1034
                          YRL+G   H GTL  GHYTS V+K  E         W YFDD V +
Sbjct: 812  TDEIPARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDKGPEKG-------WIYFDDTVYR 864

Query: 1035 ADKKHGSDKSLKISSSDAYVLFYERV 1060
              +        +  S  AYVLFY R+
Sbjct: 865  PVRFQN-----EFISPSAYVLFYHRI 885

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 61/116 (52%), Gaps = 5/116 (4%)

Query: 281 NDDLLDVETDGFIQSLEILQKQ---SIITAPELFTILSNQSESEKLLLIDLRIPQRSALN 337
           N D ++++ D  +Q +  +  +   S I+  EL +++  + +S  LLLID+R       +
Sbjct: 163 NRDAIEIDKDSILQDIRYINGKRSGSGISCSELLSLMKMKEDS--LLLIDVRPKLEYDAH 220

Query: 338 NIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDVK 393
           +I   N++ I+P    +  +++ + +  ++       + F  R +FQY++ Y+D++
Sbjct: 221 HIKTKNIICIEPISFKESYSDQQIEKTSMIPSPKHEIQLFQRRSEFQYIILYTDLE 276

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 111/248 (44%), Gaps = 32/248 (12%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR-LSNSLNMLF 660
           TGL N+ N+CY+N +IQCL +      L++++ + +  Q +  N+L S   LS +   L 
Sbjct: 458 TGLENVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLT--QINVENKLGSKGFLSKNFANLI 515

Query: 661 DKMYLNGGCSVVPTGFLKVVNQLR--------PDLKIPDDQQDTQEFLMILLDRLHDELS 712
             MY           FL  V  L           +     +QD QEF   LLD LH++L+
Sbjct: 516 QTMYKKSAFQPYNPNFLHPVAPLEFKNACGMMNSIYAESTEQDCQEFCEFLLDGLHEDLN 575

Query: 713 NQPHVANDYPNLLLYDADGLK-------VSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
                 N  P  L  +   L+        S  E++ +   N      SPI ++FQGQ  +
Sbjct: 576 Q--CSGNPRPKELSANEAELRESLSMRIASEIEWESFLTTN-----FSPIINLFQGQYAS 628

Query: 766 SLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGE 825
            LQC  C +T+  Y  F +LS+ +P  SM  S     N +   + DC   FT  E L  +
Sbjct: 629 RLQCLICQHTSTTYQPFSLLSIPVP--SMVFS-----NGQTCNILDCFKEFTKCERLDND 681

Query: 826 NAWDCPRC 833
             W CP+C
Sbjct: 682 EKWFCPKC 689

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 68/148 (45%), Gaps = 34/148 (22%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND--------- 985
            K  + K +    LPK L+IH  RF  +   KNN  + YP  L++  L  ND         
Sbjct: 692  KQISTKQLKITRLPKNLIIHFKRFD-NFMNKNNIFVQYPYQLDLTSLWVNDYDGKLPPNF 750

Query: 986  -----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVK 1034
                         KY+L  V  H+G L SGHYT+ V+K L          W+ FDD   +
Sbjct: 751  NEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDKGLYRG-------WFRFDDASYR 803

Query: 1035 ADKKHGSDKSLKISSSDAYVLFYERVHD 1062
               K G++      + DAY+LFY+R+++
Sbjct: 804  P-VKFGTE----FLTPDAYLLFYQRIYE 826

 Score = 35.8 bits (81), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 59/141 (41%), Gaps = 8/141 (5%)

Query: 303 SIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVY 362
           S I   +L  +LS  S    LLLID+R  +     +I AP ++ I P       T+  + 
Sbjct: 167 SFILPEKLHDLLS--SHKRNLLLIDVRTRKEFDTLHIDAPIILPIGPLSFKSTFTDLQIE 224

Query: 363 QDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTR----L 418
           Q  +L    +   +F  R++F+Y+V Y+      T  +      F +L  +   R    +
Sbjct: 225 QTSLLTSTFQERNYFKKRNQFRYIVLYTKDDNDTTYYYTQVISLFNILTIAASKRNIDQI 284

Query: 419 ATVPTALLGGYEKWKKTLHTY 439
                 L GG   W +  H+Y
Sbjct: 285 CPSIFILKGGITSWVQ--HSY 303

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score = 94.4 bits (233), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 105/246 (42%), Gaps = 32/246 (13%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQ--QSRGNRLHSPRLSNSLNM 658
           I GL N GN CY+N ++QCL        +F+ + Y +++    S+G++     L+ +   
Sbjct: 445 IVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSKGSK---GLLAKNFAT 501

Query: 659 LFDKMYLNGG--------CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDE 710
           L   M+ N            V    F K+   +   +     QQD QEF   LLD LH++
Sbjct: 502 LVRNMHRNSAFMPVNSRTTPVQTIQFKKICGHIN-SIYSDSMQQDCQEFCQFLLDGLHED 560

Query: 711 LSNQPHVANDYPNLLLYDA---DGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSL 767
           L NQ         L   +    + + +       W  +  +    S I D+FQGQ  + L
Sbjct: 561 L-NQNGGKEHLKQLTEEEEQKREKMTIRKASALEW--ERFLLTDFSAIIDLFQGQYASRL 617

Query: 768 QCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENA 827
           QC+ C  T+  Y TF VLS+ +PR +               + DC   FT  E L  +  
Sbjct: 618 QCQACDRTSTTYQTFSVLSVPVPRITT------------CNILDCFREFTKCEKLGIDEL 665

Query: 828 WDCPRC 833
           W CPRC
Sbjct: 666 WSCPRC 671

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 69/144 (47%), Gaps = 32/144 (22%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-----------LKNN 984
            K  + K +    LPK L+I+L RF   + K NN  + YP  L++            + N 
Sbjct: 674  KQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYFLDLTPYWARDFNHEAIVNE 732

Query: 985  DT--------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
            D          +YRL+GV  H+G+L  GHYTS V K         +  WY+FDD + +  
Sbjct: 733  DIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PKKGWYFFDDSIYRPI 785

Query: 1037 KKHGSDKSLKISSSDAYVLFYERV 1060
            + +      +  + +AYVLFYER+
Sbjct: 786  RFND-----EFITPNAYVLFYERI 804

 Score = 32.7 bits (73), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%)

Query: 320 SEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFIN 379
            + LLLID+R        +I   N++ I+P    D  T++ +    ++       + F N
Sbjct: 160 GDTLLLIDVRPRSDFTKAHIKCKNIICIEPVSFKDSFTDRQLENVSLITSSQSDIDLFSN 219

Query: 380 RDKFQYVVCYSDVK 393
           R+ F+Y+V Y+D +
Sbjct: 220 RNMFKYIVLYTDAQ 233

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 94.4 bits (233), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 109/244 (44%), Gaps = 32/244 (13%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSY--LQQSRGNRLHSPRLSNSLNMLF 660
           GL N+GN+CY+N ++QC+        +F+++ Y+ +  +    G++    R    L  + 
Sbjct: 584 GLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHININSKLGSKGVLARYFARLAHIM 643

Query: 661 DKMYLN---GGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHV 717
            +   +       V PT F   +  +    +   +QQD QEF   LLD LH++L+     
Sbjct: 644 HQTSYDQEKKAAIVRPTQFRMAIASINSMFR-NTNQQDCQEFCQFLLDGLHEDLN---QC 699

Query: 718 ANDYPNLLLYDADGLK--------VSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 769
            N+ P   L +    K         S+ E++ +   N      S I D+FQGQ  + L+C
Sbjct: 700 GNNPPLKELSEEAEKKRELLSLRIASSIEWERFLTTN-----FSVIIDLFQGQYASRLKC 754

Query: 770 KRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWD 829
             C  T+  Y  F VLS+ +P  +          +  V L DC N FT  E L  +  W+
Sbjct: 755 SVCSNTSTTYQPFSVLSVPLPTGT----------KSSVNLMDCFNEFTKCEKLEHDEYWN 804

Query: 830 CPRC 833
           CP C
Sbjct: 805 CPTC 808

 Score = 75.9 bits (185), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 70/148 (47%), Gaps = 35/148 (23%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNNDT-------- 986
            K  + K +    LP+ L+IHL RF   + K N  +I YP  L++     ND         
Sbjct: 811  KQPSTKQLTITRLPRNLIIHLKRFDNRMNK-NTKLIDYPFNLDLTSFWANDKDDRLPPGV 869

Query: 987  -------------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
                          KY L+ V NH G+L  GHYTS VNK L          WYYFDD+  
Sbjct: 870  SIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNKGLSRG-------WYYFDDQNY 922

Query: 1034 KADKKHGSDKSLKISSSDAYVLFYERVH 1061
            +  K     K+ ++ +S+AYVLFY RVH
Sbjct: 923  RLVK-----KTSEVVNSNAYVLFYRRVH 945

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 107/246 (43%), Gaps = 32/246 (13%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQ--QSRGNRLHSPRLSNSLNM 658
           I GL N+GN CY+N ++QCL        +F+ + Y +++    +RG++     L+ +   
Sbjct: 463 IVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFGNTRGSK---GLLAKNYAT 519

Query: 659 LFDKMYLNGG--------CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDE 710
           L   M+ +G           V    F KV   +   +     QQD QEF   LLD LH++
Sbjct: 520 LVHNMHRHGAFKPPHSRTTPVQTLQFKKVCGHIN-SIYSDSMQQDCQEFCQFLLDGLHED 578

Query: 711 LSNQPHVANDYPNLLLYDA---DGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSL 767
           L NQ         L   +    + + +       W  +  +    S I D+FQGQ  + L
Sbjct: 579 L-NQNGGKKHLKQLSEQEERMRESMSIRKASALEW--ERFLLTDFSAIIDLFQGQYASRL 635

Query: 768 QCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENA 827
           QC+ C +T+  Y TF VLS+ +PR             +   + DC   FT  E L  +  
Sbjct: 636 QCQACEHTSTTYQTFSVLSVPVPRI------------RTCNILDCFREFTKCEKLGVDEQ 683

Query: 828 WDCPRC 833
           W C +C
Sbjct: 684 WSCSKC 689

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 68/144 (47%), Gaps = 32/144 (22%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-----------LKNN 984
            K  + K +    LPK L+I+L RF   + K NN  + YP  L++            + N 
Sbjct: 692  KQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPCFLDLTPYWARDFNHESIVNE 750

Query: 985  DT--------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
            D          +YRL+GV  H+G+L  GHYTS V K  +         WY+FDD V    
Sbjct: 751  DIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGPQKG-------WYFFDDSVYCPI 803

Query: 1037 KKHGSDKSLKISSSDAYVLFYERV 1060
            + +      +  + +AYVLFYER+
Sbjct: 804  RFND-----EFITPNAYVLFYERI 822

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 51/119 (42%), Gaps = 2/119 (1%)

Query: 323 LLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDK 382
           +L+ID+R        +I   N++ I+P    D  T++ V +  +        + F NRD 
Sbjct: 179 ILVIDIRPRSEFIKAHIKCKNIICIEPVSFKDSFTDQQVGKISLATSPQSEIDLFSNRDT 238

Query: 383 FQYVVCYSDVKTFMTMNFDYSFIFFYLLL--TSQKTRLATVPTALLGGYEKWKKTLHTY 439
           F+Y+V Y+D + +   +   + I   +L   +  K    T    L  G+  W K    Y
Sbjct: 239 FKYIVLYTDTQLYGDFHQRQTRILTKILCQHSVLKPLGGTKVLILANGFSNWVKLGGAY 297

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 123/269 (45%), Gaps = 50/269 (18%)

Query: 591 QSSNAYVSLSIT---------GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSY--L 639
           +SSN+  SL+ T         GL N+GN+CYIN +IQCL        +F+++ Y+ +  L
Sbjct: 495 RSSNSQSSLTQTKQYDLDFTVGLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINL 554

Query: 640 QQSRGNR----LHSPRLSNSL--NMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQ 693
               G++     H  RL + +  +  F K   N   +V P  F      +   L     Q
Sbjct: 555 NSKLGSKGVLAKHFARLIHQMHQSAAFKKSDKNK--AVRPYEFKMACGSIN-SLFRESGQ 611

Query: 694 QDTQEFLMILLDRLHDELSNQPHVANDYPNL--LLYDADGLK-------VSNKEYKHWFD 744
           QD+QEF   LLD LH++L NQ       P L  L  +A+ ++        S+ E++ +  
Sbjct: 612 QDSQEFCQFLLDGLHEDL-NQ---CGGNPPLKELSEEAEKMRERLSMRIASSIEWERYLT 667

Query: 745 KNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNE 804
           ++      S I D+FQGQ  + L+CK C +T+  Y  F +L+  +            P+ 
Sbjct: 668 RD-----FSVIVDLFQGQYASQLRCKVCNHTSTTYQPFSILAAPV------------PHA 710

Query: 805 KRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           K   L DC   FT  E L  +  W CP C
Sbjct: 711 KSCYLLDCFKEFTKLEQLEKDEEWLCPYC 739

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 70/147 (47%), Gaps = 34/147 (23%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND--------- 985
            K  + K +    LP+ L+IHL RF  +L  KNN ++ YP  L++     ND         
Sbjct: 742  KQPSTKKLTITRLPRNLIIHLKRFD-NLLNKNNVLVNYPFFLDLTPFWANDFDGRLPPGV 800

Query: 986  -----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVK 1034
                         KY+L+ V +H+G+L  GHYT+ V+K L          WYYFDD   +
Sbjct: 801  TDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGLNKG-------WYYFDDTGYR 853

Query: 1035 ADKKHGSDKSLKISSSDAYVLFYERVH 1061
              +        +  +S+AYVLFY RV+
Sbjct: 854  PMR-----TPTECITSNAYVLFYHRVY 875

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 107/257 (41%), Gaps = 50/257 (19%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR-LSNSLNMLFD 661
           GL NLGN+CY+N +IQCL        +F++  YK+++  +  ++L S   L+   + L  
Sbjct: 524 GLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHI--NFNSKLGSKGVLAKYFSQLVH 581

Query: 662 KMYLNGG----------------CSVVPTGF---LKVVNQLRPDLKIPDDQQDTQEFLMI 702
            MY                     +V P  F      +N L  D      QQD QEF   
Sbjct: 582 NMYRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTINSLFRDC----SQQDCQEFCQF 637

Query: 703 LLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNK------EYKHWFDKNVIGNGISPID 756
           LLD LH++L+         P L     +  K+  K          W  +  +    S I 
Sbjct: 638 LLDGLHEDLNQ----CGGNPRLKELSEEAEKIREKLSMRIASSIEW--ERYLTTDFSVIV 691

Query: 757 DIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMF 816
           D+FQGQ  + L+C+ CG T+  Y  F VLS+ +            P+ K   + DC   F
Sbjct: 692 DLFQGQYASQLKCQVCGRTSTTYQPFSVLSVPL------------PSLKSCNILDCFQEF 739

Query: 817 TSDEVLSGENAWDCPRC 833
           T  E L  +  W CP C
Sbjct: 740 TKVETLEKDEQWSCPDC 756

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 69/143 (48%), Gaps = 33/143 (23%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND------------ 985
            + K I    LP+ L+IHL RF  ++  KNN  ++YP  L++     ND            
Sbjct: 762  STKKITITRLPRNLIIHLKRFD-NMMNKNNVFVSYPHTLDLTPFWANDFDGRLPPGVTEL 820

Query: 986  -------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKK 1038
                      Y+L+ V +HTGTL  GHYT+ V+K  +         W YFDD   +  + 
Sbjct: 821  PTRGQVPPFSYKLYAVASHTGTLYGGHYTAYVHKGSQRG-------WCYFDDTNWRRSR- 872

Query: 1039 HGSDKSLKISSSDAYVLFYERVH 1061
              SD   +  +S+AYVLFY RV+
Sbjct: 873  --SDN--ECITSNAYVLFYHRVY 891

 Score = 32.3 bits (72), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%)

Query: 314 LSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEG 373
           L N   +  +LLIDLR       ++I +P+++ I+P    D  ++  + +  ++      
Sbjct: 167 LQNLMAASSVLLIDLRPRMEFIKSHIKSPSVICIEPISFKDTYSDLDLAKKSMITSPNCE 226

Query: 374 NEHFINRDKFQYVVCYS 390
            E F  RD FQ++V Y+
Sbjct: 227 IELFSKRDTFQFIVLYT 243

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 114/263 (43%), Gaps = 38/263 (14%)

Query: 587 PTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQ--QSRG 644
           P I+ S+  +    I GL N+GN CY+N ++QCL        +F+ + Y +++     RG
Sbjct: 414 PPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFDNMRG 473

Query: 645 NRLHSPRLSNSLNMLFDKMYLNGG-----CSVVPTGFLKV------VNQLRPDLKIPDDQ 693
           ++     L+ +   L   M+ +G        + P   ++       +N +  D      Q
Sbjct: 474 SK---GLLAKNFANLVHTMHRHGAFKPLNSRITPVQTIQFKKTCGHINSIYSD----SMQ 526

Query: 694 QDTQEFLMILLDRLHDELSNQPHVANDYPNLLLYDA---DGLKVSNKEYKHWFDKNVIGN 750
           QD QEF   LLD LH++L NQ         L   +    + + +       W  +  +  
Sbjct: 527 QDCQEFCQFLLDGLHEDL-NQNGGKKHLKQLSEEEERTRENMSIRKASALEW--ERFLLT 583

Query: 751 GISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLE 810
             S + D+FQGQ  + LQC+ C +T+  Y TF VLS+ +P R M  + L           
Sbjct: 584 DFSAVIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVP-RIMTCNVL----------- 631

Query: 811 DCINMFTSDEVLSGENAWDCPRC 833
           DC   FT  E L     W C RC
Sbjct: 632 DCFREFTKCEKLGIGEQWSCSRC 654

 Score = 68.2 bits (165), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 70/144 (48%), Gaps = 32/144 (22%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILN-------------IILK 982
            K  + K +    LPK L+I+L RF   +  KNN  + YP  L+             II +
Sbjct: 657  KQPSTKQLKITRLPKKLIINLKRFDNQM-HKNNVFVQYPCFLDLTPYWARDFNHEAIIDE 715

Query: 983  NNDT------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
            +  T       +YRL+GV  H+G+L  GHYTS V K  +         WY+FDD + +  
Sbjct: 716  DIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGPQKG-------WYFFDDTIYRLI 768

Query: 1037 KKHGSDKSLKISSSDAYVLFYERV 1060
            + +      +  + +AYVLFYER+
Sbjct: 769  RFNN-----EFITPNAYVLFYERI 787

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 106/256 (41%), Gaps = 49/256 (19%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQ-----SRG----------N 645
           I GL N+ N+CY+N +IQCL +      + +++ +  ++       S+G           
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQ 487

Query: 646 RLHSPRLSNSLNML---FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMI 702
            +HS ++    ++       +     C+ V + +                QQD QEF   
Sbjct: 488 DMHSQQVKTGRSLFSYPVKTIDFKNACASVSSIYSG------------SQQQDCQEFCEF 535

Query: 703 LLDRLHDELSNQPHVANDYPNLLLYDAD-----GLKVSNKEYKHWFDKNVIGNGISPIDD 757
           LLD LH++L+       + P   L D +     GL +       W  +N + N  S I D
Sbjct: 536 LLDGLHEDLN---QCGGNPPARELTDQEERLREGLCMRVASSMAW--ENFLHNNFSLIID 590

Query: 758 IFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFT 817
           +F GQ  + L+C  C YT+  Y  F +LS+ +P  S            R  + DC   FT
Sbjct: 591 LFAGQYGSQLRCCVCQYTSTTYQPFTLLSVPVPLSS---------RVSRCSIIDCFQEFT 641

Query: 818 SDEVLSGENAWDCPRC 833
             E L  +  W CP+C
Sbjct: 642 KCERLDKDEEWFCPQC 657

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 71/153 (46%), Gaps = 43/153 (28%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNI---------------- 979
            K  + K +    LPK L+IH  RF  ++  KNN  I YP  L++                
Sbjct: 660  KQPSTKQLKITRLPKNLIIHFKRFD-NMMNKNNIFIQYPYELDLTPFWVNDFNGELPLGM 718

Query: 980  ----ILKNNDT--MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
                + K       KY+L  V  H GTL SGHYT+ VNK      D+G   WYYFDD   
Sbjct: 719  TNSLLTKGGQVGPFKYQLNAVACHMGTLGSGHYTAYVNK----GPDVG---WYYFDD--- 768

Query: 1034 KADKKHGSDKSLKISSS----DAYVLFYERVHD 1062
                   S + +KI++     DAY+LFY RV++
Sbjct: 769  ------SSHRIVKIATEYMNPDAYLLFYHRVYN 795

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 81/174 (46%), Gaps = 23/174 (13%)

Query: 227 VLLEDVPYTHNDNDGTSASSDQPFGEITADRSVTHRKDSYHSVYMVDS-DTF---KSDND 282
           +L E VP +H   D       QP  E+ +    +  +D+     M+D+ +TF    S+ D
Sbjct: 83  LLTERVPQSHEYADAKIERRCQPLLEVYSTLKKSLLQDT-----MIDNVETFLIKYSNED 137

Query: 283 DLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAP 342
             + + +   ++    L     +T P+L TILS+Q  S  +LLID+R       ++I + 
Sbjct: 138 PSMKIISTQKVEGGHNLPSGPFLTVPQLQTILSDQKIS--VLLIDVRKRYEFEFSHINSV 195

Query: 343 NLVKIDPNLLWDKKTNKPVYQDDILEQL------LEGNEHFINRDKFQYVVCYS 390
            ++ +DP       + KP Y  D LE++      +   + F  R+++  +V Y+
Sbjct: 196 AVLPLDP------ISFKPTYTIDQLEKISFINSPMHELQLFQKRNEYDVIVLYT 243

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 82.4 bits (202), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 104/205 (50%), Gaps = 14/205 (6%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR--GNRLH-SPRLSN 654
           SL ITGL NLGNTCY+NS +QC+    VFR  F+ S Y+  L      G + H +   S 
Sbjct: 317 SLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVAEAFSE 376

Query: 655 SLNMLF-DKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS- 712
            +  LF DK+      +  P  F   +      +     QQD+QEFL  LLD LH++L+ 
Sbjct: 377 LIRCLFGDKLV--QFSAYAPNHFKATIGHFN-SMFSGYLQQDSQEFLAFLLDSLHEDLNR 433

Query: 713 --NQPHVANDYPNL-LLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 769
              +P+V  + P+L    D +  ++  K     +  +++ N  S I D+F G  +++L+C
Sbjct: 434 IDKKPYV--EKPSLPSTADLNDFRIVKKLADDTWKAHLLRND-SVITDLFVGLYKSTLEC 490

Query: 770 KRCGYTTFNYSTFYVLSLAIPRRSM 794
             C   +  +  +  L+L +P +SM
Sbjct: 491 PECQNISITFDPYNDLTLPLPVKSM 515

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 55/129 (42%), Gaps = 21/129 (16%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI-----LNIILKNNDTMK-YR 990
              K I     P +L+IHL RF      + K + V+ +P+       +++ K++     Y 
Sbjct: 928  ATKQIQLWNAPDVLLIHLKRFENQQSFSDKIDDVVQFPITDFDISEHLVYKDDPRGNVYD 987

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
            L  V NH G L  GHYT+      +        KWYYFDD  V       S       + 
Sbjct: 988  LIAVDNHYGGLGGGHYTAYAKNSTD-------GKWYYFDDSRVTETVAENS------ITG 1034

Query: 1051 DAYVLFYER 1059
             AY+LFY R
Sbjct: 1035 AAYLLFYLR 1043

 Score = 39.3 bits (90), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 805 KRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           K + L DC+N+F+  E+LS  ++W CP C
Sbjct: 894 KEITLNDCLNLFSKPEILSLNDSWYCPTC 922

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 78.6 bits (192), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 107/220 (48%), Gaps = 18/220 (8%)

Query: 593 SNAYV------SLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSY--LQQSRG 644
           SN YV      S    GL NLGNTCY+NS +QCL     F+  F+ + Y+    ++   G
Sbjct: 331 SNFYVYNQLLSSKGTIGLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLG 390

Query: 645 NRLH-SPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703
           ++ H +   ++ +  LF K + +   S  P  F   +  L   +     QQD+QEFL  L
Sbjct: 391 HKGHIAWAFASMVQALFGKRH-SAATSYSPRNFKNTIGHLN-SMFSGYQQQDSQEFLAFL 448

Query: 704 LDRLHDELS---NQPHVANDYPNLLLYDADG-LKVSNKEYKHWFDKNVIGNGISPIDDIF 759
           LD LH++L+    +P+V  + P L   D     KV  K     + K+ + N  S I D+F
Sbjct: 449 LDGLHEDLNRIIEKPYV--EKPELTSTDDTAEFKVIKKLADDTWGKHKLRND-SVITDLF 505

Query: 760 QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKL 799
            G  +++L C  C  T+  +  +  L+L +P  S   +K+
Sbjct: 506 VGLYKSTLICPVCKKTSVTFDPYNDLTLPLPVNSTWSNKV 545

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 57/129 (44%), Gaps = 22/129 (17%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYP-----LILNIILKNNDTMK-YR 990
              K I     P IL+IHL RF      + K    + +P     +   ++ KN D    Y 
Sbjct: 994  ATKQIELWNAPDILLIHLKRFENQRSFSDKIADTVHFPITDLDMTPYLVYKNEDKGDIYD 1053

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
            L  V NH G L  GHYT+ V      N+D    KWYYFDD  V       S     I+ S
Sbjct: 1054 LIAVDNHYGGLGGGHYTAYVK-----NID---GKWYYFDDSRVSETLPERS-----IAGS 1100

Query: 1051 DAYVLFYER 1059
             AY+LFY R
Sbjct: 1101 -AYLLFYRR 1108

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 803 NEKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
            EK++ L DC+ +F++ EVL   ++W CP C
Sbjct: 958 GEKKITLHDCLTLFSTPEVLGATDSWFCPNC 988

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 75.1 bits (183), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 103/204 (50%), Gaps = 15/204 (7%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR--GNRLHSPR-LSN 654
           S  ITGL NLGNTCY+NS +QCL      R  F+ + ++  +  +   G + +  R  S 
Sbjct: 289 SSGITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEINCNNPLGYQGYVARAFSG 348

Query: 655 SLNMLFDKMYLNGGCSVV----PTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDE 710
            +  LF    L+ G ++     PTGF   +      +     QQD+QEF+  LLD LH++
Sbjct: 349 LVQNLFGCKTLSSGSTLTPAYSPTGFKSTIGHFN-SMFSGYMQQDSQEFITFLLDGLHED 407

Query: 711 LS---NQPHVANDYPNLLLY-DADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENS 766
           L+   ++P++  + P+L    D++   V  +  +  +  ++  N  S I D+F G  E++
Sbjct: 408 LNRIVDKPYI--EKPSLSPEDDSNDFNVIKRLAEDTWKLHLQRND-SVITDLFVGLYEST 464

Query: 767 LQCKRCGYTTFNYSTFYVLSLAIP 790
           LQC  C   +  +  +  L+L +P
Sbjct: 465 LQCPECNNVSITFDPYNDLTLPLP 488

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 62/130 (47%), Gaps = 23/130 (17%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI---LNIILKNNDTMK---YR 990
              K I     P +L+IHL RF      + K + V+ +P+    ++  L N    +   Y 
Sbjct: 912  ATKQIQLWDTPDVLLIHLKRFENLRSFSDKIDEVVHFPITGLDMSPYLVNKGDPRGTIYD 971

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDD-EVVKADKKHGSDKSLKISS 1049
            L  V NH G L  GHYT+        NVD   SKWYYFDD  V +   + G      I+S
Sbjct: 972  LVAVDNHYGGLGGGHYTAYAK-----NVD--DSKWYYFDDSRVTETTPERG------IAS 1018

Query: 1050 SDAYVLFYER 1059
            S AY+LFY R
Sbjct: 1019 S-AYLLFYVR 1027

 Score = 38.9 bits (89), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 798 KLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           K  +  EK++ L DC+ +F+  EVL   ++W CP C
Sbjct: 871 KRQQEEEKKITLHDCLKLFSKREVLGMNDSWYCPSC 906

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 98/206 (47%), Gaps = 24/206 (11%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            GL NLGNTCY+NS +QCL      R  F    YK+ +            ++N+ + L  
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDNPLGFQG-NIANAFSALVQ 456

Query: 662 KMYLNG---GCSVVPTGFLKVV---NQLRPDLKIPDDQQDTQEFLMILLDRLHDELS--- 712
            +Y N      S  P+ F   +   NQ+         QQD+QEFL  LLD LH++L+   
Sbjct: 457 NLYKNQFIPSASYAPSQFKLTIGHYNQMFSGYF----QQDSQEFLAFLLDGLHEDLNRIK 512

Query: 713 NQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGI----SPIDDIFQGQMENSLQ 768
           ++P+V  + P+L    ADG  V++         + +   +    S I D+F G  +++L+
Sbjct: 513 DKPYV--EKPSL----ADGSDVNDYNIIARLAADTLEAHLKRNDSIIIDLFVGLYKSTLK 566

Query: 769 CKRCGYTTFNYSTFYVLSLAIPRRSM 794
           C  C + +  +  +  L+L IP  S+
Sbjct: 567 CPVCNHVSITFDPYCDLTLPIPVESV 592

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 59/127 (46%), Gaps = 21/127 (16%)

Query: 941  KTINFVTLPKILVIHLSRFYY--DLTKKNNTVITYP-----LILNIILKNNDTMK-YRLF 992
            K I   + P IL IHL RF      + K + V+ +P     L  +I+ K+   +  Y L 
Sbjct: 996  KQIQLWSTPDILTIHLKRFETQGSFSDKIDDVVDFPINGLDLSKHILDKSTSQLNIYDLI 1055

Query: 993  GVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSDA 1052
             V NH G L  GHYT+ + K+L  N      KWYYFDD  V       S       +  A
Sbjct: 1056 AVDNHYGGLGGGHYTAYI-KNLIDN------KWYYFDDSRVSETVPERS------VAGSA 1102

Query: 1053 YVLFYER 1059
            Y+LFY R
Sbjct: 1103 YLLFYMR 1109

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 795 KLSKLGR-PNEKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           K  +LG+   EK + LED +N+F   EVL   ++W CP+C
Sbjct: 949 KTRELGQDKEEKNITLEDSLNLFERAEVLGINDSWYCPKC 988

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 99/207 (47%), Gaps = 15/207 (7%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR--GNRLHSPRLSNSL--NM 658
           GL NLGNTCY+NS +QCL      R  F+ S Y++ L      G + +  +  +SL  N+
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDNLIGYKGYVAKAFSSLVQNL 383

Query: 659 LFDKMYLNG-GCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS---NQ 714
             D +   G   S  P  F   V      +     QQD+QEFL  LLD LH++L+   N+
Sbjct: 384 FGDTITKQGTNSSFGPNHFKSTVGHFNS-MFSGYLQQDSQEFLAFLLDSLHEDLNRIINK 442

Query: 715 PHVANDYPNLLLYD--ADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 772
           P  + + P+L   D   D   + +   + W  K  +    S I D+F G  +++L+C  C
Sbjct: 443 P--STEKPSLKEGDDYNDPAVIKSLADETW--KMHLLRNDSVITDLFVGMYKSTLECPEC 498

Query: 773 GYTTFNYSTFYVLSLAIPRRSMKLSKL 799
              +  +  +  L+L +P  S   SK+
Sbjct: 499 TNVSITFDPYSDLTLPLPVDSTWSSKV 525

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 62/127 (48%), Gaps = 21/127 (16%)

Query: 941  KTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYP---LILNIILKNNDTMK---YRLF 992
            K I     P +L+IHL RF      + K +  + +P   L ++  L + D  +   Y L+
Sbjct: 906  KRIQLWNTPDVLLIHLKRFENQRSFSDKIDATVNFPIENLDMSPYLVHKDDPRGTVYDLY 965

Query: 993  GVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSDA 1052
             V NH G L  GHYT+ V   +++       KWYYFDD  V     + +D    +S S A
Sbjct: 966  AVDNHYGGLGGGHYTAYVKNFIDN-------KWYYFDDSRV-----YETDPEKSVSGS-A 1012

Query: 1053 YVLFYER 1059
            Y+LFY R
Sbjct: 1013 YLLFYLR 1019

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 764 ENSLQCKRCGYT---TFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDE 820
           E SL+  R  ++     N+    VL   +    +K  +    ++K + L DC+N+F+  E
Sbjct: 827 EWSLESSRLAFSEEKVINWENPGVLQ-NVELEELKTQREVDGSDKEITLNDCLNLFSKRE 885

Query: 821 VLSGENAWDCPRC 833
           VL   ++W CP C
Sbjct: 886 VLGLNDSWYCPHC 898

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 72.8 bits (177), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 105/209 (50%), Gaps = 20/209 (9%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYL--QQSRGNR-LHSPRLSNSLNM 658
           TGL NLGN+CY+NS +QCL      +  F+   Y+  +  Q   G + L +   +  +  
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPLGYKGLVAQAFAALIKS 393

Query: 659 LFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS---NQP 715
           LFD+   +   +  P  F  ++ Q +  +     QQD+QEFL  LLD LH++L+    +P
Sbjct: 394 LFDERS-SSAFAFSPREFKSIIGQ-QNSMFAGFLQQDSQEFLAFLLDGLHEDLNRIIEKP 451

Query: 716 HVANDYPNLLLYDADGLKVSNKEYKH-----WFDKNVIGNGISPIDDIFQGQMENSLQCK 770
            V  + P L    +    V+N+E  H      +DK+ + N  S I D+F G  +++L C 
Sbjct: 452 FV--EKPEL----SPDEDVNNREVIHRLASKTWDKHKLRND-SVILDLFVGLYKSTLTCP 504

Query: 771 RCGYTTFNYSTFYVLSLAIPRRSMKLSKL 799
            C  T+  +  +  L+L +P  S+  SK+
Sbjct: 505 VCDKTSVTFDPYSDLTLPLPVESIWTSKV 533

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 59/129 (45%), Gaps = 21/129 (16%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI-LNII--LKNNDTMK---YR 990
              K I     P IL IHL RF   +  + K + V+ +P+  LN+   L   D  +   Y 
Sbjct: 935  ATKQIQLWNSPDILTIHLKRFESRHSFSDKISDVVDFPICGLNMSDHLVCEDAEQNNLYD 994

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
            L  V NH G L  GHYT+     ++        KWYYFDD  V       +D    +S +
Sbjct: 995  LVAVDNHYGGLGGGHYTAFAKNPVD-------GKWYYFDDSRVSE-----TDPETSVSGA 1042

Query: 1051 DAYVLFYER 1059
             AY+LFY R
Sbjct: 1043 -AYLLFYRR 1050

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 804 EKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           E+R+ L DC+ +F+  EVLS  ++W CP C
Sbjct: 900 ERRISLFDCLKLFSKPEVLSAADSWYCPTC 929

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 106/236 (44%), Gaps = 28/236 (11%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQ-QSR-GNR-LHSPRLSNSLN 657
           I G++N GN CY+N +IQCL     F   F+ + Y   +   SR G++ L     +  + 
Sbjct: 343 IKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTINVNSRLGHQGLVVKNWAKIIQ 402

Query: 658 MLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHV 717
             F     N   +V  T F +    L P+      Q D  EF + LL+ +H++ SN    
Sbjct: 403 AFFQVSQENIQPAVSITEFREQWANLFPEYG-KYQQHDCSEFCLRLLEEIHED-SNWGRP 460

Query: 718 ANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTF 777
            N        DA  ++V   +Y+  ++    GN  S I D F+GQ+++ L C+ C   + 
Sbjct: 461 QNS-------DA-AMQVD--DYREAWNLYRKGNS-SYIVDTFKGQIKSQLTCQVCQTQSN 509

Query: 778 NYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           NY  F +L+L IP  SM              + DC+       VL+G++ W C  C
Sbjct: 510 NYEPFSILNLPIPLVSM------------CHIYDCMKELFKVHVLTGDDRWYCSTC 553

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 59/116 (50%), Gaps = 18/116 (15%)

Query: 948  LPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMK----YRLFGVVNHTGTLIS 1003
            +P++L+IH +RF  +L  K    + YP +L++   N    K    Y+L  V  HTGTL S
Sbjct: 568  VPEVLIIHFNRFD-NLLNKKECFVKYPYLLDLSQGNGLLGKCDVPYKLVAVACHTGTLFS 626

Query: 1004 GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSDAYVLFYER 1059
            GHYT+   K+ E+        WY+FDD   K           +  S  AY+LFY++
Sbjct: 627  GHYTAYCFKNSENG-------WYHFDDTQCKPVSNG------ECISQSAYLLFYQK 669

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 98/208 (47%), Gaps = 21/208 (10%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR--GNRLHSPRLSNS 655
           S    GL NLGNTCY+NS +QCL      R  F+ + ++  +  +   G + H  R  + 
Sbjct: 317 STGTIGLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEINVNNPLGFQGHMARSFHG 376

Query: 656 L-NMLFDKMYLNGGCSVVPTGFLKVV---NQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 711
           L   LF          V PT F   +   N +    +    QQD+QEFL  LLD LH++L
Sbjct: 377 LIQSLFGDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQ----QQDSQEFLAFLLDSLHEDL 432

Query: 712 S---NQPHVANDY--PNLLLYDADGL-KVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
           +    +P+V      P   + D D + K++N+ +K    +N      S I DIF G  ++
Sbjct: 433 NRIVEKPYVEKPSLKPGDDINDFDTIKKLANETWKSHLMRN-----DSIITDIFVGMYKS 487

Query: 766 SLQCKRCGYTTFNYSTFYVLSLAIPRRS 793
           +L+C  C   +  +  +  L+L +P  S
Sbjct: 488 TLECPECSNVSITFDPYNDLTLPLPINS 515

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 57/129 (44%), Gaps = 21/129 (16%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPL----ILNIILKNNDTMK--YR 990
              K I     P + +IHL RF      + K +  I +P+    +   ++  +D     Y 
Sbjct: 925  ATKKIELWNTPDVFLIHLKRFENTRSFSDKIDATILFPIEDLDMSEYLVYKDDPRGSVYD 984

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
            L  V NH G +  GHYT+ V    + N       WYYFDD  V    K   +KS+   + 
Sbjct: 985  LIAVDNHYGGMGGGHYTAYVKNLTDQN-------WYYFDDSRV---SKTSPEKSI---AG 1031

Query: 1051 DAYVLFYER 1059
             AY+LFY R
Sbjct: 1032 SAYLLFYLR 1040

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 792 RSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
            S+KL++     E+   L+DC+N+F+  EVL   ++W CP C
Sbjct: 879 ESIKLAESAHV-EQETTLKDCLNLFSKKEVLGMSDSWYCPNC 919

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 103/227 (45%), Gaps = 46/227 (20%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLN 657
           S  ITGL NLGNTCY+NS +QCL      R  F+   + S +  S     +   ++ + +
Sbjct: 298 SQGITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEI-NSDNPLGYQGNIAKAFS 356

Query: 658 MLFDKMY-------------------LNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQE 698
           +L   ++                   + G C+ + +G++               QQD+QE
Sbjct: 357 LLVKSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYM---------------QQDSQE 401

Query: 699 FLMILLDRLHDELS---NQPHVAND--YPNLLLYDADGL-KVSNKEYKHWFDKNVIGNGI 752
           FL  LLD LH++L+   ++P++      PN  + D D + K++   +K    +N      
Sbjct: 402 FLAFLLDGLHEDLNRVHDKPYIEKPSLSPNSDVTDRDTIKKLAEDTWKMHLLRN-----D 456

Query: 753 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKL 799
           S + D+F    E++L+C  C   +  +  +  L+L +P  +   SK+
Sbjct: 457 SIVTDLFVALYESTLECPECRNVSITFDPYNDLTLPLPVNTTWHSKV 503

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 58/128 (45%), Gaps = 22/128 (17%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYP-----LILNIILKNNDTMKYRL 991
              K I   + P +L+IHL RF      + K +  + +P     +  +++ ++     Y L
Sbjct: 902  ATKQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDL 961

Query: 992  FGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSD 1051
              V NH G L  GHYT+ V  +          KW+YFDD  V   K   S     I+ S 
Sbjct: 962  IAVDNHFGGLGGGHYTAYVKTN---------DKWFYFDDSRVTETKPESS-----IAGS- 1006

Query: 1052 AYVLFYER 1059
            AY+LFY R
Sbjct: 1007 AYLLFYLR 1014

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 798 KLGRPNEKR-VKLEDCINMFTSDEVLSGENAWDCPRC 833
           K     EKR + L DC+ +F+  EVLS  ++W CP C
Sbjct: 860 KEAEGQEKRAISLHDCLKLFSKKEVLSMNDSWYCPTC 896

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 107/215 (49%), Gaps = 14/215 (6%)

Query: 593 SNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRL-HSPR 651
           +N   S    GL NLGNTCY+NS +QC+    +FR  F+   ++  + +  GN L +   
Sbjct: 321 NNLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQKEVNE--GNPLGYQGY 378

Query: 652 LSNSLNMLFDKMY---LNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLH 708
           ++ + + L   ++   +    +  P+ F   +      +     QQD+QEFL  LLD LH
Sbjct: 379 MARAFSDLIQSLFGDNITSTTAYSPSYFKSTLGHFN-SMFSGYLQQDSQEFLAFLLDSLH 437

Query: 709 DELS---NQPHVANDYPNL-LLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQME 764
           ++L+    +P+V  + P+L L  + +   V  +     +  +++ N  S I D+F    +
Sbjct: 438 EDLNRIDKKPYV--EKPSLPLTANLNDFDVVKRLADDTWKAHLLRND-SVITDLFVAMYK 494

Query: 765 NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKL 799
           ++L+C  C  T+  +  +  L+L +P  S+  +K+
Sbjct: 495 STLKCPECQNTSVTFDPYNDLTLPLPVASIWHTKV 529

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 56/129 (43%), Gaps = 21/129 (16%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVIT--YPL----ILNIILKNNDTMK--YR 990
              K I     P IL+IHL RF    +  +  V T  +P+    I   ++   D     Y 
Sbjct: 971  ATKQIELWNTPDILLIHLKRFENQRSFSDKIVDTVFFPITDFDISEHLVYKEDPRGNVYD 1030

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
            L  V NH G L  GHYT+          +   +KWYYFDD  V        +KS+   + 
Sbjct: 1031 LIAVDNHYGGLGGGHYTAYAK-------NANDNKWYYFDDSRVSV---TAPEKSI---AG 1077

Query: 1051 DAYVLFYER 1059
             AY+LFY R
Sbjct: 1078 SAYLLFYVR 1086

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 801 RPNEKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           +  E+ + L+DC+ +F+  E+LS  ++W CP C
Sbjct: 933 KQEERHITLDDCLKLFSKPEILSSNDSWYCPHC 965

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 92/200 (46%), Gaps = 22/200 (11%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSY--LQQSRGNRLHSPRLSNSLNMLF 660
           GL NLGNTCY+NS +QCL      R  F+   ++    L    G + H  R   S  +L 
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEINLDNPLGYQGHVAR---SFAILI 399

Query: 661 DKMY---LNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL---SNQ 714
             ++   L    S  PT F   V      +     QQD+QEF+  LLD LH++L   +N+
Sbjct: 400 QNLFKDELLPSLSYSPTTFKSTVGHFNS-MFSGYLQQDSQEFIAFLLDGLHEDLNRITNK 458

Query: 715 PHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGI----SPIDDIFQGQMENSLQCK 770
           P V  + P+L   D     VSN+E       +   + +    S I DIF G  +++L C 
Sbjct: 459 PVV--EKPSLKPED----DVSNQEVIKKLADDTWNSHLLRNDSIITDIFVGLYKSTLHCP 512

Query: 771 RCGYTTFNYSTFYVLSLAIP 790
            C   +  +  +  L+L +P
Sbjct: 513 ECDNLSVTFDPYNDLTLPLP 532

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 61/132 (46%), Gaps = 21/132 (15%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI---LNIILKNNDTMK---YR 990
              K +   + P IL+IHL RF      + K +  + +P+    L+  + NND  K   Y 
Sbjct: 941  ATKQLQLWSTPDILLIHLKRFENQSSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYD 1000

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
            L  V NH G L  GHYT+ V   ++        KWYYFDD  V       S     I+ S
Sbjct: 1001 LVSVDNHYGGLGGGHYTAYVKNFVDK-------KWYYFDDSRVTETVPERS-----IAGS 1048

Query: 1051 DAYVLFYERVHD 1062
             AY+LFY R  D
Sbjct: 1049 -AYLLFYMRRSD 1059

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 804 EKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           EK++ L+DC+N+F   EVL   ++W CP C
Sbjct: 906 EKKITLDDCLNLFAKKEVLGMNDSWYCPTC 935

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 99/210 (47%), Gaps = 20/210 (9%)

Query: 593 SNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQ-SRGNRL-HSP 650
           +N      I GL NLGNTCY+NS +QCL      R  F    Y  Y Q+ +  N L ++ 
Sbjct: 280 NNPMTMTGIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFF---YGGYEQEINLDNPLGYNG 336

Query: 651 RLSNSLNMLFDKMY-----LNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLD 705
            ++ +   L   +Y          S  P  F   + Q    +     QQD+QEFL  LLD
Sbjct: 337 TVATAFGNLIQNLYSYHWNQQQYQSYSPNRFKMTLGQAN-SMFAGYMQQDSQEFLAFLLD 395

Query: 706 RLHDELS---NQPHVANDYPNLLLYD--ADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQ 760
            LH++L+   ++P++  + P L   +  AD   V     K W D ++  N  S I+D+F 
Sbjct: 396 SLHEDLNRIHDKPYI--EKPTLETSEELADENAVKQLAKKTW-DAHLARND-SVINDLFV 451

Query: 761 GQMENSLQCKRCGYTTFNYSTFYVLSLAIP 790
           G  +++L+C  C   +  +  +  L+L +P
Sbjct: 452 GMYKSTLKCPTCKNISITFDPYNDLTLPLP 481

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 67/129 (51%), Gaps = 25/129 (19%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPL--------ILNIILKNNDTMK 988
              K +     P+IL+IHL RF      + K + V+ +P+        +++ +++  D   
Sbjct: 877  ATKQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFPIEGLDMTPYVVDSVVE--DGCI 934

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKIS 1048
            Y LF V NH G L  GHYTS V    ++N+D   ++WYYFDD  V +     +D    ++
Sbjct: 935  YDLFAVDNHYGGLGGGHYTSYV----KNNID---NRWYYFDDSRVSS-----TDPKKSVA 982

Query: 1049 SSDAYVLFY 1057
             S AY+LFY
Sbjct: 983  GS-AYLLFY 990

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 807 VKLEDCINMFTSDEVLSGENAWDCPRC 833
           + L+ C+ +F+  EVL   ++W CP+C
Sbjct: 845 ITLDSCLKLFSKPEVLGINDSWYCPKC 871

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 65.9 bits (159), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 94/203 (46%), Gaps = 23/203 (11%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
           TGL NLGNTCY+NS +QCL      R  F+ + Y+S + +      H   ++ + + L  
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEENPLGYHG-YVARAFSDLVQ 422

Query: 662 KMYLNGGCSVV------PTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS--- 712
           K++ N   S+       P+ F   V      +     QQD+QEFL  LLD LH++L+   
Sbjct: 423 KLFHNKLSSMQRNAAFPPSMFKSTVGHFN-SMFSGYMQQDSQEFLAFLLDSLHEDLNRII 481

Query: 713 -----NQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSL 767
                 +P ++ D       D +   V  K     ++ ++  N  S I D+F G  +++L
Sbjct: 482 KKAYIEKPSLSPD------DDVNDWNVVKKLADDTWEMHLKRN-CSVITDLFVGLYKSTL 534

Query: 768 QCKRCGYTTFNYSTFYVLSLAIP 790
            C  C   +  +  +  ++L +P
Sbjct: 535 YCPECKNVSITFDPYNDVTLPLP 557

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 59/129 (45%), Gaps = 21/129 (16%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLIL-----NIILKNNDTMK-YR 990
              K I     P IL++HL RF      + K +  + +P+       +++ K++     Y 
Sbjct: 996  ATKQIQLWNTPDILLVHLKRFESQRSFSDKIDATVNFPVTALDLSKHVVHKDDPRGSIYD 1055

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
            L+ V NH G L  GHYT+ V        +   SKWYYFDD  V       S     IS S
Sbjct: 1056 LYAVDNHYGGLGGGHYTAYVK-------NFADSKWYYFDDSRVTETVPENS-----ISGS 1103

Query: 1051 DAYVLFYER 1059
             AY+LFY R
Sbjct: 1104 -AYLLFYIR 1111

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 748 IGNGISPIDDIFQGQMENSLQCKR-CGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPN--E 804
           I + I  IDDI   + E S   +       FN+         +P   ++ +KL R N  E
Sbjct: 906 ISHEILSIDDILVCEWEESGSNEAFSNDKIFNWEN----PAPLPNIELENAKLERSNAKE 961

Query: 805 KRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           + + L+DC+ +F+  E+L   ++W CP C
Sbjct: 962 RIITLDDCLQLFSKPEILGLNDSWYCPTC 990

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 65.5 bits (158), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 88/206 (42%), Gaps = 30/206 (14%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQ--------SRGNRLHSPRL 652
           I GL NLGNTCY+NS +QCL         F+   YK Y ++         +G+  H+   
Sbjct: 338 IMGLSNLGNTCYMNSALQCLLHIPELNEYFL---YKGYEREININNPLGHKGDVAHA--F 392

Query: 653 SNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 712
            + L  LF   Y        P  F   +      L     QQD+QEFL  LLD LH++L+
Sbjct: 393 GHLLYSLFAPSY-GQSTFYAPRNFKNTIGHYN-SLFAGYGQQDSQEFLAFLLDGLHEDLN 450

Query: 713 --------NQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQME 764
                   N+P   ND     + D D + +       +  K       S I D+F G  +
Sbjct: 451 RVIEKPYVNKPEFPNDGQ---IDDTDQIVLLAANMWDYIKK----RNDSVIMDLFVGLYK 503

Query: 765 NSLQCKRCGYTTFNYSTFYVLSLAIP 790
           ++L C  C + +  +  +  L+L +P
Sbjct: 504 STLVCPNCNHVSITFDPYNDLTLPLP 529

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 56/127 (44%), Gaps = 21/127 (16%)

Query: 941  KTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYP---LILNIIL---KNNDTMKYRLF 992
            K I     P IL+IHL RF      + K +  + +P   L ++  L   K  +   Y L 
Sbjct: 936  KQIELWNTPDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDVYDLI 995

Query: 993  GVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSDA 1052
             V NH G L  GHYT+     ++        KWYYFDD  V       S     I+ S A
Sbjct: 996  AVDNHYGGLGGGHYTAYCRNFID-------GKWYYFDDSRVNEVSPENS-----IAGS-A 1042

Query: 1053 YVLFYER 1059
            Y+LFY R
Sbjct: 1043 YLLFYRR 1049

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 807 VKLEDCINMFTSDEVLSGENAWDCPRC 833
           + L+ C+ +F+  E+L   ++W CP C
Sbjct: 902 ITLDSCLRLFSQPEILGSADSWYCPNC 928

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 93/199 (46%), Gaps = 15/199 (7%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
           TGL NLGNTCY+NS +QCL      R  F+   Y++ + +      H   ++ + + L  
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEENPLGYHG-YVARAFSDLIQ 422

Query: 662 KMYLN------GGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQP 715
           K++ N         +  P+ F   V      +     QQD+QEFL  LLD LH++L+   
Sbjct: 423 KIFQNRLSVMQRNGAFPPSMFKSTVGHFN-SMFSGYMQQDSQEFLAFLLDSLHEDLNR-- 479

Query: 716 HVANDY---PNLLLY-DADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKR 771
            +  +Y   P+L    D D   V  K     ++ ++  N  S I D+F G  +++L C  
Sbjct: 480 IIKKEYIEKPSLSPGDDVDDWNVVKKLADDTWEMHLKRN-CSVITDLFVGMYKSTLYCPE 538

Query: 772 CGYTTFNYSTFYVLSLAIP 790
           C   +  +  +  ++L +P
Sbjct: 539 CKNVSITFDPYNDVTLPLP 557

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 59/129 (45%), Gaps = 21/129 (16%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYP-----LILNIILKNNDTMK-YR 990
              K I     P IL+IHL RF      + K +  + +P     L  N++ K++     Y 
Sbjct: 990  ATKQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSKNVVYKDDPRGSIYD 1049

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
            L+ V NH G L  GHYT+ V        +   +KWYYFDD  V       S     I+ S
Sbjct: 1050 LYAVDNHYGGLGGGHYTAYVK-------NFANNKWYYFDDSRVTETVPENS-----IAGS 1097

Query: 1051 DAYVLFYER 1059
             AY+LFY R
Sbjct: 1098 -AYLLFYIR 1105

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 789 IPRRSMKLSKLGRPN--EKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           +P   ++  K  R N  E+ + L+DC+ +F+  E+L   ++W CP C
Sbjct: 938 LPNTELENIKSERSNAKERTITLDDCLQLFSKPEILGLSDSWYCPTC 984

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 98/207 (47%), Gaps = 14/207 (6%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRL-HSPRLSNSLNML 659
           I GL NLGN+CY+NS +QCL      R  F+   ++  +  S  N L +  +++ +   L
Sbjct: 297 IVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTS--NPLGYQGQIAQAFAAL 354

Query: 660 FDKMYLNGGCSV---VPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS---N 713
              ++ +   ++    P  F  ++      +     QQD+QE L  LLD LH++L+    
Sbjct: 355 VKSLFDDKASALQAFSPRAFKSIIGH-HNGMFAGFLQQDSQELLAFLLDGLHEDLNRIMK 413

Query: 714 QPHVANDYPNLLLY-DADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 772
           +P V  + P L    D + + V        ++K+ + N  S I D+F G  +++L C  C
Sbjct: 414 KPFV--EKPELASSDDVNDIDVIRNLASLTWEKHKLRNE-SVIVDLFVGLYKSTLTCPAC 470

Query: 773 GYTTFNYSTFYVLSLAIPRRSMKLSKL 799
              +  +  F  L+L +P  S   +K+
Sbjct: 471 DRVSVTFDPFSDLTLPLPVESFWSAKV 497

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 57/130 (43%), Gaps = 23/130 (17%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI-------LNIILKNNDTMKY 989
              K I     P IL IHL RF   +  + K + V+ +P+        L     N ++M Y
Sbjct: 904  ATKQIQLWNTPDILTIHLKRFENRHSFSDKISDVVDFPITGLDMSEHLVCHDPNQNSM-Y 962

Query: 990  RLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISS 1049
             L  V NH G L  GHYT+ V   ++        KWYYFDD  V   +        +  S
Sbjct: 963  DLIAVDNHYGGLGGGHYTAYVKNFMD-------GKWYYFDDSRVSETEAE------RAIS 1009

Query: 1050 SDAYVLFYER 1059
              AY+LFY R
Sbjct: 1010 GAAYLLFYRR 1019

 Score = 36.2 bits (82), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 807 VKLEDCINMFTSDEVLSGENAWDCPRC 833
           + L DC+ +F+  EVL   ++W CP C
Sbjct: 872 ISLTDCLELFSKSEVLGAADSWYCPNC 898

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 94/204 (46%), Gaps = 25/204 (12%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
           TGL NLGNTCY+NS +QCL      R  F+   Y+  + +      H   ++ + + L  
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLGYHG-YVARAFSDLVQ 422

Query: 662 KMYLN------GGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL---- 711
           K++ N         +  P+ F   +      +     QQD+QEFL  LLD LH++L    
Sbjct: 423 KLFQNRMSIMQRNAAFPPSMFKSTIGHFNS-MFSGYMQQDSQEFLAFLLDSLHEDLNRII 481

Query: 712 ----SNQPHVANDYPNLLLYDADGL-KVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENS 766
               + +P ++   P   + D + + K+++  ++    +N      S I D+F G  +++
Sbjct: 482 KKEYTEKPSLS---PGDDVNDWNVVKKLADDTWEMHLKRNC-----SVITDLFVGMYKST 533

Query: 767 LQCKRCGYTTFNYSTFYVLSLAIP 790
           L C  C   +  +  +  ++L +P
Sbjct: 534 LYCPECQNVSITFDPYNDVTLPLP 557

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 60/131 (45%), Gaps = 21/131 (16%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPL----ILNIILKNND--TMKYR 990
              K I     P IL+IHL RF      + K +  + +P+    +   ++  +D   + Y 
Sbjct: 994  ATKQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSRYVVYKDDPRGLIYD 1053

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
            L+ V NH G L  GHYT+ V        +   +KWYYFDD  V       S     I+ S
Sbjct: 1054 LYAVDNHYGGLGGGHYTAYVK-------NFADNKWYYFDDSRVTETAPENS-----IAGS 1101

Query: 1051 DAYVLFYERVH 1061
             AY+LFY R H
Sbjct: 1102 -AYLLFYIRRH 1111

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 788 AIPRRSMKLSKLGRPN--EKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
            +P + ++ +KL R N  E+ + L+DC+ +F+  E+L   ++W CP C
Sbjct: 941 TLPNKELENAKLERSNAKERTITLDDCLQLFSKPEILGLTDSWYCPTC 988

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 99/220 (45%), Gaps = 16/220 (7%)

Query: 592 SSNAYVSLSIT------GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR-- 643
           +SN Y+   +T      GL NLGNTCY+NS +QCL     F+  F+ + Y+  +      
Sbjct: 333 ASNYYIYNQMTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEINVDNPL 392

Query: 644 GNRLH-SPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMI 702
           G++ H +      +  LF K   N   S  P  F   +  L   +     QQD+QEFL  
Sbjct: 393 GHKGHIAWAFGTLIQSLFGKRN-NLISSYSPRHFKTTIGHLN-SMFAGYQQQDSQEFLAF 450

Query: 703 LLDRLHDELS---NQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIF 759
           LLD LH++L+   ++P+V     N      +   +       W    +  + +  I D+F
Sbjct: 451 LLDGLHEDLNRIVDKPYVEKPELNPTDDVTEFETIKKLADDTWLKHKLRNDSV--ILDLF 508

Query: 760 QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKL 799
            G  +++L C  C   +  +  +  L+L +P  S   +K+
Sbjct: 509 VGLYKSTLICPTCKKVSTTFDPYNDLTLPLPVDSTWSNKV 548

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 58/129 (44%), Gaps = 21/129 (16%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI---LNIILKNNDTMK---YR 990
              K I     P IL+IHL RF      + K   ++ +P+    ++  L   D  K   Y 
Sbjct: 969  ATKQIELWNTPDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKDDKKGTIYD 1028

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
            L  V NH G L  GHYT+ V   L++       KWYYFDD  V       S     I+ S
Sbjct: 1029 LIAVDNHYGGLGGGHYTAYVKNFLDN-------KWYYFDDSRVNETVPERS-----IAGS 1076

Query: 1051 DAYVLFYER 1059
             AY+LFY R
Sbjct: 1077 -AYLLFYRR 1084

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 44/89 (49%), Gaps = 10/89 (11%)

Query: 755 IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSL--------AIPRRSMKLSKLGR--PNE 804
           ++DI + ++  +     C + + +Y   +  SL         +P   ++ SK  R    E
Sbjct: 875 LNDIPREKLIKAQNAIICEWNSKSYDEVFNSSLKVNWDSPGEVPNTELEASKRERNAQEE 934

Query: 805 KRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           K++ L DC+ +F++ EVL   ++W CP C
Sbjct: 935 KKITLHDCLTLFSTPEVLGATDSWYCPSC 963

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 92/203 (45%), Gaps = 23/203 (11%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
           TGL NLGNTCY+NS +QCL      R  F+ + Y+  + +      H   ++ + + L  
Sbjct: 361 TGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENPLGYHG-YVARAFSDLIQ 419

Query: 662 KMYLNG------GCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS--- 712
           K++ N         +  PT F   +      +     QQD+QEFL  LLD LH++L+   
Sbjct: 420 KLFQNKLNIMQRNGAFPPTMFKSTIGHFNS-MFSGYMQQDSQEFLAFLLDSLHEDLNRII 478

Query: 713 -----NQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSL 767
                 +P ++ D       D +   V  K     ++ ++  N  S I D+F G  +++L
Sbjct: 479 KKAYIEKPSLSPD------DDVNDWNVIKKLADDTWELHLKRNR-SVITDLFVGMYKSTL 531

Query: 768 QCKRCGYTTFNYSTFYVLSLAIP 790
            C  C   +  +  +  ++L +P
Sbjct: 532 YCPECKDVSTTFDPYNDVTLPLP 554

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 58/129 (44%), Gaps = 21/129 (16%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYP-----LILNIILKNNDTMK-YR 990
              K I     P IL+IHL RF      + K +  + +P     L  +++ K++     Y 
Sbjct: 993  ATKQIQLWNTPDILLIHLKRFESQRSFSDKIDDTVNFPITDLDLSEHVVYKDDPRGSIYD 1052

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
            L+ V NH G L  GHYT+ V   +++       KWYYFDD  V       S       + 
Sbjct: 1053 LYAVDNHYGGLGGGHYTAYVKNFMDN-------KWYYFDDSRVTETVPENS------VAG 1099

Query: 1051 DAYVLFYER 1059
             AY+LFY R
Sbjct: 1100 SAYLLFYIR 1108

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 789 IPRRSMKLSKLGRPN--EKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           +P   ++  KL R N  E+ + L DC+ +F+  E+L   ++W CP C
Sbjct: 941 LPNTELEKVKLERCNAKERTITLNDCLQLFSKPEILGLNDSWYCPTC 987

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 67/131 (51%), Gaps = 17/131 (12%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLIL--NIILKNNDTMKYRLFGV 994
            + +    LP  L++HL RF Y   + +N    + + YPLIL  N   K  DT+KY L G+
Sbjct: 511  RAVELKKLPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGI 570

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSL--KISSSD 1051
            V H G     GHY +L   +        +  W ++DDE V++  +    K +  + + S 
Sbjct: 571  VIHVGDGPQMGHYVALCKTE--------KYGWLFYDDETVESVSEETVLKFIGDEKTQST 622

Query: 1052 AYVLFYERVHD 1062
            AYVLFY+++ D
Sbjct: 623  AYVLFYKKLGD 633

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSP 650
           + G  N GNTCY NS++QCL+    FR   +    ++ + Q R  +L  P
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNLPEFRLNILQYPERNLMDQ-RVRKLEMP 173

 Score = 35.8 bits (81), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 12/79 (15%)

Query: 755 IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCIN 814
           I++IFQG + N ++C  C   T     F  L + +          G  + +RV     + 
Sbjct: 437 INEIFQGTLTNKVRCLTCDNVTSREEAFLDLPIEVKEN-------GDTDIQRV-----LK 484

Query: 815 MFTSDEVLSGENAWDCPRC 833
            ++  E+L+G N ++C +C
Sbjct: 485 YYSQREMLNGSNKFNCSQC 503

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 106/232 (45%), Gaps = 25/232 (10%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQS-----RGNRLHSPRL 652
           S    GL NLGNTCY+NS +QCL     F   F+ + Y+  +        +GN  ++   
Sbjct: 410 STGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANA--F 467

Query: 653 SNSLNMLFDKMYLNGGC--------SVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILL 704
              ++ LF++  ++           S  PT F   V      +     QQD+QEFL  +L
Sbjct: 468 GKLIHKLFEERIIDNESEKSSFSINSFSPTNFKSTVGYCNS-MFSGYLQQDSQEFLAFIL 526

Query: 705 DRLHDELS---NQPHVANDYPNLLL-YDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQ 760
           D LH++L+    +P V  + P+L    +    KV  K     ++ ++  N  S + D+F 
Sbjct: 527 DGLHEDLNRILKKPFV--EKPSLPENSNYKDYKVIKKLADDTWEAHLKRND-SIVTDLFV 583

Query: 761 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSM--KLSKLGRPNEKRVKLE 810
           G  +++LQC  C   +  +  +  L+L +P  ++  K+ K+   N     LE
Sbjct: 584 GMYKSTLQCPDCHNVSVTFDPYNDLTLPLPVETIWNKVIKIFPSNSPPCSLE 635

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 59/129 (45%), Gaps = 21/129 (16%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYP-----LILNIILKNNDTMK-YR 990
              K I     P IL+IHL RF      + K + V+ +P     L  +I+  + +    Y 
Sbjct: 1102 ATKQIELWNTPDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYD 1161

Query: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
            L  V NH G L  GHYT+ V   ++        KWYYFDD  V       +D    IS S
Sbjct: 1162 LIAVDNHYGGLGGGHYTAYVKNFVDQ-------KWYYFDDSRVSL-----ADPQRSISGS 1209

Query: 1051 DAYVLFYER 1059
             AY+LFY R
Sbjct: 1210 -AYLLFYVR 1217

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 21/30 (70%)

Query: 804  EKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
            EK + L+DC+ +F+  E+L  +++W CP C
Sbjct: 1067 EKTILLDDCLRLFSKPEILGLQDSWYCPTC 1096

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 90/208 (43%), Gaps = 20/208 (9%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLN 657
           S    GL NLG+TC+INS++QCL      R  F+ + + + L  +R +  +  R++ +  
Sbjct: 347 SSGTMGLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAEL-NTRNSLGYGGRVAGAFA 405

Query: 658 MLFDKMYLNGGC---SVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 714
            +   ++ +      +   + F   +   RP L  P  QQD+ E +  LL  LH++L+  
Sbjct: 406 EVVQALFGDKIAQFPTYAASNFRATIGYFRPALG-PYVQQDSHEVVAFLLGALHEDLNRA 464

Query: 715 PH---VANDYPNLLLYDADGLKVSNKEYKH--------WFDKNVIGNGISPIDDIFQGQM 763
           P    V     +  +  + G     +            W    +  + +  I D+F G +
Sbjct: 465 PEGPRVGQAGESTGVGASVGASAGTRNRGRGERLAADTWSRYKLQNDSV--ITDLFAGML 522

Query: 764 ENSLQCKRC--GYTTFNYSTFYVLSLAI 789
           +++L C  C     TF+  T   + LA+
Sbjct: 523 KSTLTCLTCRRSSVTFDPCTELAVPLAV 550

 Score = 56.6 bits (135), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 59/139 (42%), Gaps = 32/139 (23%)

Query: 939  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI---------------LNIIL 981
              + I   + P+IL++HL RF  +Y  T K N  + +PL                     
Sbjct: 965  ATRQIELWSTPEILLVHLKRFESHYSSTGKLNNTVHFPLTGLDMSPHLPCRDGDGDGDGD 1024

Query: 982  KNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDD-EVVKADKKHG 1040
                   Y L  V NH G L SGHYT+ V   ++        KWY FDD EV + D +  
Sbjct: 1025 DGGRENVYDLIAVDNHFGGLGSGHYTAYVKNPVD-------DKWYLFDDSEVREVDAE-- 1075

Query: 1041 SDKSLKISSSDAYVLFYER 1059
                  ++SS  Y+LFY R
Sbjct: 1076 -----SVASSFGYLLFYRR 1089

 Score = 40.0 bits (92), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 798 KLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           + GR  ++   LEDC+++FT+ EVL+  ++W CP C
Sbjct: 925 RAGR-QKQETTLEDCLDLFTAPEVLNTADSWYCPAC 959

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 65/133 (48%), Gaps = 25/133 (18%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNNT----VITYPLILNI--ILKNNDTMKYRLFGV 994
            + +   +LPK L +HL RF Y   K  N      I YPLILN      ++ +  YRL GV
Sbjct: 557  RLVGLKSLPKTLSLHLKRFKYSEEKNANVKLFNKIHYPLILNASSTFDSSVSKSYRLQGV 616

Query: 995  VNHTGTLI-SGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKA-DKKH-----GSDKSLKI 1047
            V H G     GHY SL + +L      G   W  FDDE V++ D+ +     GS +    
Sbjct: 617  VVHMGNGPHHGHYVSLCHTEL-----FG---WLLFDDETVESVDESYVLDFVGSHE---- 664

Query: 1048 SSSDAYVLFYERV 1060
            S + AYVLFY  +
Sbjct: 665  SPTTAYVLFYSEI 677

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           + G  N GNTCY NS++QCL+    FR
Sbjct: 160 VFGYENFGNTCYCNSVLQCLYHLPEFR 186

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 65/133 (48%), Gaps = 23/133 (17%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNNTV-----ITYPLILNIILKNNDTM--KYRLFG 993
            + +    LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY+L G
Sbjct: 551  RLVGLKQLPDTLALHLKRFKYS-EKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAG 609

Query: 994  VVNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHG----SDKSLKIS 1048
            +V H G     GHY SL   +        +  W  FDDE V+A K+      + +S  ++
Sbjct: 610  IVVHMGGGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTGESPNMA 661

Query: 1049 SSDAYVLFYERVH 1061
            +  AYVLFY+ +H
Sbjct: 662  T--AYVLFYKAMH 672

 Score = 36.2 bits (82), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 586 IPTIEQSSNAYVSLS--ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           + TI   S  Y   S  + G  N GNTCY NS++QCL+     R
Sbjct: 123 LATIASESMPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLSSLR 166

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 61/129 (47%), Gaps = 17/129 (13%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNII--LKNNDTMKYRLFGV 994
            +++    LP  L +HL RF Y  TK +N      + YPL L++     N+   KY L G+
Sbjct: 604  RSVGLKQLPHTLALHLKRFKYSETKNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSGI 663

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISS--SD 1051
            V H G     GHY SL   D     + G   W  FDDE V++  +      +  SS  + 
Sbjct: 664  VVHMGGGPQHGHYVSLCKND-----NFG---WLLFDDETVESVSEKTVLDFVGDSSTLTT 715

Query: 1052 AYVLFYERV 1060
            AYVLFY  +
Sbjct: 716  AYVLFYREL 724

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 51/140 (36%), Gaps = 38/140 (27%)

Query: 694 QDTQEFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGIS 753
           QD  EFL  LL+ L D L+N                 G K    + +H  +         
Sbjct: 495 QDAHEFLNFLLNELSDYLNN-----------------GAKSGKDDEEHSLNF-------- 529

Query: 754 PIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCI 813
            I DIFQG + N ++C  C   T     F    + +            P++    ++  +
Sbjct: 530 -IKDIFQGTLTNRVKCFTCDNITSRDEPFLDFPIEV------------PDDSETDIQALL 576

Query: 814 NMFTSDEVLSGENAWDCPRC 833
             F   E+LSG N + C  C
Sbjct: 577 QNFDQREMLSGPNKFYCNVC 596

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           + G  N GNTCY NS++QCL+    FR
Sbjct: 130 VFGFENFGNTCYCNSVLQCLYNMTEFR 156

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 91/244 (37%), Gaps = 61/244 (25%)

Query: 600 SITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNML 659
            + GL N+G+TC+++S+IQ +     F    +S K+ +      G +  S  L       
Sbjct: 131 GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSGTKCVSCALDEIACDF 190

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRPDLKI-----PDDQQDTQEFLMILLDRLHDELSNQ 714
           +      G  S V  GF   VN L     I        QQD  E+   LL++LH +    
Sbjct: 191 YGNGPGTGKSSSVSKGF---VNLLSASWHINHHLVGSSQQDAHEYWQFLLNQLHTD---- 243

Query: 715 PHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISP-----IDDIFQGQMENSLQC 769
                                           V G+  +P        IFQG ++N+LQC
Sbjct: 244 -----------------------------HARVFGSSKAPDCQCITHRIFQGYLKNTLQC 274

Query: 770 KRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWD 829
            +CG++         LSL I                  KLEDC++ F  +E L+ +  ++
Sbjct: 275 SQCGFSKTTIDPIMDLSLEIKNNP--------------KLEDCLDHFQREETLT-DFHYE 319

Query: 830 CPRC 833
           C  C
Sbjct: 320 CQSC 323

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 61/129 (47%), Gaps = 24/129 (18%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNI---ILKNND----TMK 988
             VK +     P +LVI L RF + L   + K N  + +PL LN+   + +  D     + 
Sbjct: 329  VVKQLTLHKAPNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIA 388

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKIS 1048
            Y L  VV+H GT+  GHYT++   +          +W+ F+D VV +  +       ++ 
Sbjct: 389  YDLLNVVSHQGTVDQGHYTTVSKTE--------DGQWFKFNDSVVTSVTEE------QVL 434

Query: 1049 SSDAYVLFY 1057
               AY+LFY
Sbjct: 435  EQQAYLLFY 443

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 63/135 (46%), Gaps = 25/135 (18%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTMK--YRLFGV 994
            + +    LP IL +HL RF Y   K  N      + YPL LN+    + +++  Y L GV
Sbjct: 638  RIVGLKQLPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGV 697

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSD-- 1051
            V H G+    GHY SL   D        +  W  FDDE V++     S+ ++   + D  
Sbjct: 698  VIHMGSSPQHGHYVSLCKND--------KFGWLLFDDETVES----VSESTVLEFTGDPN 745

Query: 1052 ----AYVLFYERVHD 1062
                AYVLFY+ + D
Sbjct: 746  NQATAYVLFYKEIKD 760

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 77/196 (39%), Gaps = 61/196 (31%)

Query: 645 NRLHSPRLSNSLNMLFDKM----YLNGGCSVVPTGFLKVV---NQLRPDLKIPDDQQDTQ 697
           N+     L NSL  +F+ +    YL G   V PT F+K++   N L   +     QQD+ 
Sbjct: 489 NQYEKANLYNSLKDIFESITENRYLTG--IVAPTEFVKILKKENVLFNSMM----QQDSH 542

Query: 698 EFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDD 757
           EFL  LL+ L D L   P   N++                                 I +
Sbjct: 543 EFLNFLLNELRDYL---PSTTNNF---------------------------------ITN 566

Query: 758 IFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFT 817
           +FQG + N ++C  C   T     F    L  P        +G  +++   +E  +  + 
Sbjct: 567 LFQGILTNQIKCLTCDNITSRDEPF----LDFP--------IGVKDDEETNIETLLRNYH 614

Query: 818 SDEVLSGENAWDCPRC 833
           + E+L+G N + C +C
Sbjct: 615 TREMLNGSNKFYCNQC 630

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           + G  N GNTCY NS++QCL+    FR
Sbjct: 171 VFGYENFGNTCYCNSVLQCLYNLYEFR 197

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 64/131 (48%), Gaps = 17/131 (12%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 994
            + +    LP+IL +HL RF Y   +  N      ITYPL L +  K + ++  KY L GV
Sbjct: 541  RVVGLKKLPRILALHLKRFKYSEAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGV 600

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKA--DKKHGSDKSLKISSSD 1051
            V H G     GHY S+   D     + G   W +FDDE V+   + +  +      +S+ 
Sbjct: 601  VLHMGGGPQHGHYVSVCKTD-----NFG---WLFFDDETVETLDEPQVLNFTGDTTTSTT 652

Query: 1052 AYVLFYERVHD 1062
            AYVLFY+   +
Sbjct: 653  AYVLFYKETDE 663

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 18/27 (66%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           I G  N GNTCY NS++QCLF    FR
Sbjct: 113 IFGYENFGNTCYCNSILQCLFNLTEFR 139

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
            YBL067C (REAL)
          Length = 745

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 62/132 (46%), Gaps = 23/132 (17%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNNTV-----ITYPLILNIILKNNDTM--KYRLFG 993
            + +    LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY L G
Sbjct: 548  RLVGLKQLPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAG 606

Query: 994  VVNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHG----SDKSLKIS 1048
            +V H G     GHY SL            +  W  FDDE V+A K+      + +S  ++
Sbjct: 607  IVVHMGGGPQHGHYVSLCKHQ--------KFGWLLFDDETVEAVKEETVLEFTGESANMA 658

Query: 1049 SSDAYVLFYERV 1060
            +  AYVLFY+ V
Sbjct: 659  T--AYVLFYKAV 668

 Score = 35.8 bits (81), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           + G  N GNTCY NS++QCL+     R
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLR 165

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 59/135 (43%), Gaps = 25/135 (18%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 994
            +T+    LP  L +HL RF Y      N      I YPL LN+      ++  KY+L G+
Sbjct: 618  RTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGI 677

Query: 995  VNHTGTL-ISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKH------GSDKSLKI 1047
            V H G+    GHY ++   D        +  W  FDDE      +       G +K    
Sbjct: 678  VVHMGSSPQQGHYVAICKTD--------KYGWLLFDDETASWINEEEVLSFIGDEK---- 725

Query: 1048 SSSDAYVLFYERVHD 1062
            S + AYVLFYE V D
Sbjct: 726  SQNTAYVLFYEEVKD 740

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKS 637
           I G  N GNTCY NS++QCL+    F+   + +  +S
Sbjct: 154 IFGYENFGNTCYCNSVLQCLYHLDDFKLNLLKTSLRS 190

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 79/193 (40%), Gaps = 45/193 (23%)

Query: 602 TGLRNLGNTCYINSMIQCLF--AAKVFRTLFISSKY-KSYLQQSRGNRLHSPRLSNSLNM 658
            GL NLGN+CY+NS++QCLF    K +    +   + +  L  +   +    +L+N++  
Sbjct: 323 CGLINLGNSCYLNSVLQCLFNGGVKGWSLKGLGQDFPQDVLYPTNNFKCQLIKLNNAMK- 381

Query: 659 LFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVA 718
           +  + Y  G   + P  F K V Q   +      QQD+ EFL  L+D L           
Sbjct: 382 VEPQNYPEG---IRPKSFKKCVGQSHEEFS-SGRQQDSMEFLGYLVDVL----------- 426

Query: 719 NDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 778
                                    DK +  NG +P +D+ +  ME+ LQC  CG   ++
Sbjct: 427 -------------------------DKKIFKNGSNP-NDLMKFTMEDRLQCTNCGKVKYS 460

Query: 779 YSTFYVLSLAIPR 791
                 L L +P 
Sbjct: 461 SEAAESLQLPMPE 473

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 63/122 (51%), Gaps = 22/122 (18%)

Query: 941  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIILKNNDTMK- 988
            K + F + PK+L + L RF YD     L K N+      ++   P +   +LKN +  + 
Sbjct: 386  KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETES 445

Query: 989  --YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKADKKHGSDKSL 1045
              Y+L GV+ HTG + +GHY +++  DL         +WY FDDE V K D+K   D++ 
Sbjct: 446  HIYKLHGVLVHTGDISTGHYYTMIKPDL-------GDQWYRFDDERVWKVDRKQVFDENF 498

Query: 1046 KI 1047
             +
Sbjct: 499  GL 500

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 87/233 (37%), Gaps = 61/233 (26%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            G RN G TCY+NS++Q  F  K FR L     Y+    + + N        +S+ +   
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLV----YEIPTDEEKPN--------DSVPLALQ 256

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDY 721
           + +     S +P   L++      D      Q D QE   IL+DRL   +          
Sbjct: 257 RAFYQLQVSNLPLDTLELTRSFGWDSADAFTQHDVQELNRILMDRLETRMK--------- 307

Query: 722 PNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                    G KV  K                 + ++F G+M++ ++CK   Y +     
Sbjct: 308 ---------GTKVEGK-----------------LSELFVGKMKSYIKCKNVDYESSRVEE 341

Query: 782 FYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 834
           F+ + L +      L  L +  E  +++          E++ GEN +  P  G
Sbjct: 342 FWDIQLNVK----DLKNLQQSFENYIEV----------ELMDGENQYAAPDFG 380

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
            YBL067C (REAL)
          Length = 748

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 63/130 (48%), Gaps = 23/130 (17%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNNTV-----ITYPLILNIILKNNDTM--KYRLFG 993
            + +    LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY L G
Sbjct: 550  RLVGLKQLPDTLALHLKRFKYS-EKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSG 608

Query: 994  VVNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHG----SDKSLKIS 1048
            +V H G     GHY SL   ++      G   W  FDDE V+A K+      + +S  ++
Sbjct: 609  IVVHMGGGPQHGHYVSLCKHEI-----FG---WLLFDDETVEAVKEEAVLEFTGESPNMA 660

Query: 1049 SSDAYVLFYE 1058
            +  AYVLFY+
Sbjct: 661  T--AYVLFYK 668

 Score = 35.8 bits (81), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           + G  N GNTCY NS++QCL+     R
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSVR 166

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 81/191 (42%), Gaps = 41/191 (21%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKV--FRTLFISSKYKSYLQQSRGN-RLHSPRLSNSLNM 658
            GL NLGN+CY+NS++Q L    V  +   F+ S++   +     N +    +L N++  
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGVPSWSLDFLGSEFPLDVVYPANNLKCQWIKLLNAMKH 382

Query: 659 LFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVA 718
              K+Y NG   + PT F K + +   +    + QQD  EFL  LLD L           
Sbjct: 383 E-PKLYANG---IKPTTFKKCIGKNHEEFS-SNRQQDAMEFLTFLLDSLD---------- 427

Query: 719 NDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 778
                                +++F  N    G S  +D+ +  ME+ LQC +CG   ++
Sbjct: 428 ---------------------RNFFSDNSA--GASNPNDLMRFMMEDRLQCNKCGKVKYS 464

Query: 779 YSTFYVLSLAI 789
           Y     + L +
Sbjct: 465 YEPAEAIQLPL 475

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
            similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 64/133 (48%), Gaps = 25/133 (18%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 994
            +T+    LPKIL +HL RF Y    ++N      I YPL L +  K++  +   Y L G+
Sbjct: 583  RTVGLKQLPKILSLHLKRFKYSEKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELNGI 642

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKH------GSDKSLKI 1047
            V H G     GHY ++   D+      G   W  +DDE V++  +       G +K +  
Sbjct: 643  VIHMGGGPQHGHYVAICKHDM-----FG---WLLYDDETVESIDEETVFKFVGDEKDM-- 692

Query: 1048 SSSDAYVLFYERV 1060
              + AYVLF++ V
Sbjct: 693  --TTAYVLFFKEV 703

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 6/44 (13%)

Query: 585 HIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRT 628
           H+P  + S+  +      GL N GNTCY NS++QCLF     RT
Sbjct: 122 HLPCGDGSTKVF------GLENFGNTCYCNSVLQCLFNLSELRT 159

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 12/79 (15%)

Query: 755 IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCIN 814
           +  +FQG M NS++C  C   T +   F  L  AIP             ++ V ++D ++
Sbjct: 509 VQSLFQGTMINSIKCLTCDNVTSSDELF--LDFAIPVNE----------DEEVNIQDMLS 556

Query: 815 MFTSDEVLSGENAWDCPRC 833
            F   E+L+G N + C  C
Sbjct: 557 NFNQREMLNGANKFYCDSC 575

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 64/133 (48%), Gaps = 23/133 (17%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNNTV-----ITYPLILNIILKNNDTM--KYRLFG 993
            + +    LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY L G
Sbjct: 548  RLVGLKQLPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAG 606

Query: 994  VVNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHG----SDKSLKIS 1048
            +V H G     GHY SL   +        +  W  FDDE V+A K+      + +S  ++
Sbjct: 607  IVVHMGGGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTGESPNMA 658

Query: 1049 SSDAYVLFYERVH 1061
            +  AYVLFY+ ++
Sbjct: 659  T--AYVLFYKAMY 669

 Score = 36.2 bits (82), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           + G  N GNTCY NS++QCL+     R
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLR 165

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 20/112 (17%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNI--------ILKNNDTMK 988
            K + F + P IL + L RF YD       K N    +P  +++        + +N ++ K
Sbjct: 384  KGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCK 443

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKADKKH 1039
            Y L GV+ HTG + +GHY +++  DL+        +WY FDDE V K  KK 
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKPDLQ-------DQWYRFDDEKVWKVTKKQ 488

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 87/234 (37%), Gaps = 63/234 (26%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            G RN G TCY+NS++Q  F  K FR L      ++           SP  ++S+ +   
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYQIPTEN----------ESP--NDSVPLALQ 254

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDY 721
           + +     S +P   L++      D      Q D QE   IL+DRL + +   P      
Sbjct: 255 RAFYQLQVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTP------ 308

Query: 722 PNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                       V  K                 ++++F G+M++ ++C    Y +     
Sbjct: 309 ------------VEGK-----------------LNELFVGKMKSYIKCINVDYESSRVED 339

Query: 782 FYVLSLAIPRRSMKLSKLGRPNEKRVK-LEDCINMFTSDEVLSGENAWDCPRCG 834
           F+ L L               N K +K LE+    +   E+++GEN +     G
Sbjct: 340 FWDLQL---------------NVKNLKGLEESFKNYIEIELMNGENQYAAQDFG 378

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 53/112 (47%), Gaps = 9/112 (8%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDK 662
           GL N+GNTCY+NS +Q L+     R + +  KYK       G+ LH  +L + L   F+ 
Sbjct: 110 GLLNMGNTCYMNSTLQALYRVDGLRDMVL--KYKEQANVQPGDELHY-KLISELKRCFEN 166

Query: 663 MYLNGGCSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFLMILLDRLH 708
           +      SV+P  FL ++ +  P     D+      QQD +E    L   L+
Sbjct: 167 LQKKSYESVMPVVFLNLLRKCYPQFAEVDNANGIFKQQDAEELFTQLFSSLN 218

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 58/127 (45%), Gaps = 21/127 (16%)

Query: 941  KTINFVTLPKILVIHLSRFYYD--LTKKNNTVITYPLILNI--ILKNNDTMKYRLFGVVN 996
            KT+ F  LPK L +HL RF  D  +  K    I YPL L +     N+    Y L GVV 
Sbjct: 531  KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 997  HTG-TLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV-----KADKKHGSDKSLKISSS 1050
            H G +   GHY S+   +        +  W  +DDE +     +A   H  + +  I+  
Sbjct: 591  HVGASPTHGHYVSICKHE--------KYGWLMYDDETIESIPEEAVTSHVGEPNNPIT-- 640

Query: 1051 DAYVLFY 1057
             AYVLFY
Sbjct: 641  -AYVLFY 646

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 73/185 (39%), Gaps = 42/185 (22%)

Query: 652 LSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 711
           L + +  + +  YL+G   V P  F+K++ +  P L     QQD  EFL  LL+ + D  
Sbjct: 378 LKDIMECITENRYLSG--VVSPAEFVKLLKRQNP-LFNSTMQQDAHEFLNFLLNNISDFA 434

Query: 712 SNQPHVANDYPNLLLYDADGLKVSNKE---YKHWFDKNVIGNGISPIDDIFQGQMENSLQ 768
                          Y ++ LK SN+E     H F           + D F+G + N ++
Sbjct: 435 GK-------------YKSNYLKSSNEEECEISHDF-----------VKDQFEGVLLNRIK 470

Query: 769 CKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAW 828
           C  C   + N   F    + I             N++ + ++D    F   E+L G N +
Sbjct: 471 CLTCDCVSANEEPFLDFPIEIQ------------NDEAINIQDTFRSFYQREILCGPNKF 518

Query: 829 DCPRC 833
            C  C
Sbjct: 519 YCNEC 523

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           + G  N G+TCY NS++QC++    FR
Sbjct: 120 VFGYENFGHTCYCNSVLQCIYNLPEFR 146

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 67/129 (51%), Gaps = 8/129 (6%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKV--FRTLFISSKYK-SYLQQSRGNRLHSPRLSNSLNML 659
           GL NLGN+CY+NS++QC +   +  +    + +++  S +  S   +    +L+N++ + 
Sbjct: 327 GLINLGNSCYLNSILQCFYNGGIPNWSVEELGTEFPLSVVYPSNNLKCQLLKLTNAMKIE 386

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719
            D +Y NG   + PT F K +     +    + QQD  EFL  ++D L +++ N  +  N
Sbjct: 387 SD-LYPNG---IKPTAFKKCIGGSHNEFS-SNRQQDAMEFLTYMIDVLDNKIFNTANNPN 441

Query: 720 DYPNLLLYD 728
           D    ++ D
Sbjct: 442 DTMRFIMED 450

 Score = 39.7 bits (91), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 14/76 (18%)

Query: 989  YRLFGVVNHTG-TLISGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKADKKHGSDKSLK 1046
            Y+L  VV H G +  SGHY + + K ++     G+  W  ++DE +V AD       SLK
Sbjct: 721  YKLTAVVCHKGQSAHSGHYVAFIRKIVD-----GKLSWVLYNDEKIVIAD-------SLK 768

Query: 1047 ISSSDAYVLFYERVHD 1062
                + Y+ FY R  D
Sbjct: 769  EVQKNGYIFFYSRTSD 784

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 86/233 (36%), Gaps = 61/233 (26%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            G RN G TCY+NS++Q  F  K FR L              G   +    ++S+ +   
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVY------------GIPTNGENPNDSVPLALQ 251

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDY 721
           + +     S  P   L++      D      Q D QE   IL+DRL + +          
Sbjct: 252 RAFYQLQVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDRLENRMK--------- 302

Query: 722 PNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                    G  V  K                 +++IF G+M++ ++CK   Y +     
Sbjct: 303 ---------GTNVEGK-----------------LNEIFVGKMKSYIRCKNVDYESSRVED 336

Query: 782 FYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 834
           F+ + L +  ++ K             L++    +   E+++GEN +  P  G
Sbjct: 337 FWDIQLNV--KNFK------------SLQESFENYIEVELMNGENQYAAPDFG 375

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 20/120 (16%)

Query: 941  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIILKNNDTMK- 988
            K + F + P +L + L RF YD     L K N+       +   P +   +LK     K 
Sbjct: 381  KGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKN 440

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKADKKHGSDKSLKI 1047
            Y+L GV+ HTG + +GHY +++   LE        +WY FDDE V K DKK   D++  +
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKPTLE-------DQWYRFDDEKVWKVDKKQVFDENFGL 493

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 58/129 (44%), Gaps = 17/129 (13%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNI--ILKNNDTMKYRLFGV 994
            + I    LPK LV+HL RF Y   K  N      + YP  LNI  +  ++ + KY L  +
Sbjct: 533  RLIGIKELPKHLVVHLKRFKYCEEKNCNIKLFNKVNYPFTLNISSVFDDSISKKYELNSI 592

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSL--KISSSD 1051
            V H G     GHY +L               W  +DDE V+A       + L  +  S+ 
Sbjct: 593  VVHIGESPQLGHYVTLCKHK--------SYGWLIYDDETVQAVSDELVSRILNNEQRSAT 644

Query: 1052 AYVLFYERV 1060
            AY+LFYE V
Sbjct: 645  AYLLFYEEV 653

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 21/40 (52%)

Query: 593 SNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFIS 632
           SN  V   + G +N G TCY NS++Q LF    FR   I 
Sbjct: 97  SNYDVGERVFGFQNFGYTCYCNSILQALFNIGSFRDGIIG 136

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 62/136 (45%), Gaps = 29/136 (21%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 994
            + +    LP IL +HL RF Y   +K+N      I YPL L++    N ++  KY L GV
Sbjct: 547  RMVGLKQLPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGV 606

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKK--------HGSDKSL 1045
            V H G+    GHY  +       N   G   W  +DDE V++ K+        H  D++ 
Sbjct: 607  VIHMGSGPQHGHYVCIC-----RNEKFG---WLLYDDETVESIKEETVLQFTGHPGDQTT 658

Query: 1046 KISSSDAYVLFYERVH 1061
                  AYVLFY+   
Sbjct: 659  ------AYVLFYKETQ 668

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFR 627
           S  + G  N GNTCY NS++QCL+    FR
Sbjct: 130 SNKVFGYENFGNTCYCNSVLQCLYNIPEFR 159

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar to
            uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13 or
            uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
            ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 17/128 (13%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNNT----VITYPLILNIILKNNDTM--KYRLFGV 994
            + +    LPK L +HL RF Y   + +N      ++YPL L +    N ++   Y L G+
Sbjct: 559  RVVGLKQLPKTLALHLKRFKYSEQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSGI 618

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDK--SLKISSSD 1051
            V H G     GHY SL   +        +  W  FDDE V+A  +    +    K + + 
Sbjct: 619  VVHMGGGPQHGHYISLCKNE--------KFGWLLFDDETVEAISEQAVLQYTGDKDTMTT 670

Query: 1052 AYVLFYER 1059
            AYVLFY+ 
Sbjct: 671  AYVLFYQE 678

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 77/189 (40%), Gaps = 40/189 (21%)

Query: 652 LSNSLNMLFDKM----YLNGGCSVVPTGFLKVV---NQLRPDLKIPDDQQDTQEFLMILL 704
           L N L  +F+ +    YL G   V P+ F++++   N L   +      QD  EFL+ LL
Sbjct: 396 LYNGLKDIFECITEHSYLTG--VVTPSAFIEMLKRENVLFSSMM----HQDAHEFLIFLL 449

Query: 705 DRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQME 764
           + + D L  Q   A    N  +YD+   + ++   K++            + DIFQG + 
Sbjct: 450 NEISDFLDKQNKNA---LNSKIYDSSQGRRNSGTVKNF------------VSDIFQGTLT 494

Query: 765 NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSG 824
           N ++C  C  TT     F    + +                 + +++ +  F   E+L G
Sbjct: 495 NRIKCLTCDNTTARDEPFLDFPIEVQENV------------DIDIQEILESFHQKEMLHG 542

Query: 825 ENAWDCPRC 833
            N + C  C
Sbjct: 543 PNKFYCDEC 551

 Score = 38.9 bits (89), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           I G  N GNTCY NS++QCL+    FR
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFR 175

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 61/126 (48%), Gaps = 22/126 (17%)

Query: 940  VKTINFVTLPKILVIHLSRFYYDLTKKN---NTVITYPLILNI-----ILKNNDTMKYRL 991
            +K +    LP +LV+ L RF +    +N   N  I +P  LN+       +NN ++ Y L
Sbjct: 323  IKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYEL 382

Query: 992  FGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSD 1051
             GV++H GT+  GHY + +  D         + W+ F+D +V +  +       ++    
Sbjct: 383  NGVISHIGTVNEGHYIATLKLD--------SNNWFKFNDSMVTSISEE------EVLKDQ 428

Query: 1052 AYVLFY 1057
            AY+LFY
Sbjct: 429  AYLLFY 434

 Score = 38.5 bits (88), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 95/245 (38%), Gaps = 64/245 (26%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDK 662
           G  N+G+TC+++S++Q L         FI    ++ + QS  +       +N ++   D+
Sbjct: 122 GFVNMGSTCFMSSILQVLI-----HNPFI---VQNSMSQSHYSSCKIRNPNNCISCALDE 173

Query: 663 MYLNGGCSVVPTGFLKVVNQ--------LRPDLKIPDD-----QQDTQEFLMILLDRLHD 709
           +      + V     K +NQ        L    KI D+     QQD  EFL  +L+RLH 
Sbjct: 174 IIAESYGNFVKYNNGKPINQYHDGFISMLNCSWKINDNFAGYSQQDAHEFLQFILNRLHR 233

Query: 710 ELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 769
           +      + + Y N    + D                        I  IFQG++++S+ C
Sbjct: 234 DYK----LTSTYTN----NTDSCSC-------------------LIHSIFQGKLKSSIVC 266

Query: 770 KRCGYTTFNYSTFYV-LSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAW 828
             C   +   +  Y+ LSL I              + +  L  C++ F   E L   N +
Sbjct: 267 PECHDNSKTVTDPYIDLSLDI--------------KDKATLYQCLDSFHKKETLHDYN-Y 311

Query: 829 DCPRC 833
            CP C
Sbjct: 312 HCPNC 316

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 61/131 (46%), Gaps = 17/131 (12%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 994
            + +    LP  L +HL RF Y   +  N      + YPL L++    + ++  KY L GV
Sbjct: 534  RIVGLKQLPHTLALHLKRFKYSEEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTGV 593

Query: 995  VNHT-GTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISS--SD 1051
            V H  G+   GHY SL   D        +  W  FDDE V++  +    +    SS  + 
Sbjct: 594  VIHMGGSPQHGHYVSLCKND--------KFGWLLFDDETVESVTEKTVLEFTGDSSNQAT 645

Query: 1052 AYVLFYERVHD 1062
            AYVLFY+ + +
Sbjct: 646  AYVLFYKELDE 656

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 60/141 (42%), Gaps = 36/141 (25%)

Query: 693 QQDTQEFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGI 752
           QQD  EFL  LL+ L + L N  H++  +P            SNK     F   VI    
Sbjct: 422 QQDAHEFLNFLLNELSEYLQN--HIS--HP------------SNKPTDIPFKNYVI---- 461

Query: 753 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDC 812
               D+FQG + N ++C  C   T     F    L  P        +G   ++ + ++D 
Sbjct: 462 ----DLFQGVLTNRIKCLTCDNITSRDEPF----LDFP--------IGVKGDENIDIQDV 505

Query: 813 INMFTSDEVLSGENAWDCPRC 833
           +  + + E+L+G N + C +C
Sbjct: 506 LRCYHTREMLNGSNKFYCSQC 526

 Score = 36.2 bits (82), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFR 627
           S  + G  N GNTCY NS++QCL+     R
Sbjct: 133 SNKVFGYENFGNTCYCNSVLQCLYNLTELR 162

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 80/193 (41%), Gaps = 48/193 (24%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSY----LQQSRGNRLHSPRLSNSLN 657
            GL NLGN+CYINS++QCL    V +T  +S+  +S+    L  S   +    +L+N++ 
Sbjct: 322 CGLINLGNSCYINSVLQCLLNGGV-KTYSLSALGESFPLDVLYPSTNMKCQLIKLNNAIK 380

Query: 658 MLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHV 717
            L  ++Y +G   + P  F K + Q   +    + QQD  EFL    D L          
Sbjct: 381 -LEPELYPSG---IRPRSFKKCIGQAHEEFS-SERQQDALEFLSFFNDTL---------- 425

Query: 718 ANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTF 777
                                     DK +     +   D+ +  +EN LQC +CG    
Sbjct: 426 --------------------------DKKIFSRSENNPSDLMRYIIENRLQCTKCG--KV 457

Query: 778 NYSTFYVLSLAIP 790
            Y+T    S+ +P
Sbjct: 458 KYTTDINESMLVP 470

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 63/128 (49%), Gaps = 24/128 (18%)

Query: 940  VKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNIILKNNDT-------MKY 989
            +K +    LP +LV+ L RF + +   + K N  I YP  LN+    + +       M Y
Sbjct: 335  IKQMTIAKLPPVLVLQLKRFEHLMNGNSVKLNEKIAYPTYLNMAPFCHQSESRPVPDMMY 394

Query: 990  RLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISS 1049
             L  V++H G++  GHYTS+          I   +W+ F+D ++ +  +   +++L+   
Sbjct: 395  ELVAVISHEGSVNQGHYTSM--------CKIPGGQWFRFNDSMIVSISE---EEALR--- 440

Query: 1050 SDAYVLFY 1057
              AY+LFY
Sbjct: 441  QQAYLLFY 448

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 94/250 (37%), Gaps = 69/250 (27%)

Query: 600 SITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRL-----SN 654
            + GL N+G+TC+++S+IQ L              +  Y+ ++  N++H  R      ++
Sbjct: 134 GLCGLVNMGSTCFMSSIIQTLV-------------HNPYVLKTCMNQVHFSRCDIQDSAS 180

Query: 655 SLNMLFDKMYLNGGCSVVPTGFLK----VVNQLRPDLKIPDD-----QQDTQEFLMILLD 705
             +   D++  N         F       V+ L    KI  +     QQD  EF    L+
Sbjct: 181 CFSCALDRIVSNFYGPAADASFTSQQKGFVDLLLCSWKINRNLAGYSQQDAHEFWQFFLN 240

Query: 706 RLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
           +LH                    AD ++V+ K+     + N I +        FQG + +
Sbjct: 241 QLH--------------------ADHVRVTGKKSSKPEECNCISH------SAFQGSLRS 274

Query: 766 SLQCKRC-GYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSG 824
           S+ C  C   +   +     LSL I  ++              KL DC+  F   E L+ 
Sbjct: 275 SILCTDCHDGSNITFDPMMDLSLEIKNKN--------------KLVDCLKSFHEGETLTD 320

Query: 825 ENAWDCPRCG 834
            N   CP CG
Sbjct: 321 FNH-RCPNCG 329

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 89/236 (37%), Gaps = 67/236 (28%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLF--ISSKYKSYLQQSRGNRLHSPRLSNSLNML 659
            G RN G TCY+NS++Q  F  K FR L   I ++++S               +NS+ + 
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHES--------------PNNSVPLA 250

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719
             + +     S +P   L++      D      Q D QE   IL+DRL + +   P    
Sbjct: 251 LQRAFYQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTP---- 306

Query: 720 DYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY 779
                         V  K                 +++IF G+M++ ++C    Y +   
Sbjct: 307 --------------VEGK-----------------LNEIFVGKMKSYIKCINVDYESARV 335

Query: 780 STFYVLSLAIPRRSMKLSKLGRPNEKRVK-LEDCINMFTSDEVLSGENAWDCPRCG 834
             F+ L L               N K  K L++  + +   E+++GEN +     G
Sbjct: 336 EDFWDLQL---------------NVKNFKNLQESFDNYIEMELMNGENQYAAQDYG 376

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 26/112 (23%)

Query: 941  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIILK------- 982
            K + F + P +L + L RF YD     + K N+      T+   P +   +LK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSEN 441

Query: 983  -NNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
             + +   Y L GV+ H+G + +GHY +L+   +E        +WY FDDE V
Sbjct: 442  KDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 61/132 (46%), Gaps = 24/132 (18%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNII-------LKNND 985
            K   ++ +    LP +LV+ L RF + +   + K N  I +P  L++        +    
Sbjct: 331  KQNAIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVGETP 390

Query: 986  TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSL 1045
             + Y L G+++H G++  GHYTS+          I   +W+ F+D +V A  +      +
Sbjct: 391  AIVYELIGLISHQGSVNQGHYTSI--------CKIPGGQWFKFNDSMVTAVAE------I 436

Query: 1046 KISSSDAYVLFY 1057
             +    AY+LFY
Sbjct: 437  DVLKEQAYLLFY 448

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 79/201 (39%), Gaps = 59/201 (29%)

Query: 586 IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645
           IP++E+ +       + GL N+G+TC+++S+IQ L              +  Y+ +   +
Sbjct: 126 IPSVEKRN------GLAGLVNMGSTCFMSSIIQTLI-------------HNPYILKHSMD 166

Query: 646 RLHSPR---------LSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD---- 692
           +LHS           +S +++ +    Y         T     VN L    +   +    
Sbjct: 167 QLHSTTCDLQNSSSCMSCAVDQIISDFYGASKSETSETNQQGFVNLLSCSWRKNKNLAGY 226

Query: 693 -QQDTQEFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNG 751
            QQD  EF   LL++LH+                    D L+ +N++     D N I + 
Sbjct: 227 SQQDAHEFWQFLLNQLHN--------------------DHLRATNQKASLKNDCNCISH- 265

Query: 752 ISPIDDIFQGQMENSLQCKRC 772
                  FQG +++S+ C  C
Sbjct: 266 -----RSFQGFLKSSIVCPEC 281

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 23/133 (17%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNI--ILKNNDTMKYRLFGV 994
            + +    LP IL +HL RF Y   +++N      I YPL L++     ++ + KY L GV
Sbjct: 539  RIVGLKQLPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGV 598

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISS---- 1049
            V H G+    GHY  +   +        +  W  +DDE V++ ++   +  LK +     
Sbjct: 599  VIHMGSGPQHGHYVCICKNE--------KFGWLLYDDETVESIRE---ETVLKFTGHPGD 647

Query: 1050 -SDAYVLFYERVH 1061
             + AYVLFY+  H
Sbjct: 648  QTTAYVLFYKETH 660

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFR 627
           S  + G  N GNTCY NS++QCL+    FR
Sbjct: 122 SNKVFGYENFGNTCYCNSVLQCLYNISEFR 151

 Score = 32.3 bits (72), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 38/184 (20%), Positives = 70/184 (38%), Gaps = 36/184 (19%)

Query: 652 LSNSLNMLFDKMYLNGGCS--VVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHD 709
           L N L  +F+ +  N   +  V PT F+K++ +          QQD  EFL  LL     
Sbjct: 382 LYNGLKDIFESITENLSLTGIVSPTEFVKILKKENVLFNTMM-QQDAHEFLNFLL----- 435

Query: 710 ELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 769
                    ND+   +     G++   K       K+++    + I D+F+G + N ++C
Sbjct: 436 ---------NDFSEYIERRNSGMQFGPK-------KDIVNANDNFIADLFKGTLTNRIKC 479

Query: 770 KRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWD 829
             C   T     F    + +              +    ++  +  +   E+L+G N + 
Sbjct: 480 LTCDNITSRDEPFLDFPIEV------------QGDDETDIQKILRSYHQREMLNGVNKFY 527

Query: 830 CPRC 833
           C +C
Sbjct: 528 CNKC 531

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 64/131 (48%), Gaps = 24/131 (18%)

Query: 937  LTTVKTINFVTLPKILVIHLSRFYYDLTKKN---NTVITYPLILNI---ILKNNDT---- 986
            L  +K      LP +LV+ L RF + +   N   N  + YPL LN+     +N +     
Sbjct: 344  LDPIKQFTINKLPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPD 403

Query: 987  MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLK 1046
            + Y L G+++H G++  GHY  ++         I   +W+ F+D ++   K+   D++LK
Sbjct: 404  IIYELTGILSHIGSINEGHYVVVLK--------INDGRWFKFNDSMISVIKE---DEALK 452

Query: 1047 ISSSDAYVLFY 1057
                 AY+LFY
Sbjct: 453  ---QQAYLLFY 460

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 53/111 (47%), Gaps = 9/111 (8%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDK 662
           GL+NLGNTCY+N+ +QCLF  +  R + ++ K  S +  S  + +H  ++   L   FD 
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYKQSSSV--SPADEVHQ-KIVLELRNCFDS 166

Query: 663 MYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILLDRL 707
           +      +V+P   L V+ +  P     D       QQD +E    L   L
Sbjct: 167 LDKKKFQAVMPLMLLNVLRKAYPQFAERDPQGGFYKQQDAEELFTQLFHSL 217

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 88/194 (45%), Gaps = 29/194 (14%)

Query: 586 IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645
           IPT+ Q+        + GL N+G+TCY++S++QCL    +F  L +   + +Y +     
Sbjct: 127 IPTLTQAH------GLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNYCKIQDPM 180

Query: 646 RLHSPRLSNSLNMLFDKMYLNGGCSVVPT-GFLKVVN-QLRPDLKIPD-DQQDTQEFLMI 702
           +  S  + N ++  +      G     P  G + ++N   R +  +    QQD  EFL  
Sbjct: 181 KCMSCAIDNIISETY------GNKKTTPNEGLVDILNCSWRVNKNLAGYTQQDAHEFLQF 234

Query: 703 LLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPID----DI 758
           +L+++H          NDY    ++D +  +++  ++K   + N     +   +     I
Sbjct: 235 ILNQMH----------NDYKLNEIHDTNKQEMNGTDFKTMVNGNSSKEHLHLCNCLPHTI 284

Query: 759 FQGQMENSLQCKRC 772
           FQG +++ + C  C
Sbjct: 285 FQGFLKSIISCSEC 298

 Score = 39.7 bits (91), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 47/115 (40%), Gaps = 30/115 (26%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTK---KNNTVITYPLILNI------------------ 979
            + ++ + L  I+VI L RF + +T    K N  + +PL LN+                  
Sbjct: 353  RQLSILKLAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPTPDTDPTNLNE 412

Query: 980  -ILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
               K+   M Y L G+V H GT+  GHY +                WY F+D VV
Sbjct: 413  KTNKSTPDMIYELTGIVTHRGTVNEGHYITY--------TKTADGVWYQFNDSVV 459

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 63/137 (45%), Gaps = 33/137 (24%)

Query: 940  VKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNIIL----KNNDT------ 986
            +K +    L  +LV  L RF + L   T K N  I YPL LN+       NNDT      
Sbjct: 365  IKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESN 424

Query: 987  ------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHG 1040
                  M Y L  +++H GT+  GHY  +        V +   +W+ F+D +V A  +  
Sbjct: 425  SENVPDMIYELTSIISHKGTVNEGHYIVV--------VKVNDGQWFKFNDSMVSAITE-- 474

Query: 1041 SDKSLKISSSDAYVLFY 1057
             +++LK     AY+LFY
Sbjct: 475  -EEALK---QQAYLLFY 487

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 60/115 (52%), Gaps = 14/115 (12%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDK 662
           GL N+G+TC+++S++Q L          +   + +  Q    N L     S +L+++  +
Sbjct: 138 GLVNMGSTCFMSSILQTLIHNPYVVNYSMCQTHYNMCQSK--NPLSCT--SCALDLIITE 193

Query: 663 MYL--NGGCSVVPTGFLKVVNQLRPDLKIPDD-----QQDTQEFLMILLDRLHDE 710
            Y   + G +   TGF+ ++N L   L++ ++     QQD  EFL  +L+++H++
Sbjct: 194 FYATESKGNNSSHTGFISLLNSL---LQVNENFAGYSQQDAHEFLQFILNQIHND 245

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 89/235 (37%), Gaps = 65/235 (27%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLF--ISSKYKSYLQQSRGNRLHSPRLSNSLNML 659
            G RN G TCY+NS++Q  F  K FR L   I ++++S               +NS+ + 
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHES--------------PNNSVPLA 250

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719
             + +     S +P   +++      D      Q D QE   IL+DRL + +   P    
Sbjct: 251 LQRAFYQLQVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTP---- 306

Query: 720 DYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY 779
                         V  K                 + +IF G+M++ ++C    Y +   
Sbjct: 307 --------------VEGK-----------------LSEIFVGKMKSYIKCVNVDYESARV 335

Query: 780 STFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 834
             F+ L L +  ++ K             L++  + +   E+++GEN +     G
Sbjct: 336 EDFWDLQLNV--KNFK------------NLQESFDNYIEMELMNGENQYAAQDYG 376

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 26/112 (23%)

Query: 941  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIILKNN----- 984
            K + F + P +L + L RF YD     + K N+      T+   P +   +LK +     
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGD 441

Query: 985  ---DTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
               +   Y L GV+ H+G + +GHY +L+   +E        +WY FDDE V
Sbjct: 442  KSRNPYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 63/131 (48%), Gaps = 29/131 (22%)

Query: 940  VKTINFVTLPKILVIHLSRFYYDLTKKN---NTVITYPLILNI--ILKNND------TMK 988
            +K      LP +LV+ L RF + ++  N   N  I +P IL++   LK+N       ++ 
Sbjct: 341  IKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSIL 400

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLK-- 1046
            Y L G+++HTG++  GHY +           I   +W+ F+D +V         K L+  
Sbjct: 401  YELIGIISHTGSVNEGHYVAFCK--------IENGEWFKFNDSMVT--------KILEKD 444

Query: 1047 ISSSDAYVLFY 1057
            +    AY+LFY
Sbjct: 445  VLKEQAYLLFY 455

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 88/220 (40%), Gaps = 51/220 (23%)

Query: 586 IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645
           +PT++Q         + GL N+G+TCY++S++QC+         F+  ++ +       +
Sbjct: 127 VPTVDQID------GMAGLVNMGSTCYMSSIMQCIIHNPYMIRYFMCQQHSNNCTLKMAS 180

Query: 646 RLHSPRLSNSLNMLFDKMYLNG-----GCSVVPTGFLKVVNQLRPDLKIPDD-----QQD 695
              S  +S+ +   +     N        +    GF   +N L    K+ ++     QQD
Sbjct: 181 NCTSCAISSIIADFYGNSVQNDYKSKKNNNNKHEGF---INLLTCSWKVNENLAGYSQQD 237

Query: 696 TQEFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPI 755
             E+   +L+ +H +  +  H  +D                       DK  + N +  +
Sbjct: 238 AHEYWQFILNHIHQDYKSSMHSHSD-----------------------DK--LCNCV--V 270

Query: 756 DDIFQGQMENSLQCKRC---GYTTFNYSTFYVLSLAIPRR 792
              FQG +++S+ C  C     TTF+   F  LSL I  +
Sbjct: 271 HSSFQGSLKSSIVCPECNNDSKTTFD--PFIDLSLGIKDK 308

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 59/126 (46%), Gaps = 21/126 (16%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNI--ILKNNDT--MKYRL 991
             +K +    LP +LV+ L RF + L   + K N ++ +PL LN+      +D   + + L
Sbjct: 348  AIKRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDDVPDIIFEL 407

Query: 992  FGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSD 1051
             G++ H GT+  GHY +       H        W+ F+D +V +  +       ++    
Sbjct: 408  IGIIAHRGTVNEGHYIAFTKVTTGH--------WFKFNDSMVSSITEE------ELLQEQ 453

Query: 1052 AYVLFY 1057
            AY+LFY
Sbjct: 454  AYLLFY 459

 Score = 35.4 bits (80), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 61/149 (40%), Gaps = 43/149 (28%)

Query: 586 IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645
           IP +E+         + GL N+G+TC+++S++QCL              +  Y  Q   N
Sbjct: 127 IPKLERRD------GLQGLLNMGSTCFMSSIVQCLI-------------HNPYFFQFSIN 167

Query: 646 RLHSPRLS-----NSLNMLFDKMYLN--GGCSVVPTG------------FLKVVNQLRPD 686
           +LHS R       + ++   D+M     G   ++  G            +   +      
Sbjct: 168 QLHSQRCPLQDPLSCISCALDRMVWEFYGHPELIKNGEDDSNNSRTSDEYAGFIGLFVSS 227

Query: 687 LKIPDD-----QQDTQEFLMILLDRLHDE 710
            KI ++     QQD  E+   LL++LH++
Sbjct: 228 WKINENLAGYFQQDAHEYWQFLLNQLHND 256

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 89/236 (37%), Gaps = 67/236 (28%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLF--ISSKYKSYLQQSRGNRLHSPRLSNSLNML 659
            G RN G TCY+NS++Q  F  K FR L   I ++++S               +NS+ + 
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHES--------------PNNSVPLA 250

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719
             + +     S +P   L++      D      Q D QE   IL+DRL + +   P    
Sbjct: 251 LQRAFYQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTP---- 306

Query: 720 DYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY 779
                         V  K                 +++IF G+M++ ++C    Y +   
Sbjct: 307 --------------VEGK-----------------LNEIFVGRMKSYIKCINVDYESSRV 335

Query: 780 STFYVLSLAIPRRSMKLSKLGRPNEKRVK-LEDCINMFTSDEVLSGENAWDCPRCG 834
             F+ L +               N K  K L++  + +   E+++GEN +     G
Sbjct: 336 EDFWDLQM---------------NVKNFKNLQESFDNYIEMELMNGENQYAAQDYG 376

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 25/111 (22%)

Query: 941  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIILK------- 982
            K + F + P +L + L RF YD     + K N+      T+   P +   +LK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGD 441

Query: 983  NNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
            N +   Y L GV+ H+G + +GHY +L+   +E        +WY FDDE V
Sbjct: 442  NGNPYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 485

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
            Anc_7.390 YBL067C
          Length = 765

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 59/131 (45%), Gaps = 21/131 (16%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILN--IILKNNDTMKYRLFGV 994
            + +    LP  L +HL RF Y   +  N      I YPL L+      ++ + KY L G+
Sbjct: 561  RKVGLKQLPHTLALHLKRFKYSEEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGI 620

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSD-- 1051
            V H G     GHY SL   D     + G   W  FDDE V+A   H S  S  I   D  
Sbjct: 621  VVHMGGGPQHGHYVSLCKND-----NFG---WLLFDDETVEA--VHESTVSKFIGDRDSL 670

Query: 1052 --AYVLFYERV 1060
              AYVLFY+ +
Sbjct: 671  TTAYVLFYKEI 681

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFI 631
           + G  N GNTCY NS++QCL+    FR L +
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLLL 153

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 92/242 (38%), Gaps = 71/242 (29%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRL------HSPRLSNS 655
            G  NLGN+CY+NS++QCLF   V         + + L    GN         +  L   
Sbjct: 333 CGFINLGNSCYLNSVLQCLFNDGV-------PNWATLLANLIGNEFPLDCVYPTTNLKCQ 385

Query: 656 LNMLFDKMYLNGGC---SVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 712
           L  + +   LN       + P  F   V Q   + K  ++QQD  EFL  LL++L   L 
Sbjct: 386 LIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFK-SNNQQDATEFLTFLLEQLEKTLF 444

Query: 713 NQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 772
            +    ++ PN                                 +I +  ME+ +QC+ C
Sbjct: 445 KK----DNNPN---------------------------------NIMKFIMEDKIQCQSC 467

Query: 773 GYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENA-WDCP 831
           G   ++Y          P   ++L   G  N + + +E   N F      +GEN  +DCP
Sbjct: 468 GNVKYSYE---------PTEYIQLPLDGTNNPQNL-VETLTNFF------NGENIDFDCP 511

Query: 832 RC 833
            C
Sbjct: 512 TC 513

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 39/82 (47%), Gaps = 12/82 (14%)

Query: 979  IILKNNDTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADK 1037
            II  N D   YRL  VV H G +  SGHY + + K ++  +     KW  ++DE +    
Sbjct: 724  IIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDEL-----KWVLYNDEKIVV-- 776

Query: 1038 KHGSDKSLKISSSDAYVLFYER 1059
               SD   +I   D Y+ FY R
Sbjct: 777  ---SDNIDEI-KKDGYIYFYSR 794

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 57/118 (48%), Gaps = 20/118 (16%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNI-------ILKNNDTMK- 988
            K + F + P +L + L RF YD       K N    +P  +++       +L+ N   + 
Sbjct: 380  KGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRW 439

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKADKKHGSDKSL 1045
            Y L GV+ HTG + +GHY +L+   LE        +WY FDDE V K  KK   D++ 
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLE-------DQWYRFDDERVWKVSKKQAFDENF 490

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 86/234 (36%), Gaps = 63/234 (26%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            G RN G TCY+NS++Q  F  K FR L         +  S+ N    P+  +S+ +   
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQ------IPTSQEN----PK--DSVVLALQ 250

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDY 721
           + +     S  P   +++      D      Q D QE   IL+DRL   +          
Sbjct: 251 RAFYQLQVSQYPLDTMELTRSFGWDNVEAFTQHDVQELNRILMDRLETRMK--------- 301

Query: 722 PNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                    G  V NK                 +++IF G+M++ ++C    Y +     
Sbjct: 302 ---------GTTVENK-----------------LNEIFVGKMKSFIKCINVDYESARTED 335

Query: 782 FYVLSLAIPRRSMKLSKLGRPNEKRVK-LEDCINMFTSDEVLSGENAWDCPRCG 834
           F+ + +               N K +K L+D    +   E++ GEN +     G
Sbjct: 336 FWDIQM---------------NVKNLKGLKDSFENYIEVELMDGENQYAAQDYG 374

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 59/137 (43%), Gaps = 34/137 (24%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTV---ITYPLILNIILKNNDTMK------- 988
             +K +    LP +LV+ L RF + L   N  +   I +P  LN  +KN  + K       
Sbjct: 345  AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLN--MKNYCSTKEKDKHSE 402

Query: 989  --------YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHG 1040
                    Y L G+V+H GT+  GHY +           I   +W+ F+D +V +  +  
Sbjct: 403  NGKVPDIIYELIGIVSHKGTVNEGHYIAF--------CKISGGQWFKFNDSMVSSISQE- 453

Query: 1041 SDKSLKISSSDAYVLFY 1057
                 ++    AY+LFY
Sbjct: 454  -----EVLKEQAYLLFY 465

 Score = 38.5 bits (88), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 59/261 (22%), Positives = 108/261 (41%), Gaps = 61/261 (23%)

Query: 586 IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645
           +P++E+         ++GL N+G+TC+++S++QCL     F    +S  + +  +    +
Sbjct: 127 VPSMERRD------GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPD 180

Query: 646 RLHSPRLSNSLNMLFDKMYLNGGCSVVP-----TGFLKVVNQLRPDLKIPDD-----QQD 695
           +  S  L   ++ L+  +      S        TGF+ +   L    KI  +     QQD
Sbjct: 181 KCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYL---LTCAWKINQNLAGYSQQD 237

Query: 696 TQEFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPI 755
             EF   +++++H     Q +V  D PN      +  + +NK+ +              +
Sbjct: 238 AHEFWQFIINQIH-----QSYVL-DLPNA----KEVSRANNKQCE------------CIV 275

Query: 756 DDIFQGQMENSLQCKRC---GYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDC 812
             +F+G +E+S+ C  C     TT +   F  LSL I  +               KL +C
Sbjct: 276 HTVFEGSLESSIVCPGCQNNSKTTID--PFLDLSLDIKDKK--------------KLYEC 319

Query: 813 INMFTSDEVLSGENAWDCPRC 833
           ++ F   E L   N + C  C
Sbjct: 320 LDSFHKKEQLKDFN-YHCGEC 339

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 61/133 (45%), Gaps = 29/133 (21%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNI--ILKNNDTMKYRLFGV 994
            + +    LP IL +HL RF Y   +K+N      I YPL L++      + + KY L GV
Sbjct: 545  RIVGLKQLPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGV 604

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKK--------HGSDKSL 1045
            V H G+    GHY  +       N   G   W  +DDE V++ ++        H  D++ 
Sbjct: 605  VIHMGSGPQHGHYVCIC-----KNEKFG---WLLYDDETVESIREETVLQFTGHPGDQTT 656

Query: 1046 KISSSDAYVLFYE 1058
                  AYVLFY+
Sbjct: 657  ------AYVLFYK 663

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLN 657
           S  + G  N GNTCY NS++QCL+    FR   +      Y ++   NR+    L  S  
Sbjct: 130 SNKVFGYENFGNTCYCNSVLQCLYNIPEFRCNIL-----QYPEKPATNRIRKSDLKGSKA 184

Query: 658 MLFD----KMYLNGG 668
            +F     +  +NGG
Sbjct: 185 RIFTNESFETSVNGG 199

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 87/235 (37%), Gaps = 65/235 (27%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLF--ISSKYKSYLQQSRGNRLHSPRLSNSLNML 659
            G RN G TCY+NS++Q  F  K FR L   I ++++            SP  +NS+ + 
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHE------------SP--NNSVPLA 250

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719
             + +     S +P   +++      D      Q D QE   IL+DRL + +   P    
Sbjct: 251 LQRAFYQLQVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTP---- 306

Query: 720 DYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY 779
                         V  K                 +++IF G+M++ ++C    Y +   
Sbjct: 307 --------------VEGK-----------------LNEIFVGKMKSYIKCINVDYESARV 335

Query: 780 STFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 834
             F+ L L +                   L+   + +   E+++GEN +     G
Sbjct: 336 EDFWDLQLNVKNFE--------------NLQGSFDNYIEMELMNGENQYAAQDYG 376

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 26/112 (23%)

Query: 941  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIIL-------- 981
            K + F + P +L + L RF YD     + K N+      T+   P +   +L        
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGD 441

Query: 982  KNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
            K+ +   Y L GV+ H+G + +GHY +L+   +E        +WY FDDE V
Sbjct: 442  KDKNPYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 62/130 (47%), Gaps = 25/130 (19%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTK---KNNTVITYPLILNI--ILKNNDT------M 987
             +K ++   LP +LV+ L RF + L     K N  I YP  LN+     + D+      +
Sbjct: 342  AIKRLSIYKLPSVLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNMRDYCSSGDSDVDVPDL 401

Query: 988  KYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKI 1047
             Y L GVV H GT+  GHY +           +   +W+ F+D +V +  +   +++L  
Sbjct: 402  IYELIGVVAHKGTVNEGHYVA--------TTKVAGRQWFKFNDSMVSSVTQ---EEAL-- 448

Query: 1048 SSSDAYVLFY 1057
             +  AY+LFY
Sbjct: 449  -NEQAYLLFY 457

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 62/140 (44%), Gaps = 29/140 (20%)

Query: 586 IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645
           +P++E+         + GL NLG+TC+++S++Q L     F    IS  +      S+  
Sbjct: 127 VPSVERRD------GLHGLLNLGSTCFMSSILQILIRNPYFFNFSISQSH------SKKC 174

Query: 646 RLHSPR--LSNSLNMLFDKMYLNGGCSVVPTG-------FLKVVNQLRPDLKIPDD---- 692
            +  P+  +S +L  +  + Y   G S   TG       +   +  L    KI ++    
Sbjct: 175 PIQDPKSCISCALEKMVCEFY---GSSAYSTGDVEPQAMYSGFIGLLVCSWKINENLAGY 231

Query: 693 -QQDTQEFLMILLDRLHDEL 711
            QQD  EF   LL++LH + 
Sbjct: 232 SQQDAHEFWQFLLNQLHHDF 251

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 51/112 (45%), Gaps = 20/112 (17%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLT----KKNNTVITYPLILNII--------LKNNDTMK 988
            K + F + P IL + L RF YD       K N    +P   +            NN+   
Sbjct: 378  KGVIFESFPPILHLQLKRFEYDFNFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCI 437

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKADKKH 1039
            Y L GV+ HTG + +GHY +++  DLE        +WY FDDE V K  KK 
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKPDLE-------DQWYRFDDEKVWKVTKKQ 482

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 86/233 (36%), Gaps = 61/233 (26%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            G RN G TCY+NS++Q  F  K FR L     YK   +    N        +S+ +   
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV----YKIPTESETPN--------SSVPLALQ 248

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDY 721
           + +     S +P   L++      D      Q D QE   IL+DRL + +   P      
Sbjct: 249 RAFYQLQVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMLGTP------ 302

Query: 722 PNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                       V  K                 + ++F G+M++ ++C    Y +     
Sbjct: 303 ------------VEGK-----------------LSELFVGKMKSYIKCVNVEYESSRVED 333

Query: 782 FYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 834
           F+ L L +  +++K             L+D    +   E+++GEN +     G
Sbjct: 334 FWDLQLNV--KNLKC------------LKDSFENYIEIELMNGENQYAAQDFG 372

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 63/152 (41%), Gaps = 27/152 (17%)

Query: 584 YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643
           Y I  +  + NA  S+   G+ N GN C+++S++Q L   K F ++       SY   ++
Sbjct: 315 YTIENVPNAGNAIDSIVPRGIVNTGNICFMSSVLQVLLYCKPFISIL---NVISYRTVAK 371

Query: 644 GNRLHSPRLSNSLNML--FDKMYLNGGCSVVP---------TGFLKVVNQLRPD------ 686
                SP L   L +   FDK         VP          G       ++PD      
Sbjct: 372 IGSSVSPSLDACLELYRRFDKQTCENEKKPVPKSKLANGNNVGITPAAEPIKPDDFYKTL 431

Query: 687 LKIP-------DDQQDTQEFLMILLDRLHDEL 711
            K+P         Q+D +EFL  LLD+LH+E 
Sbjct: 432 SKLPKFRDLRWGHQEDAEEFLTHLLDQLHEEF 463

 Score = 35.4 bits (80), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 57/144 (39%), Gaps = 40/144 (27%)

Query: 948  LPKILVIHLSRFYYDLTKKNNTVITYPLILNIILK------------------------- 982
            LP++L+I L RF +      + ++ Y      + K                         
Sbjct: 638  LPQVLLIQLKRFSFINNTDKDKIVNYNAYSGRVEKIRKKIHYNHELTIPKETISSVHSNF 697

Query: 983  -NNDTMKYRLFGVVNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDD----EVVKAD 1036
             ++   KY+L GVV H G   S GHYT+    D+ H       KW+  DD    E+ K +
Sbjct: 698  YDDAGTKYKLVGVVYHHGVSPSGGHYTA----DVYHQ---EMDKWFRIDDVNIAELNKEE 750

Query: 1037 KKHGSDKSLKISSSDAYVLFYERV 1060
               G +      S  AY+L Y+++
Sbjct: 751  VLKGGEDGF--DSRTAYILMYQKI 772

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa] {ON}
            Anc_8.202 YER151C
          Length = 1080

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 68/144 (47%), Gaps = 42/144 (29%)

Query: 948  LPKILVIHLSRF-YYDLTKKNNTVITY----------------------PL--ILNIILK 982
            LP++L+I L RF +     K+N +  Y                      P+  + + ILK
Sbjct: 945  LPQVLLIQLKRFSFVSNIGKDNGMTNYNSYNGRIEKIRKKINYNHELLVPVESVSSAILK 1004

Query: 983  NNDT-MKYRLFGVVNHTGTLI-SGHYTS-LVNKDLEHNVDIGRSKWYYFDD----EVVKA 1035
            NN++  KY+L  VV H G+    GHYT+ + NKDL+        KW+  DD    E+  A
Sbjct: 1005 NNESSRKYKLRAVVYHHGSSPDGGHYTADIYNKDLK--------KWFMIDDVNITELEDA 1056

Query: 1036 DKKHGSDKSLKISSSDAYVLFYER 1059
            D  +G D  L   +  AY+L YE+
Sbjct: 1057 DVVNGGDNGLDTRT--AYILMYEK 1078

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 61/136 (44%), Gaps = 29/136 (21%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNI--ILKNNDTMKYRLFGV 994
            + +    +P IL +HL RF Y   + +N      I YPL L++      + + +Y L GV
Sbjct: 550  RIVGLKQVPYILSLHLKRFKYSEEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSGV 609

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKK--------HGSDKSL 1045
            V H G+    GHY  +   +        +  W  +DDE V++  +        H  D++ 
Sbjct: 610  VIHMGSGPQHGHYVCICKNE--------KFGWLLYDDETVESVSEETVLKFTGHSGDQTT 661

Query: 1046 KISSSDAYVLFYERVH 1061
                  AYVLFY+ +H
Sbjct: 662  ------AYVLFYKEIH 671

 Score = 39.3 bits (90), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 8/74 (10%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLF 660
           + G  N GNTCY NS++QCL+    FR   +  +Y   +  S  NR+    L+ S   +F
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFRCNVL--RYPERIPVS--NRIRKSNLTGSKVRVF 190

Query: 661 D----KMYLNGGCS 670
                ++  NGG S
Sbjct: 191 TNESFEVSTNGGSS 204

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 58/135 (42%), Gaps = 30/135 (22%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTV---ITYPLILNI--ILKNNDTMK----- 988
             +K +    LP +LV+ L RF + L   N  +   I +P  LN+       ++ K     
Sbjct: 345  AIKQLGIHRLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEKHTGNG 404

Query: 989  ------YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSD 1042
                  Y L G+V+H GT+  GHY +           I   +W+ F+D VV +  +    
Sbjct: 405  KVPDIIYELIGIVSHRGTVNEGHYIAFCK--------ISGGQWFKFNDSVVTSIAQG--- 453

Query: 1043 KSLKISSSDAYVLFY 1057
               ++    AY+LFY
Sbjct: 454  ---EVLKEQAYLLFY 465

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 102/247 (41%), Gaps = 55/247 (22%)

Query: 600 SITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNML 659
            ++GL N+G+TC+++S++QCL     F    +S  + +  +    ++  S  L   +  L
Sbjct: 135 GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNKCKVGSPDKCFSCALDKIIQEL 194

Query: 660 F-----DKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD-----QQDTQEFLMILLDRLHD 709
           +     D+   +   +   TGF+ +   L    KI  +     QQD  EF   +++++H 
Sbjct: 195 YGVLNTDQPSPSSSATNRQTGFIYL---LTCAWKINQNLAGYSQQDAHEFWQFIINQIHQ 251

Query: 710 ELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 769
             +      +D PN    D    +V+NK  +              +  +F+G +E+S+ C
Sbjct: 252 SYT------HDSPNAKEID----RVNNKRCE------------CIVHSVFEGSLESSIVC 289

Query: 770 KRC---GYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGEN 826
             C     TT +   F  LSL I  +               KL +C++ F   E L   N
Sbjct: 290 PGCQKNSKTTID--PFMDLSLDIKDKK--------------KLYECLDSFHKKEQLKDFN 333

Query: 827 AWDCPRC 833
            + C  C
Sbjct: 334 -YHCGEC 339

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 57/128 (44%), Gaps = 24/128 (18%)

Query: 940  VKTINFVTLPKILVIHLSRFYYDLTKKN---NTVITYPLILNII-------LKNNDTMKY 989
            +K +    LP +LV+ L RF + +   N   N  ITYP  LN+         ++   M Y
Sbjct: 334  IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 990  RLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISS 1049
             L  V++  G++  GHYT +          +   +W+ F+D ++ +  +        +  
Sbjct: 394  ELVAVISQEGSVNQGHYTCM--------CKVPGGQWFRFNDTMIVSITEE------DVLR 439

Query: 1050 SDAYVLFY 1057
              AY+LFY
Sbjct: 440  QQAYLLFY 447

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 91/250 (36%), Gaps = 70/250 (28%)

Query: 600 SITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKY--KSYLQQSRGNRLHSPRLSNSLN 657
            + GL N+G+TC+++S+IQ L          + + Y  K  + Q+  +R      S+  +
Sbjct: 134 GLCGLVNMGSTCFMSSIIQTL----------VHNPYVLKQCMNQNHYSRCDIQDSSSCFS 183

Query: 658 MLFDKMYLNGGCSVVPTGFLKVVNQLRP--DLKIPD----------DQQDTQEFLMILLD 705
              D++ +N      PT      +Q R   DL +             QQD  EFL   L+
Sbjct: 184 CALDQIVMN---FYGPTSDATFTSQQRGFVDLLLCSWKTNKNLAGYSQQDAHEFLQFFLN 240

Query: 706 RLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
           +LH                    AD ++V+    K         N    +   FQG + +
Sbjct: 241 QLH--------------------ADHVRVAQTNVK-------AENCNCILHTAFQGSLRS 273

Query: 766 SLQCKRC-GYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSG 824
           S+ C  C   +   +     LSL I  +S               L +C+  F   E L+ 
Sbjct: 274 SILCTDCQDGSNITFDPMMDLSLDIKNKS--------------TLVECLQSFHKGERLTD 319

Query: 825 ENAWDCPRCG 834
            N   C  CG
Sbjct: 320 FNH-HCSSCG 328

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 88/233 (37%), Gaps = 61/233 (26%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            G RN G TCY+NS++Q  F  K FR L      ++           SP  +NS+ +   
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTEN----------ESP--NNSVPLALQ 250

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDY 721
           + +     S  P   L++      D      Q D QE   IL+DRL + +          
Sbjct: 251 RSFYQLQVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTS------ 304

Query: 722 PNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                   +G+                      +++IF G+M++ ++C    Y +     
Sbjct: 305 -------VEGM----------------------LNEIFVGKMKSYIKCIDVDYESSRVED 335

Query: 782 FYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 834
           F+ L L +  ++MK             L++  + +   E+L+GEN +     G
Sbjct: 336 FWDLQLNV--KNMK------------GLKESFDNYIEIELLNGENQYQAQDYG 374

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 48/104 (46%), Gaps = 18/104 (17%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNIILKNNDTMK-------Y 989
            K + F + P +L + L RF YD       K N    +P  +++     D+ K       Y
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVY 439

Query: 990  RLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
             L GV+ H G + +GHY +L+   LE        +WY FDDE V
Sbjct: 440  NLHGVLVHAGDISTGHYYTLIKPGLE-------DQWYRFDDERV 476

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 85/245 (34%), Gaps = 79/245 (32%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKV-------------FRTLFISSKYKSYLQQSRGNRLH 648
            GL NLGN+CY+NS +QCLF   V                ++ ++  KS L + R     
Sbjct: 331 CGLINLGNSCYLNSTLQCLFNGGVKGWDTDMLGNSPSLNVVYPANNLKSQLTKLRTALKE 390

Query: 649 SPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLH 708
            P +           Y  G   + P  F K +     +      QQD  EF    +D L 
Sbjct: 391 EPTI-----------YKQG---IRPKSFKKCIGGSHEEFS-SGRQQDALEFFTYFVDEL- 434

Query: 709 DELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQ 768
                                              DK +  N     +D+ +  ME+ LQ
Sbjct: 435 -----------------------------------DKKLFKNSDYNPNDLMKFMMEDRLQ 459

Query: 769 CKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAW 828
           C+ C    ++  T  V+ L           L   N+ +  LE+ IN + S EV+     +
Sbjct: 460 CQECHGVKYSTETSNVIQLP----------LQESNDAQ-DLEERINAYFSGEVIE----F 504

Query: 829 DCPRC 833
            CP C
Sbjct: 505 KCPNC 509

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 57/135 (42%), Gaps = 30/135 (22%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTV---ITYPLILN-------------IILK 982
             +K +    LP +LV+ L RF + L   N  +   I +P  LN             I  K
Sbjct: 345  AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHIGNK 404

Query: 983  NNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSD 1042
                + Y L G+V+H GT+  GHY +           I   +W+ F+D +V +  +    
Sbjct: 405  KVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVSSISQE--- 453

Query: 1043 KSLKISSSDAYVLFY 1057
               ++    AY+LFY
Sbjct: 454  ---EVLKEQAYLLFY 465

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 100/255 (39%), Gaps = 71/255 (27%)

Query: 600 SITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNML 659
            ++GL N+G+TC+++S++QCL     F         K  + QS  N+       N  +  
Sbjct: 135 GLSGLINMGSTCFMSSILQCLIHNPYF--------IKHSMSQSHFNKCKVRSPDNCFSCA 186

Query: 660 FDKMY------LN-------GGCSVVPTGFLKVVNQLRPDLKIPDD-----QQDTQEFLM 701
            DK+       LN          +    GF+ +   L    KI  +     QQD  EF  
Sbjct: 187 LDKIVHELYGVLNTDQPPSSSSATNRQAGFIYL---LTCAWKINQNLAGYSQQDAHEFWQ 243

Query: 702 ILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQG 761
            +++++H     Q +V +  P            S KE     DK  I +    +  +F+G
Sbjct: 244 FIINQIH-----QNYVLS-LP------------STKES----DKENIKHCDCIVHTVFEG 281

Query: 762 QMENSLQCKRC---GYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTS 818
            +E+S+ C  C     TT +   F  LSL I  +               KL +C++ F  
Sbjct: 282 SLESSIVCPSCQNNSKTTID--PFMDLSLDIKDKK--------------KLYECLDSFHK 325

Query: 819 DEVLSGENAWDCPRC 833
            E+L   N + C  C
Sbjct: 326 KELLKDFN-YHCGEC 339

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 106/258 (41%), Gaps = 44/258 (17%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLF 660
           I GL N GNTC++NS++Q L ++K     F+ +  ++   ++ G+   +  L   L ++ 
Sbjct: 57  IAGLVNDGNTCFMNSVLQSLASSKEL-AAFLDNVIENG-SENNGDIKFTETLRELL-LIL 113

Query: 661 DKMYLNGGCSVVPTGFLKVV-NQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHV-- 717
           +K Y            LK + N    ++ +  DQ+D QEF   +L  L   +  +P    
Sbjct: 114 NKKYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLEKNIK-KPSTEK 172

Query: 718 --------ANDYPNLLLYDADGLKVSNKEY---KHWFDKNVIGNG----------ISPID 756
                    +D P+  L   D L      Y   +     +V+ N           I+P+D
Sbjct: 173 KEERNNIKESDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVLENPDQKLYSPFKLITPLD 232

Query: 757 DIFQGQMENSLQCKRCGYT-TFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINM 815
               G     + C  CG      YS F  LSL +P  S+        N+  +KL + +N 
Sbjct: 233 ----GITAERIGCLTCGENGGIRYSVFSGLSLNLPSESL--------NQSTLKLSELLNE 280

Query: 816 FTSDEVLSGENAWDCPRC 833
           +   E++ G    +C RC
Sbjct: 281 WVKPEIIEG---VECNRC 295

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 78/191 (40%), Gaps = 41/191 (21%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKV--FRTLFISSKYKSYLQQSRGN-RLHSPRLSNSLNM 658
            GL NLGN+CY+NS++Q L    V  +   F+ S++   +     N +    +L N++  
Sbjct: 323 CGLINLGNSCYLNSVLQSLLNGGVPNWSLDFLGSEFPLDVVYPASNLKCQWIKLLNAMKC 382

Query: 659 LFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVA 718
              ++Y NG   + PT F K V +   +    + QQD  EFL  L D L  +  +    A
Sbjct: 383 E-PEIYPNG---IKPTTFKKCVGKSHEEFS-SNRQQDAMEFLTFLSDLLDRKFFSDSSSA 437

Query: 719 NDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 778
           +  PN                                 D+ +  ME+ LQC +CG   ++
Sbjct: 438 DSNPN---------------------------------DLVRFMMEDRLQCNKCGKVKYS 464

Query: 779 YSTFYVLSLAI 789
           Y     + L +
Sbjct: 465 YEPAEAIQLPL 475

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 90/235 (38%), Gaps = 61/235 (25%)

Query: 600 SITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNML 659
              GL+N G TCY+NS++Q  +  K FR L        Y   + G    +P  SNS+ + 
Sbjct: 197 GFVGLKNQGATCYLNSLLQSYYFTKYFRKLV-------YHIPTDG---ETP--SNSVPLA 244

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719
             + +     S  P    ++      D      Q D QE   IL+DRL ++         
Sbjct: 245 LQRAFYKLQRSSEPLDTFELTRSFGWDTGDAFTQHDVQELNRILMDRLENK--------- 295

Query: 720 DYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY 779
                       +K +  E K              +++IF G+M++ ++C    Y +   
Sbjct: 296 ------------MKATEVEGK--------------LNEIFVGKMKSYIKCVNVEYESSRV 329

Query: 780 STFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 834
             F+ + L +      L+ L +  E  +++          E++ GEN +   R G
Sbjct: 330 EDFWDIQLNVK----GLNGLNQAFENYIEV----------EMMDGENQYAAQRYG 370

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (48%), Gaps = 19/105 (18%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNI-------ILK-NNDTMK 988
            K + F + P +L + L RF YD       K N    +P  +++       + K   ++M 
Sbjct: 376  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMM 435

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
            Y L GV+ HTG + +GHY +++   L+        KWY FDD+ V
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIKPGLD-------DKWYRFDDDKV 473

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
            Anc_7.390 YBL067C
          Length = 715

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 15/100 (15%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNI-ILKNNDTMK-YRLFGV 994
            + +    LP+ L++HL RF Y   + +N      I YPL+L +    N+D  K Y L G+
Sbjct: 513  RIVGLKKLPETLILHLKRFKYSEEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTGI 572

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
            V H G     GHY S+   +        +  W  FDDEVV
Sbjct: 573  VLHLGGGPQHGHYVSICKNE--------KYGWLLFDDEVV 604

 Score = 35.8 bits (81), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 5/45 (11%)

Query: 583 VYHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFR 627
           +  I  +  SSN      + G  N GNTCY NS++QCL+     R
Sbjct: 98  LLEITKLSDSSNK-----VFGYENFGNTCYCNSVLQCLYNIPELR 137

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 59/140 (42%), Gaps = 32/140 (22%)

Query: 694 QDTQEFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGIS 753
           QD  EFL  LL+++ D + +  +  N+       +  GLK         F++N I     
Sbjct: 398 QDAHEFLNFLLNQISDNIESNMNNPNNDNG----EFGGLK---------FERNFI----- 439

Query: 754 PIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCI 813
             +D+FQG ++ + +C  C   T     F   ++ +             N +   +++ +
Sbjct: 440 --NDLFQGVIKYTTRCLTCDNITSREELFLDFAIEV------------SNNEETNIQEIL 485

Query: 814 NMFTSDEVLSGENAWDCPRC 833
             ++  E+L+G N + C  C
Sbjct: 486 GDYSQREMLNGSNKFFCDCC 505

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 56/121 (46%), Gaps = 20/121 (16%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILN--------IILKNNDTMK 988
            K + F + P++L + L RF YD       K N    +P  ++        ++ K      
Sbjct: 436  KGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNN 495

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKADKKHGSDKSLKI 1047
            Y L GV+ HTG + +GHY +++    +        KWY FDDE V +  KK   D++  +
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKPTTD-------DKWYRFDDEKVWRVTKKQVFDENFGL 548

Query: 1048 S 1048
            +
Sbjct: 549  N 549

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/233 (21%), Positives = 80/233 (34%), Gaps = 61/233 (26%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            G RN G TCY+NS++Q  F  K FR L     Y+        N        +S+ +   
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLV----YQIPTADENPN--------DSVALALQ 306

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDY 721
           + +     S  P   L++      D      Q D QE   IL+DRL   +          
Sbjct: 307 RAFYQLQVSNYPLDTLELTRSFGWDTAEAFTQHDVQELNRILMDRLESRMK--------- 357

Query: 722 PNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                    G  V  K                 + D+F G+M++ ++C    Y +     
Sbjct: 358 ---------GTSVEGK-----------------LTDVFVGKMKSYIKCVNIDYESSRVED 391

Query: 782 FYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 834
           F+ + L +      L  L    E  +++          E++ GEN +     G
Sbjct: 392 FWDIQLNVK----GLEGLANAFENYIEV----------ELMDGENQYAAQDYG 430

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 63/130 (48%), Gaps = 21/130 (16%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLT--KKNNTVITYPLILNIILKNNDTM-----KYRL 991
             +K+   +  P+ LV+HL +F ++ T   K    ++YP+ L++    ++++     +Y+L
Sbjct: 582  ALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCHESISSLPVRYQL 641

Query: 992  FGVVNHTG-TLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSS 1050
              VV H G +L SGHY +   +            W  +DDE +       S+K L +   
Sbjct: 642  ISVVVHEGRSLSSGHYIAHCKQP--------DGSWATYDDEYINKI----SEKQL-LKEP 688

Query: 1051 DAYVLFYERV 1060
            +AY L Y R+
Sbjct: 689  NAYFLVYTRL 698

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 7/108 (6%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDK 662
           G +N+GNTCY+N+ +Q LF     R L ++   K++   +  + +H  +L   L   F+ 
Sbjct: 109 GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLNPQDEMHH-KLILELKHCFES 167

Query: 663 MYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILL 704
           +      SV+P   + V+ ++ P     D       QQD +E    L 
Sbjct: 168 LKQKNYQSVLPIVLINVLRKVYPQFAERDPQAGFYKQQDAEELFTQLF 215

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 58/137 (42%), Gaps = 32/137 (23%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTV---ITYPLILNII-------------LK 982
             +K +    LP +LV+ L RF + L   N  +   I +P  LN+              + 
Sbjct: 345  AIKQLGIHRLPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESESENHIG 404

Query: 983  NNDT--MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHG 1040
            N     + Y L G+V+H GT+  GHY +           I   +W+ F+D +V +  +  
Sbjct: 405  NGKVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVSSISQE- 455

Query: 1041 SDKSLKISSSDAYVLFY 1057
                 ++    AY+LFY
Sbjct: 456  -----EVLKEQAYLLFY 467

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
            complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 56/126 (44%), Gaps = 23/126 (18%)

Query: 948  LPKILVIHLSRFYYDLTKKNNT----VITYPLILNIILKNNDTMK--YRLFGVVNHTGTL 1001
            LPK L IHL RF Y      N      I YP+ L +    ++++   Y L G+V H G  
Sbjct: 527  LPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGLVVHIGIG 586

Query: 1002 IS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKI-----SSSDAYVL 1055
               GHY S+         D G   W  FDDE V+   +   D  L       S+  AYVL
Sbjct: 587  PQHGHYISVC-----KTSDYG---WLLFDDETVECISE---DTVLSFVGDSNSAGTAYVL 635

Query: 1056 FYERVH 1061
            FY+ ++
Sbjct: 636  FYKEIN 641

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           + GL N GNTCY NS++QCL+    FR
Sbjct: 130 VYGLENFGNTCYCNSILQCLYNMNEFR 156

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 65/163 (39%), Gaps = 36/163 (22%)

Query: 671 VVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDYPNLLLYDAD 730
           + P GF+++V +    L   D  QD  EFL  LL+ + D L      AN   N       
Sbjct: 386 ISPGGFMEIVKKENI-LFATDMHQDAHEFLNFLLNDVSDYLDK----ANTEKNP------ 434

Query: 731 GLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIP 790
                        D    GN  + ++DIF+G + N ++C  C   T  Y +F    + + 
Sbjct: 435 -------------DNTRSGNETNFVNDIFKGTITNQIRCLTCDTVTSRYESFLDFPIEV- 480

Query: 791 RRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
                   +G   ++ + ++  +  +   E+L G N + C  C
Sbjct: 481 --------IG---DETIDIQKMMISYHQKEMLQGSNKFYCGTC 512

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
            (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 63/128 (49%), Gaps = 27/128 (21%)

Query: 948  LPKILVIHLSRFYYDLTKKNNT------VITYPLILNI--ILKNNDTMKYRLFGVVNHTG 999
            LPKIL +HL RF Y  +++NN        ITYP  L++      + + KY L G++ H G
Sbjct: 549  LPKILSLHLKRFKY--SEENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLG 606

Query: 1000 TLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKA--DK---KHGSDKSLKISSSDAY 1053
                 GHY ++   +        +  W  +DDE V+A  +K   +H  D +     + AY
Sbjct: 607  AGPQHGHYVAMCKTE--------KFGWLLYDDETVEAVLEKDVLRHVGDSN---DLATAY 655

Query: 1054 VLFYERVH 1061
            +LFY+ + 
Sbjct: 656  ILFYKTIE 663

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFI 631
           S  + G  N GNTCY NS++QCL+     R   I
Sbjct: 123 STKVFGFENFGNTCYCNSVLQCLYNFSELRDNLI 156

 Score = 35.8 bits (81), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 51/140 (36%), Gaps = 39/140 (27%)

Query: 694 QDTQEFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGIS 753
           QD  EFL  LL+ L + +                D   LK+   E    F KN       
Sbjct: 434 QDAHEFLNFLLNELSEYI----------------DRSNLKIEETEKTENFIKN------- 470

Query: 754 PIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCI 813
               IFQG + N ++C  C   T     F  L + +  R          NE  +K    +
Sbjct: 471 ----IFQGTLTNKIRCLTCDNVTSRDEPFLDLPIEVKSR----------NETDIK--KAL 514

Query: 814 NMFTSDEVLSGENAWDCPRC 833
           + +   E+L+G N + C  C
Sbjct: 515 SNYHQREMLNGSNKFYCDGC 534

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 19/105 (18%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILN--------IILKNNDTMK 988
            K + F + P +L + L RF YD       K N    +P  ++        I   N D+  
Sbjct: 383  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADSYI 442

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
            Y L GV+ HTG + +GHY +++   +E        +WY FDD+ V
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKPSIE-------DQWYRFDDDKV 480

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 87/234 (37%), Gaps = 63/234 (26%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            G +N G TCY+NS++Q  F  K FR L         + Q   ++  SP  +NS+ +   
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKL---------VYQIPTDK-ESP--NNSVPLALQ 253

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDY 721
           + +     S  P   L++      D      Q D QE   IL+DRL +++          
Sbjct: 254 RAFFQLQKSNEPLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKGT------- 306

Query: 722 PNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                 D DG                       ++++F G+M + ++C    Y +     
Sbjct: 307 ------DVDG----------------------KLNEVFVGKMRSYIKCVNVDYESSRVED 338

Query: 782 FYVLSLAIPRRSMKLSKLGRPNEKRVK-LEDCINMFTSDEVLSGENAWDCPRCG 834
           F+ + L               N K ++ L++    +   E++ GEN +     G
Sbjct: 339 FWDIQL---------------NVKNLRGLQESFKNYIEVEMMDGENQYAAQGYG 377

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 51/122 (41%), Gaps = 15/122 (12%)

Query: 948  LPKILVIHLSRFYYDLTKKNN----TVITYPLILNI--ILKNNDTMKYRLFGVVNHTGTL 1001
            LPK L +HL RF Y   K  N      I YP  L +     +  + +Y L   V H G  
Sbjct: 512  LPKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLSKRYELASAVIHLGDG 571

Query: 1002 IS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSDAYVLFYERV 1060
               GHY SL   +       G   W  FDDE V+A  +         +S  AYVLFY  V
Sbjct: 572  PQYGHYISLCKTET-----FG---WLLFDDETVEAVDEQTVLSFTGENSDTAYVLFYNEV 623

Query: 1061 HD 1062
             +
Sbjct: 624  SE 625

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 21/32 (65%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFIS 632
           I G  N GNTCY NS++QC F   VFRT  +S
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFRTSMLS 157

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 34/79 (43%), Gaps = 12/79 (15%)

Query: 755 IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCIN 814
           + DIFQG + N ++C  C   T     F   ++ +              ++ + ++  + 
Sbjct: 431 VQDIFQGSLTNQIRCYTCDSITSTEEPFLDFAIEVKE------------DENLNIQRHLE 478

Query: 815 MFTSDEVLSGENAWDCPRC 833
            F   E+L+G + + C RC
Sbjct: 479 SFHQRELLNGSDKFYCDRC 497

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 86/234 (36%), Gaps = 63/234 (26%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            G +N G TCY+NS++Q  F  K FR L                 + SP  +NS+ +   
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYEIP----------TDMDSP--NNSVPLALQ 250

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDY 721
           + +     S  P   L++      D      Q D QE   IL+DRL + +   P      
Sbjct: 251 RAFYQLQVSNEPLDTLELTRSFGWDNGDAFTQHDVQELNRILMDRLENRMKETP------ 304

Query: 722 PNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                       V  K                 ++++F G+M++ ++C    Y +     
Sbjct: 305 ------------VEGK-----------------LNELFVGKMKSYIKCINVDYESSRVED 335

Query: 782 FYVLSLAIPRRSMKLSKLGRPNEKRVK-LEDCINMFTSDEVLSGENAWDCPRCG 834
           F+ L L               N K +K LE+  + +   E+++GEN +     G
Sbjct: 336 FWDLQL---------------NVKNLKGLEESFSNYIEIELMNGENQYAAQDYG 374

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 54/121 (44%), Gaps = 21/121 (17%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNII---------LKNNDTM 987
            K + F + P +L + L RF YD       K N    +P  +++          L N +  
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEAC 439

Query: 988  KYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKADKKHGSDKSLK 1046
             Y L GV+ H G + +GHY +++   +         +WY FDD+ V +  KK   D++  
Sbjct: 440  IYNLHGVLVHAGDISTGHYYTMIRPGVS-------DEWYRFDDDKVWRVTKKQAFDENFG 492

Query: 1047 I 1047
            +
Sbjct: 493  L 493

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 8/111 (7%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDK 662
           G+ NLGNTCY+N+ +Q LF     R   +    K  +++  G   +  +L   L + F K
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIKE--GVDTYHAQLVRELKVTFQK 160

Query: 663 MYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILLDRL 707
           +    G ++ P   L+++ ++ P     D       QQD +E    L   L
Sbjct: 161 LKDRKGENITPLLLLEILRRVFPQFSETDPQGGFYKQQDAEELFTQLFHTL 211

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 9/77 (11%)

Query: 984  NDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSD 1042
            N +  Y L GV+ H G    SGHY + +  D +        KWY FDD+ V A +K   +
Sbjct: 410  NPSCIYDLIGVITHQGANSESGHYQAFIRDDADE-------KWYRFDDDKVTAIEKEKIE 462

Query: 1043 KSLKISSSD-AYVLFYE 1058
                   SD A +L Y+
Sbjct: 463  SLAGGGESDSALILIYK 479

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 89/241 (36%), Gaps = 68/241 (28%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRL------HSPRLSNS 655
            GL NLGN+CY+NS++Q LFA  V       S++   L  + G          S  +   
Sbjct: 319 CGLINLGNSCYLNSILQALFAQDV-------SQWADVLMDTIGKDFPVDVVYPSNNVKCQ 371

Query: 656 LNMLFDKMYLNGG---CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 712
           L  L + M +N       + P  F   + Q   +    + QQD  EFL   ++ L  +L 
Sbjct: 372 LIKLLNAMKINPSRYPEGIKPRSFKNCIGQNNKEF-TSNKQQDALEFLSYFVNELDKKL- 429

Query: 713 NQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 772
                                         F K +   G     D+ +  ME+ LQC RC
Sbjct: 430 ------------------------------FKKELTNPG-----DLMRCYMEDRLQCLRC 454

Query: 773 GYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPR 832
            +  ++Y     + L +   +        P + R +L+     F   EV+     ++CP 
Sbjct: 455 KHVKYSYQANESIQLPLKDNN-------EPQDIRERLD----AFFKGEVIE----FNCPH 499

Query: 833 C 833
           C
Sbjct: 500 C 500

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 12/74 (16%)

Query: 989  YRLFGVVNHTGTLI-SGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKI 1047
            Y+L GVV H GT + SGHY + + K ++ NV+    +W  ++DE +        D + +I
Sbjct: 707  YKLTGVVCHKGTSVHSGHYVAFIKKIVD-NVE----RWVLYNDEKIVL-----GDDTAEI 756

Query: 1048 SSSDAYVLFYERVH 1061
               + Y+ FY RV 
Sbjct: 757  -KKNGYIYFYSRVE 769

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 20/112 (17%)

Query: 941  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIILKNNDTMK- 988
            K + F + P +L + L RF YD     L K N+      ++   P + +  L+ N   K 
Sbjct: 380  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKI 439

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKADKKH 1039
            Y+L GV+ HTG + +GHY +L+           + +WY FDD+ V +A KK 
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKPST-------KDEWYRFDDDRVWRATKKQ 484

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 83/217 (38%), Gaps = 49/217 (22%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            G RN G TCY+NS++Q  +  K FR L        Y   + G    +P  ++S+ +   
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLV-------YQIPTEG---ENP--NDSVTLALQ 250

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDY 721
           + +     S  P   +++      D      Q D QE   IL+DRL   +          
Sbjct: 251 RAFYQLQVSQFPLDTMELTRSFGWDNAEAFTQHDVQELNRILMDRLETRMK--------- 301

Query: 722 PNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                    G  V  K                 I+++F G+M++ ++C    Y +     
Sbjct: 302 ---------GTSVEGK-----------------INELFVGKMKSYIRCINVDYQSVRTED 335

Query: 782 FYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTS 818
           F+ + L +  ++M+  +    N   V+L D  N + +
Sbjct: 336 FWDIQLNV--KNMRDLQTSFENYIEVELMDGENQYAA 370

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 85/217 (39%), Gaps = 49/217 (22%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            GL+N G TCY+NS++Q  +  K FR L        Y   + G    +P  +NS+++   
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLV-------YQIPTEG---ETP--ANSVSLALQ 237

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDY 721
           + +     S  P    ++      D      Q D QE   IL+DRL +++          
Sbjct: 238 RAFFQLQRSSEPLDTCELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMK--------- 288

Query: 722 PNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                    G +V  K                 ++ +F G+M++ ++C    Y +     
Sbjct: 289 ---------GTEVEGK-----------------LNGLFVGKMKSYIKCVNVDYESSRVED 322

Query: 782 FYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTS 818
           F+ + L +  + +K  +    N   V++ D  N + +
Sbjct: 323 FWDIQLNV--KGLKGLQQSFENYIEVEMMDGENQYAA 357

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 50/105 (47%), Gaps = 19/105 (18%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNI-------ILKNNDT-MK 988
            K + F + P +L + L RF YD       K N    +P  +++       + +++    K
Sbjct: 367  KGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVQEDSPANAK 426

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
            Y L GV+ HTG + +GHY +++   LE         WY FDD+ V
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIKPGLE-------DAWYRFDDDKV 464

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 59/126 (46%), Gaps = 22/126 (17%)

Query: 940  VKTINFVTLPKILVIHLSRFYYDLTKKN---NTVITYPLILNIIL-----KNNDTMKYRL 991
            +K +    L   LV+ L RF +  + +N   N  + +PL L++       +   ++ YRL
Sbjct: 339  IKQLTIERLAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRL 398

Query: 992  FGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISSSD 1051
             GVV+H+GT+  GHYT+++         +   +W+ F+D ++             +    
Sbjct: 399  SGVVSHSGTVNEGHYTAVLQ--------LNSGEWFKFNDSMISVVSAE------DVLREQ 444

Query: 1052 AYVLFY 1057
            AY+L Y
Sbjct: 445  AYLLLY 450

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 97/239 (40%), Gaps = 52/239 (21%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR--LSNSLNMLF 660
           GL NLG+TC+++S++Q L      +  F++S +      +R   L  P   +S +L+ + 
Sbjct: 138 GLLNLGSTCFMSSILQSLIHNTYIQYWFLNSGH------ARRCALRDPSSCISCALDRII 191

Query: 661 DKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD-----QQDTQEFLMILLDRLHDELSNQP 715
            + Y +        GFL +   L    KI  +     QQD  EFL  LL++LH +   + 
Sbjct: 192 SECYGSLSERNDHAGFLSL---LTCSWKINQNFAGYSQQDAHEFLQFLLNQLHCDYKRER 248

Query: 716 HVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYT 775
            V  D           ++ S+ +  H             +   FQG + +S+ C  C   
Sbjct: 249 QVDEDKE---------VRSSSSQLCHCI-----------VHSSFQGTLRSSIVCPECQDD 288

Query: 776 TFNY-STFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           +      F  LSL I              + +  L DC++ F   E L  +  + CPRC
Sbjct: 289 SKTMLDPFLDLSLDI--------------KGQRTLYDCLDSFHRREQLH-DFDYHCPRC 332

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 56/133 (42%), Gaps = 25/133 (18%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 994
            + +    LPK L +HL RF Y   +  N      + YPL L++    N  +  +Y L G+
Sbjct: 952  RIVGLKQLPKTLSLHLKRFKYSEEQNCNIKLFNKVNYPLYLDVSSSFNPNINKRYELNGI 1011

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKH------GSDKSLKI 1047
            V H G     GHY ++   D        +  W   DDE V+   +       G  K L  
Sbjct: 1012 VVHMGGGPQHGHYVAICKND--------KFGWLLMDDETVETISEETVLRCKGDSKDL-- 1061

Query: 1048 SSSDAYVLFYERV 1060
              + AYVLFY+  
Sbjct: 1062 --TTAYVLFYKEC 1072

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 17/26 (65%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRT 628
           G  N GNTCY NS++QCL+     RT
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRT 542

 Score = 32.7 bits (73), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 58/148 (39%), Gaps = 22/148 (14%)

Query: 694 QDTQEFLMILLDRLHD-------ELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKN 746
           QD  EFL  LL+ L D       E + +  +AN+ PN   ++   L  S+       + N
Sbjct: 813 QDAHEFLNFLLNELSDYMIKCINEENLKKTIANN-PNTDTHNT--LTQSHTSNNQQEEDN 869

Query: 747 VIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKR 806
            +      I D+F+G + N  +C  C   T     F    + +             ++  
Sbjct: 870 NLPRMSDFISDLFRGTLINKTRCLTCDNVTSREEPFLDFPIEVK------------DDTE 917

Query: 807 VKLEDCINMFTSDEVLSGENAWDCPRCG 834
             ++  +  +   E+L+G N + C  CG
Sbjct: 918 TNIQTELKSYHQREMLNGSNKFYCDECG 945

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 87/234 (37%), Gaps = 63/234 (26%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
            G +N G TCY+NS++Q  F  K FR L      ++           SP  +NS+ +   
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYQIPTEN----------DSP--NNSVPLALQ 240

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDY 721
           + +     S  P   L++      D      Q D QE   IL+DRL +++   P      
Sbjct: 241 RAFYQLQVSDEPLDTLELTRSFGWDSGDAFTQHDVQELNRILMDRLENKMKGTP------ 294

Query: 722 PNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 781
                       V +K                 +++IF G+M++ ++C    Y +     
Sbjct: 295 ------------VEDK-----------------LNEIFVGRMKSYIKCINVDYESSRVEE 325

Query: 782 FYVLSLAIPRRSMKLSKLGRPNEKRVK-LEDCINMFTSDEVLSGENAWDCPRCG 834
           F+ L +               N K +K L+     +   E+++GEN +     G
Sbjct: 326 FWDLQM---------------NVKNLKDLKSSFENYIEIELMNGENQYAAQDYG 364

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 20/106 (18%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNII-----LKNNDTMK--- 988
            K + F + P +L + L RF YD       K N    +P  +++      +   DT     
Sbjct: 370  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPC 429

Query: 989  -YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
             Y+L GV+ H G + +GHY +++    E        +WY FDDE V
Sbjct: 430  IYKLHGVLVHAGDISTGHYYAMIKPSTE-------DQWYRFDDEKV 468

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 101/244 (41%), Gaps = 54/244 (22%)

Query: 600 SITGLRNLGNTCYINSMIQCLFAAKVF-RTLFISSKYKSYLQQSRGNRLHSP--RLSNSL 656
            ++GL N+G+TCY++ +IQCL     F +  F  + YK         ++  P   LS +L
Sbjct: 135 GLSGLVNMGSTCYMSCIIQCLVRNPYFLKHSFNQTHYKEC-------KIRDPVSCLSCAL 187

Query: 657 NMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD-----QQDTQEFLMILLDRLHDEL 711
           + +  ++Y       V      +++ L    KI +D     QQD  EF   L++R+H E 
Sbjct: 188 DSVVFELYGKTQKKAVDDKNGGLIDILNCTWKINEDLVGYSQQDAHEFWQFLMNRIHSE- 246

Query: 712 SNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKR 771
                                K++N   +   D + + N I     +FQG +E++++C  
Sbjct: 247 --------------------YKLNNNTIEVPKDTHQLCNCI--YHKVFQGFLESTIECAN 284

Query: 772 CGYTTFNYSTFYV-LSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDC 830
           C   +   +  Y+ LSL +  +                L +C+N F   E L  +  + C
Sbjct: 285 CRKESKTTTEAYMDLSLDLKDKKT--------------LYECLNSFHMKEELK-DFTFHC 329

Query: 831 PRCG 834
             CG
Sbjct: 330 SNCG 333

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 23/110 (20%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNI----ILKNNDTMK--- 988
             +K +    LP +L++ L RF + L   + K N  I YP  L +       +N+T+    
Sbjct: 338  ALKQLTISKLPPVLLLQLKRFEHKLNGQSSKLNDSIEYPPYLRMNDYCQTSSNETIDSPD 397

Query: 989  -----YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
                 Y L GV+ HTGT+  GHY          +  +  ++W  F+D ++
Sbjct: 398  DSDIIYELIGVICHTGTVNEGHYIC--------SCKLANNQWVKFNDSMI 439

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 82/218 (37%), Gaps = 49/218 (22%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDK 662
           G +N G TCY+NS++Q  F  K+FR +     YK        N   S  L  S  +L   
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMV----YKIPSDNESPNDSVSLALQRSFYLL--- 255

Query: 663 MYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDYP 722
                  S  P   L++      D      Q D QE   IL+DRL   +           
Sbjct: 256 -----EKSKEPLDTLELTRSFGWDTGEAFTQHDVQELNRILMDRLETRMK---------- 300

Query: 723 NLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTF 782
                   G +V                    ++D+F G+M++ ++C    Y +F    F
Sbjct: 301 --------GTEVE-----------------GTLNDLFVGKMKSYIRCVNVDYESFRVEDF 335

Query: 783 YVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDE 820
           + + L +  +++K  K    N   V++ D  N + + +
Sbjct: 336 WDIQLNV--KNLKDVKESFENYVEVEMMDGENQYAAQD 371

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 56/118 (47%), Gaps = 20/118 (16%)

Query: 941  KTINFVTLPKILVIHLSRFYYD-----LTKKNN-----TVITYPLILNIILKNN--DTMK 988
            K + F + P +L + L RF YD     L K N+       I     L+  +K+N  +T  
Sbjct: 379  KGVVFESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPYLDPDVKDNYPNTCI 438

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKADKKHGSDKSL 1045
            Y L  V+ H+G + +GHY +++  ++         +W+ FDD+ V K  K    D++ 
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKPNV-------TDQWFRFDDDKVWKVTKTQAFDENF 489

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
            YBL067C
          Length = 714

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 59/129 (45%), Gaps = 17/129 (13%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNNT----VITYPLILNIILKNNDTM--KYRLFG- 993
            + +    LP  L +HL RF Y   K  NT     I YPLIL++    ND++  KY L   
Sbjct: 497  RIVGLKKLPHTLALHLKRFKYLEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELISI 556

Query: 994  VVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLK--ISSSD 1051
            VV+  G    GHY S+   D        +  W  FDDE V++  +    K +      + 
Sbjct: 557  VVHLGGGPHHGHYVSICKSD--------KFGWLLFDDETVESINEETVLKFVGDPEDQTT 608

Query: 1052 AYVLFYERV 1060
            AYVLFY  +
Sbjct: 609  AYVLFYREI 617

 Score = 39.7 bits (91), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 18/27 (66%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           I G  N GNTCY NS++QCLF    FR
Sbjct: 121 IFGYENFGNTCYCNSILQCLFFLDDFR 147

 Score = 38.5 bits (88), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 57/141 (40%), Gaps = 46/141 (32%)

Query: 693 QQDTQEFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGI 752
           QQD  EFL  LL+ L+D                      L++SN       +KN I    
Sbjct: 395 QQDAHEFLNFLLNELND---------------------FLQLSN-------EKNFIL--- 423

Query: 753 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDC 812
               D FQG + N ++C  C   T N   F    + +           + +++ + ++D 
Sbjct: 424 ----DQFQGTLTNQIKCLTCDTLTSNNEPFLDFPIEV-----------KNDDEDLNIQDI 468

Query: 813 INMFTSDEVLSGENAWDCPRC 833
           +N +   E+L+G N + C +C
Sbjct: 469 LNKYHQREILNGTNKFYCNQC 489

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 78/202 (38%), Gaps = 48/202 (23%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
           TGL N GN C+INS IQ L       T      Y S   +        P  +    ML +
Sbjct: 76  TGLVNPGNDCFINSSIQALVPLDKLTT------YLSATLEDEKTASTLPLHNGLATMLLE 129

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDL--KIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719
              L      V +   + + QL      KI   Q D  EF  ++L+RL++E         
Sbjct: 130 LQQLRSDPKSVSSK--RFIQQLETIFGGKISRQQNDAHEFTQLILERLNEE--------- 178

Query: 720 DYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTT-FN 778
              NL L  AD                        +   F+G + N L C +CG T+  N
Sbjct: 179 ---NLTLDHAD------------------------LTVPFKGIVGNHLVCLQCGRTSHVN 211

Query: 779 YSTFYVLSLAIPRR-SMKLSKL 799
              FY+  L +P++ S+KLS L
Sbjct: 212 EQPFYIYELTLPQQGSVKLSDL 233

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLT--KKNNTVITYP---LILNIILKNN-----D 985
            K   V+   F   P+I +IHLSR  ++     +N   + +    L+   ILK++     +
Sbjct: 314  KSVIVRKSTFAEFPEIFLIHLSRSVFNGMNYSRNPCQVEFEEEILLPRQILKDHQCVGFE 373

Query: 986  TMKYRLFGVVNHTGTLISGHY 1006
            T+KY+L  +V HTG+   GHY
Sbjct: 374  TVKYKLKSIVKHTGSHYQGHY 394

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 21/106 (19%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTK---KNNTVITYPLILNI-----ILKNNDT-----M 987
            K +    L  +L+    RF + L+    K N VI +PL LN+     + + +D+     +
Sbjct: 345  KQLAVAKLSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMKDYCDVEQRDDSNSKPDL 404

Query: 988  KYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
             Y L G++ HTGT+  GHYT++          I   +W  F+D +V
Sbjct: 405  IYELIGIICHTGTVNEGHYTAICK--------IPEGQWIKFNDSMV 442

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 77/185 (41%), Gaps = 41/185 (22%)

Query: 600 SITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR--LSNSLN 657
            ++GL N+G+TCY++ +IQCL     F       KY       +  + H P   +S +L+
Sbjct: 135 GLSGLVNMGSTCYVSCIIQCLVRNPYFL------KYSLNQSHFKICKTHDPTTCISCALD 188

Query: 658 MLFDKMYLNGGCS-----VVPTGFLKVVNQLRPDLKIPDD-----QQDTQEFLMILLDRL 707
            +    Y   G S     V  T    +++ L    KI  +     QQD  EF   LL+RL
Sbjct: 189 SIVTDFY---GISDLDDDVKKTNNDGLIDLLTCSWKINQNLAGYSQQDAHEFWQFLLNRL 245

Query: 708 HDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSL 767
           H E  +         N+   D   LK  N E         + N I     +FQG +++S+
Sbjct: 246 HSEYKS---------NIGPTDTAPLKEGNHE---------LCNCI--YHKVFQGFLKSSI 285

Query: 768 QCKRC 772
            C  C
Sbjct: 286 VCPEC 290

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 10/125 (8%)

Query: 590 EQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHS 649
           E +   ++S +  GL+NLGNTCY+NS +Q L+  K  R   ++  YK   ++    + H 
Sbjct: 48  EGAQMQHLSQTPVGLKNLGNTCYMNSTLQALYQIKPLRDEVLN--YKVPREKPSEEQHH- 104

Query: 650 PRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFLMIL 703
            +L + L   F ++      SV P   L ++ +  P     D       QQD +E    +
Sbjct: 105 -QLVSELRRCFQQLKDKPQESVTPMLLLAMLRKCYPQFAERDQESGFYKQQDAEELFTQI 163

Query: 704 LDRLH 708
            + L 
Sbjct: 164 FNSLR 168

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 8/82 (9%)

Query: 978  NIILKNNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
            N+    N +  Y L GV+ H G    SGHY S +  +++ N      KWY F+D+ V   
Sbjct: 369  NLAQGENPSCVYNLIGVITHQGANSESGHYQSFIRDEVDEN------KWYRFNDDKVSII 422

Query: 1037 KKHGSDKSLKISSSD-AYVLFY 1057
            +K   +       SD A +L Y
Sbjct: 423  EKEKIESLAGGGESDSALILIY 444

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 10/87 (11%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLT--KKNNTVITYP--LILN-IILKNND----- 985
            K T VK    V  P++L++HLSR  ++     KN   +T+P  L++N  +L+NN      
Sbjct: 375  KSTIVKRTVSVDSPRVLILHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVR 434

Query: 986  TMKYRLFGVVNHTGTLISGHYTSLVNK 1012
             ++Y+L  ++ H GT   GHY    +K
Sbjct: 435  AVRYKLCAMIKHIGTHSQGHYACFRHK 461

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 52/125 (41%), Gaps = 11/125 (8%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDK 662
           GL+N+GNTCY+N+ +Q LF A   + L +             + +H  ++   L   F+ 
Sbjct: 110 GLQNMGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHY-KIVLELKRTFET 168

Query: 663 MYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILLDRL----HDELS 712
           +      SV+P   L  + +  P     D       QQD +E    L   L     D+ +
Sbjct: 169 LKKRSFKSVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFHTLTVVFGDKFA 228

Query: 713 NQPHV 717
           NQ  +
Sbjct: 229 NQFQI 233

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 8/83 (9%)

Query: 978  NIILKNNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
            N+    N +  Y L GV+ H G    SGHY + +  + + N      KWY F+D+ V   
Sbjct: 415  NLAAGENPSSVYDLIGVITHQGANSESGHYQAFIRDESDEN------KWYKFNDDKVSPI 468

Query: 1037 KKHGSDKSLKISSSD-AYVLFYE 1058
            +K   +       SD A +L Y+
Sbjct: 469  EKEKIEALAGGGESDSALILLYK 491

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 35/135 (25%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNI--------ILKNN 984
            +LTT K      LP +L++ L RF + +   + K N  I++PL LN+         L   
Sbjct: 351  QLTTAK------LPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKPVDCLHPV 404

Query: 985  DTMKYRLFGVVNHTGTLISGHYTSL--VNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSD 1042
              M Y+L  +++H GT+  GHYT++  +N D+          W  F+D +V    +    
Sbjct: 405  PNMMYKLSAIISHHGTVHQGHYTTICRINGDI----------WAKFNDSMVTVISEEDML 454

Query: 1043 KSLKISSSDAYVLFY 1057
            K        AY+L+Y
Sbjct: 455  K------EQAYLLYY 463

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/274 (21%), Positives = 107/274 (39%), Gaps = 62/274 (22%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLF 660
           + GL N GNTC++NS++Q L +++              +++S  N+ +    S +   L 
Sbjct: 65  VAGLVNDGNTCFMNSVLQSLASSRELAHFL-----DDIIEESEPNK-NELNFSVAFKTLL 118

Query: 661 DKMYLNGGCS---VVPTGFLKVVNQL-RPDLKIPDDQQDTQEFLMILLDRLHDELSNQ-- 714
           DK+    G +     P   LK +      ++ +  DQ+D QEF   ++ +L  +L  +  
Sbjct: 119 DKLNAKYGRNRKYYRPNALLKTMESGPNKNILLGYDQEDAQEFFQQIISQLEKDLKKEDT 178

Query: 715 -------------------PHVANDYPNLLLYDADGLKVSNKEY--KHWFDKN-VIGNG- 751
                              P + +D P   L + + L+     Y      + N  +G G 
Sbjct: 179 DGDFKKEESVQPSSEDDKTPILESDLPADALLNQENLEKVGTVYIPTEQVEPNFALGKGE 238

Query: 752 ----------ISPIDDIFQGQMENSLQCKRCGYT-TFNYSTFYVLSLAIPRRSMKLSKLG 800
                     ++P+D    G +   + C  CG      YS    LSL +P  ++  +   
Sbjct: 239 HESFYTPYKLLTPLD----GIIAERIGCLNCGENGGIRYSVSSGLSLNLPNENIGAT--- 291

Query: 801 RPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 834
                 +KL + ++ +   E++ G    DC RC 
Sbjct: 292 ------LKLSELLDKWVEPEIIEG---VDCNRCA 316

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 57/118 (48%), Gaps = 20/118 (16%)

Query: 941  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYP-LILNIILKNNDTMK 988
            K + F + P +L + L RF YD     L K N+      T+   P L  +++ KN     
Sbjct: 379  KGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCV 438

Query: 989  YRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKADKKHGSDKSL 1045
            Y L GV+ H+G +  GHY +++  D+         +W+ FDD+ V +  K+   D++ 
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKPDV-------GDQWFRFDDDKVWRVTKEQAFDENF 489

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTL 629
           GL+N G TCY+NS++Q  F  K+FR +
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKI 229

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 60/137 (43%), Gaps = 30/137 (21%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKV----------FRT--LFISSKYKSYLQQSRGNRLHS 649
            GL NLGN+CY+N+++Q LF   V          F T  +++SS  K  L + R     +
Sbjct: 309 CGLLNLGNSCYMNAVLQVLFNGGVSSWSLDELGDFPTDVVYVSSNLKCQLIKLRNALRTN 368

Query: 650 PRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHD 709
           P           +MY NG   V P+ F   V     +      QQD  EF   L+D L  
Sbjct: 369 P-----------EMYPNG---VKPSTFKDCVGGTHEEFS-SGRQQDALEFFSYLIDLLDK 413

Query: 710 ELSNQPHVANDYPNLLL 726
           +L N+      +PN L+
Sbjct: 414 KLFNRSEF---HPNDLM 427

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 7/50 (14%)

Query: 989  YRLFGVVNHTGTLI-SGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKAD 1036
            +RL  V+ H G+ + SGHY + + KD+E+      +KW  ++DE +V AD
Sbjct: 698  FRLSAVICHKGSSVHSGHYVAFIKKDVEN-----ETKWVLYNDEKMVVAD 742

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa]
           {ON} Anc_2.307 YDL122W
          Length = 770

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 101/275 (36%), Gaps = 56/275 (20%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSP---------- 650
           + GL N GNTC++NS++Q L ++K        S  K + +Q    +              
Sbjct: 90  VGGLVNDGNTCFMNSVLQSLASSKELNAFLDDSIIKKFQEQEEKIQNEEDPNEKEEEEEK 149

Query: 651 ----RLSNSLNMLFDKM---YLNGGCSVVPTGFLKVV-NQLRPDLKIPDDQQDTQEFLMI 702
               R S +   L DK+   Y            LK + N    ++ +  DQ+D QEF   
Sbjct: 150 DVDVRFSVAFKELLDKLNSKYYRDKPYFRTNKLLKTMSNAPNKNMLLGYDQEDAQEFFQN 209

Query: 703 LLDRLH--------DELSNQPHVANDYPNLLLYDADGLKVSNKEY--KHWFDKNVIGNG- 751
           +L  L          +  N P   N+ P+  +     L      +      + N + N  
Sbjct: 210 ILSELEKNVKSLDPKKFDNTPIPENELPDDAIIGQANLGDVGTVFLPTEQIEPNSVLNND 269

Query: 752 ------------ISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKL 799
                       I+P+D I   ++   LQC   G     YS F  LSL +P  ++  +  
Sbjct: 270 ENDTKFYTPFKLITPLDGISAERI-GCLQCGENG--GIRYSVFSGLSLNLPGENIGST-- 324

Query: 800 GRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 834
                  +KL   +  +   E++ G    +C RCG
Sbjct: 325 -------LKLTGLLKEWIKPEIIEG---VECYRCG 349

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 51/117 (43%), Gaps = 20/117 (17%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSP------RLSNSL 656
           G +N+GNTCY+NS +Q LF   V + + ++ K       + GN + SP      ++   L
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMILNYK-------TEGNNI-SPEDELHHKIVIEL 161

Query: 657 NMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFLMILLDRL 707
              F+ +      +V+P   L V+ +  P     D       QQD +E    L   L
Sbjct: 162 KKCFETLDGKKFKAVMPVVLLSVLRKCYPQFAERDSQSGFYKQQDAEELFTQLFQTL 218

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 8/77 (10%)

Query: 984  NDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSD 1042
            N +  Y L G++ H G    SGHY S +  + + +      KWY F+D+ V   +K   +
Sbjct: 431  NPSCVYDLIGIITHQGANSESGHYQSFIRDENDED------KWYKFNDDKVSEYEKDKIE 484

Query: 1043 KSLKISSSD-AYVLFYE 1058
            +      SD A +L Y+
Sbjct: 485  QLAGGGESDSALILIYK 501

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 19/120 (15%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRL--SNSLNML 659
            GL N+GN+CY+NS++QCLF  +          +   LQ + G    +  +  SN+L   
Sbjct: 320 CGLINMGNSCYLNSVLQCLFQDET---------WTGKLQMAVGEEFPTDVVFPSNNLRCQ 370

Query: 660 FDKMYLNGGC-------SVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 712
             K+Y             + P  F K  +    +      QQD  EFL  ++D L  +LS
Sbjct: 371 LIKLYRAMKLEPELYPQGIKPQSFKKCFSAGHEEFA-SQRQQDAMEFLTYMIDNLDKKLS 429

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 73/186 (39%), Gaps = 41/186 (22%)

Query: 650 PRLSNSLNMLFDKMYLNGGC--SVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRL 707
           P L + L  +F+ +  N      V P+ F+ ++ Q    L      QD  EFL  LL+ L
Sbjct: 356 PTLYSGLKDIFECIAENESAIGVVSPSNFVNILKQ-ENILFSSSMHQDAHEFLNYLLNEL 414

Query: 708 HDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSL 767
            D L             +  D D L     E K  F           I+D+F+G + NS 
Sbjct: 415 SDTLKRD----------MELDTDKL-----ESKPTF-----------IEDLFKGSLCNST 448

Query: 768 QCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENA 827
           +C  C   T     F    + I              ++ +K++D +N +   E+L+G N 
Sbjct: 449 KCFTCDTITARDEPFLDFPIEIQE------------DEEIKIQDILNNYKHRELLTGANK 496

Query: 828 WDCPRC 833
           + C +C
Sbjct: 497 FYCDKC 502

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 17/127 (13%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNNTV----ITYPLILNIILKNNDTM--KYRLFG- 993
            +T+   +LPK L IHL RF Y   +  N      I YPL L +    +  +   Y L G 
Sbjct: 510  RTVGLKSLPKTLAIHLKRFKYSEARNCNAKLFNRIHYPLDLRVCSSFDSAVCKDYELNGI 569

Query: 994  VVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISS--SD 1051
            V++  G    GHY ++   DL      G   W  FDDE V++  +    K +  ++  + 
Sbjct: 570  VIHMGGGPHHGHYVAICKNDL-----FG---WLLFDDETVESINEETVLKFIGDANELTT 621

Query: 1052 AYVLFYE 1058
            AYVL Y+
Sbjct: 622  AYVLIYK 628

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKS 637
           S  + G  N GNTCY NS++QCL+    FRT  +  KY S
Sbjct: 111 STKVFGYENFGNTCYCNSVLQCLYNLTEFRTEIL--KYPS 148

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 61/116 (52%), Gaps = 8/116 (6%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKV--FRTLFISSKYKSYLQQSRGNRLHS-PRLSNSLNM 658
            GL NLGN+CY+NS++Q LF A V  +    I +++   +     N L    +L N++ +
Sbjct: 322 CGLINLGNSCYMNSVLQLLFNAGVPDWSLEQIGTEFPLDVVYPSNNILCQLIKLRNAMKI 381

Query: 659 LFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 714
             ++ Y NG   + PT F + + Q   +      QQD+ EF   L+++L  ++ N+
Sbjct: 382 EPER-YPNG---IKPTSFKRCIAQAHEEFS-SSRQQDSMEFFTFLIEQLDKKVLNK 432

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 60/131 (45%), Gaps = 11/131 (8%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFR-----TLFISSKYKSYLQQSRGN-RLHSPRLSNS 655
            GL NLGN+CY+NS++QCL    V          I   +   +    GN R    +L N+
Sbjct: 342 CGLINLGNSCYLNSVMQCLLNGGVPNWSDKLGNIIGHDFPKDVIYPTGNLRCQMIKLLNA 401

Query: 656 LNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQP 715
              L  + Y  G   + P  F + V +   + K  ++QQD+ EFL  + + L   L  + 
Sbjct: 402 FK-LNPEDYEEG---IRPRSFKECVGKHNAEFKT-NNQQDSMEFLTFVTEELEKGLFPKI 456

Query: 716 HVANDYPNLLL 726
             A+  PN LL
Sbjct: 457 QDASINPNNLL 467

 Score = 32.7 bits (73), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 983  NNDTMKYRLFGVVNHTGTLI-SGHYTSLVNKDLEHNVDIGRSKWYYFDDEVV 1033
            N D   Y+L  V+ H GT + SGHY + + K +++       KW  ++DE +
Sbjct: 741  NLDNKPYKLTAVICHKGTSVHSGHYVAFIRKLIDN-----ERKWVLYNDEKI 787

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
            YPL072W
          Length = 471

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 63/146 (43%), Gaps = 37/146 (25%)

Query: 949  PKILVIHLSRFYYDLTK--KNNTVITYPLILNIILKN-----NDTMKYRLFGVVNHTGTL 1001
            P IL +HLSR  ++     +N   + YP  L ++ ++      + + YRL  ++ HTGT 
Sbjct: 328  PSILSLHLSRSMFNGASFTRNPCRVEYPETLIVLQRDVENGTAERITYRLRSMIKHTGTH 387

Query: 1002 ISGHYTSLVNKD-----LEHNVDIGRS---------------------KW-YYFDDEVVK 1034
             SGHY    +K      +   V + RS                     +W Y+F  + V 
Sbjct: 388  YSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKSVRRWPYWFISDAVV 447

Query: 1035 ADKKHGSDKSLKISSSDAYVLFYERV 1060
             +   G  K L+  S   Y+LFYERV
Sbjct: 448  RESNAG--KMLR-ESKYVYMLFYERV 470

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 50/114 (43%), Gaps = 18/114 (15%)

Query: 937  LTTVKTINFVTLPKILVIHLSRFYYD-----LTKKNNTV-----ITYPLILNIILKNNDT 986
            L   + + F + P +L + L RF YD     L K N+       I     L+     +  
Sbjct: 369  LQDAQKVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTP 428

Query: 987  MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDE-VVKADKKH 1039
              Y L GV+ H+G + +GHY +++  D           WY FDD+ V+KA  K 
Sbjct: 429  ADYILHGVLVHSGDISTGHYYAMIQPD-------AHGSWYRFDDDRVIKATDKQ 475

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/235 (20%), Positives = 83/235 (35%), Gaps = 61/235 (25%)

Query: 600 SITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNML 659
              G +N G TCY+NS++Q     K+FR L      +            +P  +NS+ + 
Sbjct: 195 GFVGFKNQGATCYLNSLLQSYHFTKLFRKLVYQIPTED----------ENP--TNSVALA 242

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719
             + +     S  P    ++      D      Q D QE   IL+DRL   +        
Sbjct: 243 LQRAFYLLQTSKEPLDTTELTKSFGWDTGDAFTQHDVQELNRILMDRLEHRMK------- 295

Query: 720 DYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY 779
                      G  V  K                 I+++F G+M++ ++C    Y +   
Sbjct: 296 -----------GTSVEGK-----------------INELFVGKMKSCIKCINVDYESSRV 327

Query: 780 STFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 834
             F+ + L +  + MK             L++    +   E+++GEN +     G
Sbjct: 328 EDFWDIQLNV--KDMK------------NLQESFEQYIEVELMNGENQYAAQDHG 368

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 48/108 (44%), Gaps = 8/108 (7%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDK 662
           G+ N+GNTCY+N+ +Q L+     R   ++  +      + G  L+  +L   +   F K
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLREQILA--FDDKKATAEGMDLYHVQLIREIQATFRK 118

Query: 663 MYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILL 704
           +    G ++ P   L+++ ++ P     D       QQD +E    L 
Sbjct: 119 LRDKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELFTQLF 166

 Score = 35.4 bits (80), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 8/78 (10%)

Query: 983  NNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS 1041
             N +  Y L GV+ H G    SGHY + +  + + +      KWY F+D+ V A +K   
Sbjct: 371  ENPSCVYDLIGVITHQGANSESGHYQAFMRDEFDDD------KWYKFNDDKVTAIEKEKI 424

Query: 1042 DKSLKISSSD-AYVLFYE 1058
            +       SD A +L Y+
Sbjct: 425  ESLAGGGESDSALILIYK 442

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
            UBP16Deubiquitinating enzyme anchored to the outer
            mitochondrial membrane, probably not important for
            general mitochondrial functioning, but may perform a more
            specialized function at mitochondria
          Length = 499

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 70/163 (42%), Gaps = 48/163 (29%)

Query: 946  VTLPKILVIHLSRFYYD-LTKKNN----------TVITYPLILNIILKNNDTMKYRLFGV 994
            V LP IL++HLSR  ++ +T   N          T+  Y L  +  +  N  +KY L  V
Sbjct: 337  VQLPDILIVHLSRSTFNGITYSRNPCNVKFGERITLSEYTLAESGTITENRQVKYNLKSV 396

Query: 995  VNHTGTLISGHYTSL-------------------------VNKDLEHNV---DIGRSKWY 1026
            V HTG+  SGHY                            VNK+ E NV   D  +S++ 
Sbjct: 397  VKHTGSHSSGHYMCYRRKTEIRFGKEDESSFRRAPVVNNEVNKNREQNVAHNDYKKSRYK 456

Query: 1027 YFDDEVVKADKKHGSDKSLKISSSD--------AYVLFYERVH 1061
               +  ++      SD ++K S++         AY+L+YERV+
Sbjct: 457  KVKN-ALRYPYWQISDTAIKESTASTVLNEQKYAYMLYYERVN 498

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 49/126 (38%), Gaps = 16/126 (12%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRL--HSPRLSNSLNMLF 660
           G +N+GNTCY+NS +Q L+  K  R L +S         S  +       ++   L   F
Sbjct: 109 GFQNMGNTCYLNSTLQALYRIKPLRELILSYNGSETATSSAADSTVESHKKIVLELQRCF 168

Query: 661 DKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFL--------MILLDR 706
             +      SV+P   L  + +  P     D       QQD +E          ++  D+
Sbjct: 169 QNLKNKSFKSVMPMVLLTALRKCYPQFAERDSQMGFYKQQDAEELFTQLFHSLSVVFGDK 228

Query: 707 LHDELS 712
             DE S
Sbjct: 229 FEDEFS 234

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 34/72 (47%), Gaps = 8/72 (11%)

Query: 989  YRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYF-DDEVVKADKKHGSDKSLK 1046
            Y L GV+ H G    SGHY S +  D + +      KWY F DD+V   DK+     S  
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDED------KWYKFNDDKVSVVDKEKIESLSGG 484

Query: 1047 ISSSDAYVLFYE 1058
              S  A +L Y+
Sbjct: 485  GESDSALILIYK 496

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
            YER151C (REAL)
          Length = 909

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 68/148 (45%), Gaps = 43/148 (29%)

Query: 948  LPKILVIHLSRF-YYDLTKKNNTVITY------------------PLIL------NIILK 982
            LP++L+I L RF + +   K+N +  Y                   LI+      +I LK
Sbjct: 771  LPQVLLIQLKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELIIPEESMSSITLK 830

Query: 983  NN----DTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEHNVDIGRSKWYYFDD----EVV 1033
            N+    D  +Y+L GV+ H G +   GHYT+ V    EHN      KWY  DD    E+ 
Sbjct: 831  NHTSGVDDRRYKLTGVIYHHGVSSDGGHYTADVYHK-EHN------KWYRIDDVNITELE 883

Query: 1034 KADKKHGSDKSLKISSSDAYVLFYERVH 1061
              D   G +++    S  AY+L Y++V+
Sbjct: 884  DDDVLKGGEEAS--DSRTAYILMYQKVY 909

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 81/202 (40%), Gaps = 52/202 (25%)

Query: 596 YVSLSITGLRNLGNTCYINSMIQCLF---AAKVFRTLFISSKYKSYLQQSRGNRLHSPRL 652
           + +L   GL N G TCY N+ +Q +    A + +    +  KYK+    S         +
Sbjct: 436 FANLRPKGLINHGVTCYTNAAVQAMVHIPAVQHYLFDILRGKYKNIDPNS---------V 486

Query: 653 SNSLNMLFDKMYLN---GGCSVV----PTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLD 705
           S +L     +M+L+   G   V+    P   ++ ++ +   +  P +Q+D+ E+ M L+ 
Sbjct: 487 SYTLAETTRRMWLSNKKGNKKVIAYYNPNELIERLDDINWSMN-PYNQEDSHEYFMSLMS 545

Query: 706 RLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765
           +L +   N   +  +    ++YD                             IF G +E 
Sbjct: 546 KLQE---NSVPIGRNMTESIIYD-----------------------------IFGGLLEQ 573

Query: 766 SLQCKRCGYTTFNYSTFYVLSL 787
           ++ CK CG  +     FY LSL
Sbjct: 574 TVTCKSCGGVSKTEQEFYDLSL 595

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 60/131 (45%), Gaps = 23/131 (17%)

Query: 939  TVKTINFVTLPKILVIHLSRFYYD--LTKKNNTVITYPLILNII-----LKNNDTMKYRL 991
             +K    +  P+ LV+HL +F ++   + K    ++YP+ L+I       K     KY+L
Sbjct: 704  AIKRSTILRAPETLVVHLKKFRFNGSTSSKMKQAVSYPMYLDITEYCESSKKVLPAKYQL 763

Query: 992  FGVVNHTG-TLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLK-ISS 1049
              VV H G +L SGHY +   +            W  +DDE++    +      LK ++ 
Sbjct: 764  LSVVVHEGRSLSSGHYIAHCRQ--------PDGTWATYDDELINKISE------LKLLTE 809

Query: 1050 SDAYVLFYERV 1060
             +AY L Y R+
Sbjct: 810  PNAYYLVYTRL 820

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 56/126 (44%), Gaps = 18/126 (14%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDK 662
           GL+N+GNTCY+N+ +Q LF     R L ++       + S  + +H  ++   +   F+ 
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLILNY---DPAKASPQDEMHH-KIVLEMKRCFEN 163

Query: 663 MYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQE--------FLMILLDRLH 708
           +      SV+P   L V+ +  P     D       QQD +E        F ++  D+  
Sbjct: 164 LENKSYKSVMPLMLLNVLRKCYPQFAERDAQGGFYKQQDAEELFTQLFHTFDIVFGDKFS 223

Query: 709 DELSNQ 714
           D+ + Q
Sbjct: 224 DDFTVQ 229

 Score = 35.4 bits (80), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 8/72 (11%)

Query: 989  YRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKI 1047
            Y L G++ H G    SGHY + +  + + N      KWY F+D+ V   +K   +     
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDEN------KWYKFNDDKVSVVEKEKIEALAGG 477

Query: 1048 SSSD-AYVLFYE 1058
              SD A +L Y+
Sbjct: 478  GESDSALILMYK 489

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar to
            uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
            ubiquitin-specific proteinase
          Length = 816

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 59/145 (40%), Gaps = 41/145 (28%)

Query: 948  LPKILVIHLSRF-----------------YYDLTKKNNTVITYPLILNI--------ILK 982
            LP+IL+I L RF                 Y    +K    I+Y   L I         L+
Sbjct: 681  LPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKISYGHTLEIPDETLASSALR 740

Query: 983  NNDTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEHNVDIGRSKWYYFDD-EVVKADK--- 1037
            NN +  Y L GV+ H G +   GHYT+    D+ H        WY  DD  + K +    
Sbjct: 741  NNSSKTYELSGVIYHHGMSPDGGHYTA----DVFHKQ---TKTWYRIDDVNITKLEDDDV 793

Query: 1038 -KHGSDKSLKISSSDAYVLFYERVH 1061
             K G D    + S  AY+L Y+ VH
Sbjct: 794  LKGGED---NMDSRTAYILMYQNVH 815

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
            Ashbya gossypii AEL242W
          Length = 696

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 10/77 (12%)

Query: 940  VKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITYP--LILNIILKNND------TMKY 989
            +K    V+ PK+L++HLSR  +D     KN+  + +P  LILN      D       ++Y
Sbjct: 395  LKRTVVVSSPKVLLLHLSRSVFDGVTYTKNSCNVLFPEDLILNEQEIKEDRCIAVHCVRY 454

Query: 990  RLFGVVNHTGTLISGHY 1006
            +L  ++ HTGT   GHY
Sbjct: 455  KLQAMIKHTGTHFQGHY 471

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 63/143 (44%), Gaps = 39/143 (27%)

Query: 948  LPKILVIHLSRF-YYDLTKKNNTVITYPLILNIILK------------------------ 982
            LP++L+I L RF + + T K+N+++ Y      I K                        
Sbjct: 693  LPQVLLIQLKRFQFINNTDKDNSMVNYNAYNGRIEKIRKKINYEHELIIPIESISSANAY 752

Query: 983  NNDTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEHNVDIGRSKWYYFDD----EVVKADK 1037
             ++  +Y L GV+ H G +   GHYT+    D+ H       KWY  DD    E+ K D 
Sbjct: 753  KDENRRYHLTGVIYHHGVSSDGGHYTA----DVYHRES---DKWYRIDDVSIIELEKEDV 805

Query: 1038 KHGSDKSLKISSSDAYVLFYERV 1060
              G ++S    S  AY+L Y+++
Sbjct: 806  LKGGEESG--DSRTAYILMYQKI 826

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 66/148 (44%), Gaps = 37/148 (25%)

Query: 598 SLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLN 657
           S++  G+ N  N C+++S++Q L   + F  +      ++ +  +R   + S  L   LN
Sbjct: 375 SVAPRGIVNRANVCFMSSVLQVLLYCRPFINILNVVSVRNVV--ARAGPIQSKLLDACLN 432

Query: 658 ML--FDKMYL-----------NGGCSVVPTGFLK---VVNQLRPDLKIPDD--------- 692
           +   FDK  +           +G  S V +G ++   VV+ +   +K PD+         
Sbjct: 433 IYKQFDKDTVELEKKNAAKNGSGNNSNVGSGSIRQSNVVSSISEAIK-PDEFYEALSTIP 491

Query: 693 ---------QQDTQEFLMILLDRLHDEL 711
                    Q+D +EFL  LLD+LH+E 
Sbjct: 492 KFKDLKWGHQEDAEEFLTHLLDQLHEEF 519

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 754

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 62/135 (45%), Gaps = 27/135 (20%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFG- 993
            + +    LP IL +HL RF Y  T+  N      I YPL L +    + ++  +Y L G 
Sbjct: 551  RIVGLKQLPHILALHLKRFKYSETQNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTGI 610

Query: 994  VVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKS--LKISS-- 1049
            VV+  G    GHY SL   +        +  W  FDDE V++      D+S  +K     
Sbjct: 611  VVHMGGGPHHGHYVSLCKNE--------KFGWLLFDDETVES-----VDESSVMKFCGDL 657

Query: 1050 ---SDAYVLFYERVH 1061
               + AYVLFY+ ++
Sbjct: 658  HDLTTAYVLFYKEIN 672

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           + G  N GNTCY NS++QCL+    FR
Sbjct: 145 VFGYENFGNTCYCNSVLQCLYNLTEFR 171

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186w UBP10
          Length = 771

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 75/195 (38%), Gaps = 39/195 (20%)

Query: 596 YVSLSITGLRNLGNTCYINSMIQCLF---AAKVFRTLFISSKYKSYLQQSRGNRLHSPRL 652
           Y  L   GL N G TCY N+ +Q L    A + +    ++ KY S +  +  + + +   
Sbjct: 379 YSKLKPKGLLNHGVTCYTNAAVQALLHIPAMQHYLNDILAGKYSSTISSNSVSHVLA--- 435

Query: 653 SNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 712
             S  M  +    +G   + P   +  ++ +   +     Q+D+ E+ M ++ RL ++  
Sbjct: 436 ETSRRMWHNDGKKSGNSYINPKKLIARLDDINC-MMSEWQQEDSHEYFMSIMSRLQEDSV 494

Query: 713 NQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 772
            + H   +                                S I DIF G ++ ++ CK C
Sbjct: 495 PKGHKMTE--------------------------------SIIYDIFGGSLKQTVTCKSC 522

Query: 773 GYTTFNYSTFYVLSL 787
           G  +     FY LSL
Sbjct: 523 GEVSTTEQPFYDLSL 537

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
            UBP3Ubiquitin-specific protease involved in transport and
            osmotic response; interacts with Bre5p to co-regulate
            anterograde and retrograde transport between the ER and
            Golgi; involved in transcription elongation in response
            to osmostress through phosphorylation at Ser695 by Hog1p;
            inhibitor of gene silencing; cleaves ubiquitin fusions
            but not polyubiquitin; also has mRNA binding activity
          Length = 912

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 65/146 (44%), Gaps = 43/146 (29%)

Query: 948  LPKILVIHLSRF-YYDLTKKNNTVITY------------------PLIL------NIILK 982
            LP++L+I   RF + +   K+N +  Y                   LI+      +I LK
Sbjct: 774  LPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLK 833

Query: 983  NN----DTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEHNVDIGRSKWYYFDD----EVV 1033
            NN    D  +Y+L GV+ H G +   GHYT+ V    EHN      KWY  DD    E+ 
Sbjct: 834  NNTSGIDDRRYKLTGVIYHHGVSSDGGHYTADVYHS-EHN------KWYRIDDVNITELE 886

Query: 1034 KADKKHGSDKSLKISSSDAYVLFYER 1059
              D   G +++    S  AY+L Y++
Sbjct: 887  DDDVLKGGEEAS--DSRTAYILMYQK 910

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 61/127 (48%), Gaps = 9/127 (7%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKV--FRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNML 659
            GL NLGN+CY+NS++Q LF   V  +    +    +  +  S   +    +L N+L + 
Sbjct: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIH 377

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719
            +K Y +G   V P    K + +   +      QQD  EFL   +D+L  ++ ++   +N
Sbjct: 378 PEK-YQHG---VKPASVKKCIGEDNEEFS-SGRQQDAMEFLTYFIDKLDRKVFSKASSSN 432

Query: 720 DYPNLLL 726
             PN L+
Sbjct: 433 --PNDLM 437

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
            YFR010W (REAL)
          Length = 500

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 8/83 (9%)

Query: 978  NIILKNNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
            N+    N +  Y L GV+ H G    SGHY + +  +L+ N      KWY F+D+ V A 
Sbjct: 420  NLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVTAV 473

Query: 1037 KKHGSDKSLKISSSD-AYVLFYE 1058
            +K   +       SD A +L Y+
Sbjct: 474  EKEKIESLAGGGESDSALILMYK 496

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 46/112 (41%), Gaps = 7/112 (6%)

Query: 600 SITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHS-PRLSNSLNM 658
           S  G +N+GNTCY+N+ +Q L+     R + ++      +  S      +  ++   +  
Sbjct: 107 SPVGFKNMGNTCYLNATLQALYRVDDVRDMILNYNPSEGVSSSSAQDEETHKQIVIEMKR 166

Query: 659 LFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFLMILL 704
            F+ ++     SV+P   L  + +  P     D       QQD +E    L 
Sbjct: 167 CFENLHNKSFKSVLPIVLLNTLRKCYPQFAERDQQGGFYKQQDAEELFTQLF 218

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 92/239 (38%), Gaps = 60/239 (25%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLS----NSLN 657
           TGL N  N C++NS +Q L   +   T +++   ++      G      RL+    N + 
Sbjct: 75  TGLLNARNDCFLNSSLQALVPIESLTT-YLNQFVEALHSVDEGQVFELERLAPLHANLIK 133

Query: 658 MLFDKMYLNGGCSVVPTGFLKVVNQLRPDL--KIPDDQQDTQEFLMILLDRLHDELSNQP 715
           +L +   L      V      +V  L   L  K+  DQ D  EF  ILL+ LH E     
Sbjct: 134 LLHELQSLIVKPQTVSAK--NIVKTLEDTLRRKMSSDQNDAHEFTQILLETLHSE----- 186

Query: 716 HVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCG-Y 774
                Y  L                    ++ I  G  P    F+G   N L C +C  Y
Sbjct: 187 -----YIKL--------------------QSNIEIGSFP----FEGVSSNYLMCLQCNKY 217

Query: 775 TTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRC 833
           +   +S F +L +A+P         G  +E   KL D I + + DE++ G   + C  C
Sbjct: 218 SQTIHSPFLMLEVAVP---------GNYSE---KLTDLI-LHSQDEIIEG---YSCLYC 260

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 10/68 (14%)

Query: 949  PKILVIHLSRFYYD---LTKKNNTV-------ITYPLILNIILKNNDTMKYRLFGVVNHT 998
            P  L++HLSR  ++   +T+    V       +   +++N   +  + +KY L  VV HT
Sbjct: 337  PASLIVHLSRSIFNGATITRSACRVEYEQSLNLQRQVMINDAFERTEPIKYELKSVVKHT 396

Query: 999  GTLISGHY 1006
            G+ + GHY
Sbjct: 397  GSHVQGHY 404

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 12/111 (10%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN---RLHSPRLSNSLNML 659
           G +N+GNTCY+N+ +Q L+     R + +   YK   Q S  N    +H  ++   +   
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMILD--YKPPAQSSTYNPEDEMHH-KIVLEIKRC 168

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILL 704
           F+ +      SV+P   L V+ +  P     D       QQD +E    L 
Sbjct: 169 FENLEKKNFKSVMPMMLLTVLRKCYPQFAERDPRGGFYKQQDAEELFTQLF 219

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 8/77 (10%)

Query: 984  NDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSD 1042
            N +  Y L G++ H G    SGHY + +  + + N      KWY F+D+ V   +K   +
Sbjct: 428  NPSCVYNLIGIITHQGANSESGHYQAFMRDENDEN------KWYKFNDDKVTVVEKEKIE 481

Query: 1043 KSLKISSSD-AYVLFYE 1058
                   SD A +L Y+
Sbjct: 482  ALAGGGESDSALILMYK 498

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 51/123 (41%), Gaps = 8/123 (6%)

Query: 588 TIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRL 647
           T EQ    +  + I G +N+GNTCY+N+ +Q L+     R   ++        ++  N  
Sbjct: 94  TPEQQVQQFNDIPI-GFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINNDKNGENET 152

Query: 648 HSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLM 701
           H  +L   L   F+ +      SV+P   L  + +  P     D       QQD +E L 
Sbjct: 153 H-IKLVTELKRCFEGLKNKSFKSVMPVVLLNALRKTYPQFAERDPQSGFYKQQDAEELLT 211

Query: 702 ILL 704
            L 
Sbjct: 212 QLF 214

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
            (REAL)
          Length = 503

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 11/72 (15%)

Query: 946  VTLPKILVIHLSRFYYD-LTKKNN----------TVITYPLILNIILKNNDTMKYRLFGV 994
            V LPK+LVIHLSR  ++ +T   N           +  Y  I N+ L  N  + Y L  V
Sbjct: 345  VKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLTENRQIVYNLKSV 404

Query: 995  VNHTGTLISGHY 1006
            V HTG+   GHY
Sbjct: 405  VKHTGSHSRGHY 416

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFR 627
           TG+ N+GNTCY+NS++Q  F+  +FR
Sbjct: 758 TGINNIGNTCYLNSLLQYYFSITLFR 783

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 57/137 (41%), Gaps = 20/137 (14%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFI-----------SSKYKSY-----LQQSRGN 645
            G+ N+GNTCY+NS++Q  F  K  R   +           +S+Y S       + S+  
Sbjct: 698 AGINNVGNTCYLNSLLQFFFTIKPLRDFILNYDDDSAKLLDASEYHSRRRIGGREVSKQE 757

Query: 646 RLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRP---DLKIPDDQQDTQEFLMI 702
            L S +    L  LF+ M       V PT  L V     P   +++  DD    +E + +
Sbjct: 758 ELRSVQFVYHLRDLFNDMIHTNSRCVTPTKEL-VYLAFAPSNVEVEFGDDTVAQKELIDL 816

Query: 703 LLDRLHDELSNQPHVAN 719
             D + D      H+A+
Sbjct: 817 TTDVVEDPTDTTRHLAS 833

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 61/144 (42%), Gaps = 41/144 (28%)

Query: 948  LPKILVIHLSRF-YYDLTKKNNTVITY------------------------PLILNIILK 982
            LP +L+IHL RF + + T K+N++  Y                          I N    
Sbjct: 886  LPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKISYNHELVIPAETITNGKQL 945

Query: 983  NNDTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEH-NVDIGRSKWYYFDD----EVVKAD 1036
              +   Y L GVV H G +   GHYT+    D+ H  VD    KWY  DD    E+ K D
Sbjct: 946  APENRTYELTGVVYHHGLSSDGGHYTA----DIYHKEVD----KWYRIDDVTVTELEKDD 997

Query: 1037 KKHGSDKSLKISSSDAYVLFYERV 1060
               G + S    S  AY+L Y+++
Sbjct: 998  VLKGGENS--TDSRTAYILMYQKL 1019

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
            similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 10/81 (12%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITYPLILNI---ILKNN-----D 985
            K T VK    V  P++L+IHLSR  ++ T   +N   + +  IL +   +++N+     +
Sbjct: 457  KSTIVKKNVVVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDEILQLQEQVIQNDRCVGIN 516

Query: 986  TMKYRLFGVVNHTGTLISGHY 1006
            ++ Y L  +V H G+   GHY
Sbjct: 517  SVNYELKAIVKHAGSHSQGHY 537

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 64/137 (46%), Gaps = 36/137 (26%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTL--FISSK-------------------YKSYLQQ 641
           G+ N GN C+++S++Q L   + F  L   IS K                   Y+ + +Q
Sbjct: 348 GIVNTGNICFMSSILQVLLFCEPFVNLMNLISVKTSAKMGSTGFLLLDACLELYRKFDKQ 407

Query: 642 SRGNRLHSPRLSNSLNM---LFDKMYLNGGCSVVPTGFLKVVNQLRP--DLKIPDDQQDT 696
           +   R  + R S+ +N+   L D        ++ P  F K +++L    DL+    Q+D 
Sbjct: 408 AF-EREKASRSSSGVNISSALAD--------AIKPDDFYKTLSKLPKFKDLRW-GHQEDA 457

Query: 697 QEFLMILLDRLHDELSN 713
           +EFL  LLD+LH+E  N
Sbjct: 458 EEFLTHLLDQLHEEFVN 474

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 39/78 (50%), Gaps = 16/78 (20%)

Query: 989  YRLFGVVNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKI 1047
            Y+L GVV H G   S GHYT  V ++         +KWY  DD  V+  +K   D+ LK 
Sbjct: 714  YKLIGVVYHHGVSPSGGHYTCDVYQET-------LNKWYRIDDTNVQEIEK---DEVLKG 763

Query: 1048 S-----SSDAYVLFYERV 1060
                  S  AY+L Y+++
Sbjct: 764  GEEGNDSRTAYILIYQKL 781

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar to
            gnl|GLV|KLLA0E23463g Kluyveromyces lactis KLLA0E23463g
            and some similarites with YPL072W uniprot|Q02863
            Saccharomyces cerevisiae YPL072W UBP16 Putative
            ubiquitin-specific protease
          Length = 767

 Score = 39.3 bits (90), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITYP----LILNIILKNN----D 985
            K T VK    V  P++L+IHLSR  ++     +N+  + +     L   II KN     +
Sbjct: 440  KSTIVKKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVN 499

Query: 986  TMKYRLFGVVNHTGTLISGHY 1006
             +KYRL   V H GT  +GHY
Sbjct: 500  NVKYRLRATVRHQGTHSAGHY 520

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 39.3 bits (90), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPR 651
           TGL N+GNTCY+NS++Q  F+    R   +   Y++ +Q    N+ ++ R
Sbjct: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLD--YRNTVQHFLNNQEYASR 780

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 83/208 (39%), Gaps = 51/208 (24%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKV--FRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNML 659
            GL NLGN+CY+NS++Q L    +  +   F+ S++   +    GN L    +      L
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGIPNWSLDFLGSEFPLDVVYP-GNNLKCQWIK-----L 376

Query: 660 FDKM------YLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN 713
           F+ M      Y NG   + PT F K + Q   +    + QQD  EFL             
Sbjct: 377 FNAMRCEPEFYPNG---IKPTTFKKCIGQNHEEFS-SNRQQDAMEFLT------------ 420

Query: 714 QPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCG 773
                               + +   + +F  ++  +G S ++D+ +  ME+ LQC +CG
Sbjct: 421 -------------------FLLDLLDRKFF--SIGSSGASNVNDLVRFIMEDRLQCNKCG 459

Query: 774 YTTFNYSTFYVLSLAIPRRSMKLSKLGR 801
              ++Y     + + +   S     L R
Sbjct: 460 KVKYSYEPAEAIQIPLEENSETQDLLER 487

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
            (REAL)
          Length = 499

 Score = 38.9 bits (89), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 8/83 (9%)

Query: 978  NIILKNNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
            N+    N +  Y L GV+ H G    SGHY + +  +L+ N      KWY F+D+ V   
Sbjct: 419  NLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVSVV 472

Query: 1037 KKHGSDKSLKISSSD-AYVLFYE 1058
            +K   +       SD A +L Y+
Sbjct: 473  EKEKIESLAGGGESDSALILMYK 495

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 590 EQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFIS 632
           EQ    +  L + G +N+GNTCY+N+ +Q L+     R + ++
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLREMILN 139

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
            UBP6Ubiquitin-specific protease situated in the base
            subcomplex of the 26S proteasome, releases free ubiquitin
            from branched polyubiquitin chains; works in opposition
            to Hul5p polyubiquitin elongation activity; mutant has
            aneuploidy tolerance
          Length = 499

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 8/83 (9%)

Query: 978  NIILKNNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
            N+    N +  Y L GV+ H G    SGHY + +  +L+ N      KWY F+D+ V   
Sbjct: 419  NLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVSVV 472

Query: 1037 KKHGSDKSLKISSSD-AYVLFYE 1058
            +K   +       SD A +L Y+
Sbjct: 473  EKEKIESLAGGGESDSALILMYK 495

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 51/123 (41%), Gaps = 10/123 (8%)

Query: 590 EQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQS--RGNRL 647
           EQ    +  L + G +N+GNTCY+N+ +Q L+     R + ++      +  S  +   +
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEI 156

Query: 648 HSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFLM 701
           H  ++   +   F+ +      SV+P   L  + +  P     D       QQD +E   
Sbjct: 157 HK-QIVIEMKRCFENLQNKSFKSVLPIVLLNTLRKCYPQFAERDSQGGFYKQQDAEELFT 215

Query: 702 ILL 704
            L 
Sbjct: 216 QLF 218

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFR 627
           + GL N GNTCY NS++QCL+  K  R
Sbjct: 98  VFGLENYGNTCYCNSVLQCLYNLKELR 124

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 12/79 (15%)

Query: 755 IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCIN 814
           I  +FQG M NS++C  C   T N   F+  ++ +              ++ + ++D + 
Sbjct: 464 IHTLFQGTMNNSIKCLTCDNITSNEEPFFDFAIPVSE------------DEELNVQDILR 511

Query: 815 MFTSDEVLSGENAWDCPRC 833
            F   E+L+G N + C  C
Sbjct: 512 DFHQREMLNGANKFYCDSC 530

 Score = 35.4 bits (80), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 60/130 (46%), Gaps = 23/130 (17%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 994
            +T+    LP++L +HL RF Y    ++N     VI YPL L +    +  +   Y L G+
Sbjct: 538  RTVGIKELPELLPLHLKRFKYSEKHQSNIKLFNVIHYPLNLRVCSTFDHAVCKDYELNGI 597

Query: 995  VNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISS---- 1049
            V H G     GHY ++   +L          W  +DDE V++    G D  L+       
Sbjct: 598  VIHMGGGPQHGHYVAICKHEL--------FGWLLYDDETVES---VGEDAVLRFIGDVND 646

Query: 1050 -SDAYVLFYE 1058
             + AYVLFY+
Sbjct: 647  MTTAYVLFYK 656

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
            YFR010W (REAL)
          Length = 499

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 8/83 (9%)

Query: 978  NIILKNNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKAD 1036
            N+    N +  Y L GV+ H G    SGHY + +  +L+ N      KWY F+D+ V   
Sbjct: 419  NLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVSVV 472

Query: 1037 KKHGSDKSLKISSSD-AYVLFYE 1058
            +K   +       SD A +L Y+
Sbjct: 473  EKEKIESLAGGGESDSALILMYK 495

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFIS 632
           G +N+GNTCY+N+ +Q L+     R + ++
Sbjct: 110 GFKNMGNTCYLNATLQALYRVDDLRDMILN 139

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 85/207 (41%), Gaps = 39/207 (18%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVF----RTLFISSKYKSYLQQSRGNRLHSPRLSNSLN 657
           TGL N GN C+INS +Q L  ++ F     ++    K+ +   +  GNR   P       
Sbjct: 69  TGLINKGNDCFINSSLQGLAGSQRFNHYLNSVLRCLKFLNENPKQEGNRYALPLHQVMAE 128

Query: 658 MLFD---KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 714
            ++D     +LN   +V  +  + V  +     K+   Q D QEF  +LL+ LH      
Sbjct: 129 FIYDLQAPTFLN---TVESSDKIIVTMESIFKQKMSRRQNDAQEFTQLLLEVLH------ 179

Query: 715 PHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGY 774
               N+Y  L+                    N I N +      F+G+  + L C +CG 
Sbjct: 180 ----NEYQELIRL-----------------MNFITNNLDIPTYPFEGKYCHELTCLKCGR 218

Query: 775 TT-FNYSTFYVLSLAIPRR-SMKLSKL 799
            +      F +L+L +P + S+ L +L
Sbjct: 219 NSEVKMFDFDILTLNLPAQPSISLDEL 245

 Score = 35.4 bits (80), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITY--------PLILNIILKNND 985
            K T VK   FV +P IL+IHL+R  ++     +N   I Y         L+++ +    +
Sbjct: 320  KSTIVKKTVFVEVPDILLIHLTRSMFNGMSYTRNACKIAYDEKLLLEHQLVMDGVSVMRN 379

Query: 986  TMKYRLFGVVNHTGTLISGHY 1006
             ++Y L   + H+G+   GHY
Sbjct: 380  NIQYTLSSAIKHSGSHSMGHY 400

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 85/194 (43%), Gaps = 21/194 (10%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFD 661
           TGL N    CY NS +Q L +   F T++++     +  +     L   ++       FD
Sbjct: 66  TGLVNTSTECYANSSVQVLASLSNF-TIYLNKVISIFELE-----LKIEKVEKDAKEAFD 119

Query: 662 KMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD---QQDTQEFLMILLDRLHDELSNQPHVA 718
             YL     V+P  +   + QL  DL+   D   ++    F+ IL   +H  ++     A
Sbjct: 120 -TYL---YKVIPVHY--ALCQLLADLQELIDRPRERSVSNFIRILEASIHKRITGGQQDA 173

Query: 719 NDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTF- 777
           N+   ++L   + L+   +  K + ++  +   +      F+G++ + L C  CG T+  
Sbjct: 174 NELTQIVL---EVLQNELESLKKYVNRMELSIEVPRFP--FEGKLASYLSCLNCGQTSIP 228

Query: 778 NYSTFYVLSLAIPR 791
           N STF +L +  P+
Sbjct: 229 NISTFNILPIQTPQ 242

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 11/82 (13%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYD--LTKKNNTVITYPLILNIILKNNDT------- 986
            K T +K  + +  PKIL+IHLSR  Y+  +  +N+  + +   ++I  +  D        
Sbjct: 331  KSTIIKKNSIIETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSIERQTTDEKNENLKI 390

Query: 987  --MKYRLFGVVNHTGTLISGHY 1006
              + Y+L  ++ HTGT  SGHY
Sbjct: 391  ELVDYQLQSIIKHTGTHNSGHY 412

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 38.9 bits (89), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 590 EQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFR 627
           E +   ++S    GL+NLGNTCY+NS +Q L+  +  R
Sbjct: 94  ESAQMQHLSQLPVGLKNLGNTCYMNSTLQALYQIRPLR 131

 Score = 38.5 bits (88), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 36/77 (46%), Gaps = 8/77 (10%)

Query: 984  NDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSD 1042
            N +  Y L GV+ H G    SGHY S +  + + N      KWY F+D+ V   +K   +
Sbjct: 421  NPSCVYNLIGVITHQGANSESGHYQSFIRDEADEN------KWYRFNDDKVSVIEKEKIE 474

Query: 1043 KSLKISSSD-AYVLFYE 1058
                   SD A +L Y+
Sbjct: 475  SLAGGGESDSALILIYK 491

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 59/147 (40%), Gaps = 46/147 (31%)

Query: 948  LPKILVIHLSRF-----------------YYDLTKKNNTVITYPLILNI----------- 979
            LP++L+I L RF                 Y    +K    I Y   L I           
Sbjct: 654  LPRVLLIQLKRFEFVNNSSERRELINYNAYNGRIEKIRKWIRYDQELTIPKEALSSVNAK 713

Query: 980  -ILKNNDTMKYRLFGVVNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDD----EVV 1033
              L   DT  YRL GVV H G   S GHYT+    D+ H     + KWY  DD    E+ 
Sbjct: 714  FYLSGKDTT-YRLTGVVYHHGLSPSGGHYTA----DVLHQT---QDKWYRIDDNNVTEIR 765

Query: 1034 KADK-KHGSDKSLKISSSDAYVLFYER 1059
            + D  K G + S    S  AY+L Y+R
Sbjct: 766  QEDVFKRGDEAS---DSKTAYILIYQR 789

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
            YER151C
          Length = 795

 Score = 38.9 bits (89), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 64/143 (44%), Gaps = 41/143 (28%)

Query: 948  LPKILVIHLSRF-YYDLTKKNNTVITY------------------PLILNI-------IL 981
            LP++L+I L RF + + T K+N++I Y                   L++ I        L
Sbjct: 662  LPQVLLIQLKRFQFINNTDKDNSMINYNAYNGRIEKIRKKINYEHELMIPIESISSTNAL 721

Query: 982  KNNDTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEHNVDIGRSKWYYFDD----EVVKAD 1036
            ++ D  +Y L GV+ H G +   GHYT+    D+ H       KWY  DD    EV K  
Sbjct: 722  RDED-RQYSLSGVIYHHGLSSDGGHYTA----DVYHKE---TDKWYRIDDINITEVQKDS 773

Query: 1037 KKHGSDKSLKISSSDAYVLFYER 1059
               G +    + S  AY+L Y++
Sbjct: 774  VLKGGEDG--VDSRTAYILMYQK 794

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
           (UBP3) - Ubiquitin-specific protease [contig 231]
           PARTIAL
          Length = 444

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 68/148 (45%), Gaps = 31/148 (20%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTL--FISSKYKSYLQQSRGNRLHSPRLSNSLNMLF 660
           G+ N GN C+++S++Q L   + F +L   IS K  + +  + G  L    L   L   F
Sbjct: 10  GIVNSGNICFMSSILQVLLFCEPFVSLMNLISIKTSAKMGNT-GFLLLDACLE--LYRKF 66

Query: 661 DKMY--------LNGGCSVVPTGFLKVVNQLRPD------LKIP-------DDQQDTQEF 699
           DK+         +N G S + +    + + ++PD       K+P         Q+D +EF
Sbjct: 67  DKVTFEREKAARINAGNSGISSA---LADAIKPDDFYKTLSKLPKFKDLRWGHQEDAEEF 123

Query: 700 LMILLDRLHDEL--SNQPHVANDYPNLL 725
           L  LLD+LH+E   S      ND  NL+
Sbjct: 124 LTHLLDQLHEEFVQSIDSLSDNDVSNLI 151

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 22/81 (27%)

Query: 989  YRLFGVVNHTGTLIS-GHYTSLVNKDLEHNVDIGRSKWYYFDD--------EVVKADKKH 1039
            Y+L GVV H G   S GHYT  V ++        + KW+  DD        E V    + 
Sbjct: 377  YKLIGVVYHHGVSSSGGHYTCDVYQE-------AQKKWFRIDDINVQEIEMEEVLQPGEE 429

Query: 1040 GSDKSLKISSSDAYVLFYERV 1060
            GSD      S  AY+L Y+++
Sbjct: 430  GSD------SRTAYILIYQKL 444

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
            YPL072W
          Length = 734

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 10/81 (12%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLT--KKNNTVITYPLILNI---ILKNN-----D 985
            K T VK    V  PK LV+HLSR  +D    ++N+  + +  IL     ++++N     +
Sbjct: 420  KSTIVKKTVVVESPKTLVMHLSRSMFDGISYQRNSCGVAFDEILESREQVIRHNKCVGIN 479

Query: 986  TMKYRLFGVVNHTGTLISGHY 1006
             + Y+L  +V H+G+   GHY
Sbjct: 480  PISYKLKAIVAHSGSHSQGHY 500

>KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some
            similarities with uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 774

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 66/146 (45%), Gaps = 44/146 (30%)

Query: 948  LPKILVIHLSRFYY-------DLTKKN---------------NTVITYP---LILNIILK 982
            LP+ L+I   RF +       DL+  N               N  +T P   +  N++  
Sbjct: 637  LPQALLIQFKRFSFVSQSSKNDLSNYNSFNGRIEKIRKMVKYNHELTIPKESISPNLVST 696

Query: 983  NN--DTMKYRLFGVVNHTGTLIS-GHYTSLV-NKDLEHNVDIGRSKWYYFDDEVVKADKK 1038
            +N  ++ KY L GV+ H G   S GHYT  V +KDL+        KWY  DD  V  D+ 
Sbjct: 697  SNSEESFKYYLSGVIYHHGVSPSGGHYTCDVYDKDLD--------KWYRIDD--VNVDEI 746

Query: 1039 HGSDKSLKI--SSSD---AYVLFYER 1059
               +  L+   S+SD   AY+L YE+
Sbjct: 747  KNKEDILRSGDSASDSRTAYILLYEK 772

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 24/131 (18%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVF-------------RTLFIS-------SKYKSYLQQS 642
           G+ N G+ C+I+S++Q L   + F             RT  +S         +K + +++
Sbjct: 338 GIYNKGSICFISSVLQLLIHCRSFVNLLNVIHTTTVSRTNSVSPLLNACMDVFKRFDRET 397

Query: 643 RGNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLK--IPDDQQDTQEFL 700
             N L+  R ++        +  N   S+ P  F K ++ L P  K      Q+D +EFL
Sbjct: 398 IVNELNETRENSKTKSKSSNLNENI-ISIDPEPFYKSISTL-PKFKDLTWGRQEDAEEFL 455

Query: 701 MILLDRLHDEL 711
             +LD+LH+E 
Sbjct: 456 THMLDQLHEEF 466

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFIS 632
           TGL N+GNTCY+NS++Q  FA    R   I+
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777

 Score = 32.7 bits (73), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 962  DLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIG 1021
            +LT   N +    L ++ + K   ++KY LF V  H G    GHY + + KD + N    
Sbjct: 1174 ELTTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWTYI-KDFQQN---- 1228

Query: 1022 RSKWYYFDDEVV 1033
             S W  ++DE +
Sbjct: 1229 -SIWRKYNDETI 1239

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFR 627
           GLRN+GNTCY N+ +Q L+  K  R
Sbjct: 107 GLRNMGNTCYFNASLQALYRIKPLR 131

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 8/72 (11%)

Query: 989  YRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKI 1047
            Y L GVV H G    SGHY + V  D + N      KWY ++D+ V    +   ++    
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADEN------KWYKYNDDKVYVVTREKVEQLAGG 468

Query: 1048 SSSD-AYVLFYE 1058
              SD A +L Y+
Sbjct: 469  GESDSALILIYK 480

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
            (REAL)
          Length = 501

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 946  VTLPKILVIHLSRFYYD-LTKKNN----------TVITYPLILNIILKNNDTMKYRLFGV 994
            V LP ILV+HLSR  ++ +T   N           +  Y L  N  +  N  +KY L  V
Sbjct: 337  VQLPDILVVHLSRSTFNGITYCRNPCNVEFGERVKLPEYTLAENRAITENRQVKYNLKSV 396

Query: 995  VNHTGTLISGHY 1006
            V HTG+   GHY
Sbjct: 397  VKHTGSHSRGHY 408

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 45/113 (39%), Gaps = 12/113 (10%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKS--YLQQSRGNRLHSPRLSNSLNMLF 660
           GL+N+GNTCY+N+ +Q L+     R   ++   KS  +      + L    L      L 
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNFPADDESHFLLVQELKRCFQQLK 164

Query: 661 DKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDD------QQDTQEFLMILLDRL 707
           DK       SV P   L V+ +  P     D       QQD +E    L   L
Sbjct: 165 DKPQE----SVTPILLLSVLRRCYPQFAERDSQSGFYKQQDAEELFTQLFHSL 213

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 8/77 (10%)

Query: 984  NDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSD 1042
            N +  Y L GV+ H G    SGHY + +  +++ N      KWY F+D+ V   +K   +
Sbjct: 418  NPSCVYDLIGVITHQGANSESGHYQAFIRDEMDEN------KWYKFNDDKVSVIEKEKIE 471

Query: 1043 KSLKISSSD-AYVLFYE 1058
                   SD A +L Y+
Sbjct: 472  SLAGGGESDSALILVYK 488

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFI 631
           TG+ N+GNTCY+NS++Q  FA    R   +
Sbjct: 722 TGINNIGNTCYLNSLLQFYFAISPLREYIV 751

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186W UBP10 Ubiquitin-specific protease that
           deubiquitinates ubiquitin-protein moieties may regulate
           silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 739

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 55/254 (21%), Positives = 95/254 (37%), Gaps = 67/254 (26%)

Query: 599 LSITGLRNLGNTCYINSMIQCLF-AAKVFRTLF----------ISSKYKSYLQQSRGNRL 647
           L   GL N G TCY N+ +Q +     +   LF          IS +  + +      R+
Sbjct: 359 LKPKGLLNHGVTCYTNAAVQAMLHIPSIQHYLFDVLRGDHKTTISPQSVTQVLAETSKRM 418

Query: 648 HSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRL 707
            SP  + +        Y+N    +   G L  +N +  + +    Q+D+ E+ M L+ RL
Sbjct: 419 WSPEPNKN-------TYINPKKLI---GRLDDINCMMSEWQ----QEDSHEYFMSLMSRL 464

Query: 708 HDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSL 767
            ++   + H   +                                S I DIF G +   +
Sbjct: 465 QEDSVPRGHKLTE--------------------------------SIIYDIFGGLLHQKV 492

Query: 768 QCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPN------EKRVKLEDCINMFTSDEV 821
            CK CG  +     FY LSL +  +  K S    P       ++R  +E  I+ F + E+
Sbjct: 493 TCKSCGGVSKTEQPFYDLSLHL--KGKKKSDETVPENQEDVPQRRYSIEKSISDFFNPEL 550

Query: 822 LS--GENAWDCPRC 833
           +    ++ + C +C
Sbjct: 551 IKVDKKDGYVCEKC 564

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFIS 632
            GL N+GNTCY+NS++Q  FA    R   I+
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLREYLIN 792

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFIS-SKYKSYLQQSRGNRLHSPR 651
           TGL N+GNTCY+NS++Q  F     R   +   K  S   QS G+ L S R
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGH-LESKR 752

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFI 631
            GL N+GNTCY+NS++Q  F+ K  R   +
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFIL 791

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFI 631
           TGL N+GNTCY+NS++Q  F     R   +
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQFIV 732

>Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON}
            YER151C (REAL)
          Length = 905

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 64/146 (43%), Gaps = 43/146 (29%)

Query: 948  LPKILVIHLSRF-YYDLTKKNNTVITY------------------PLIL------NIILK 982
            LP++L+I   RF + +   K+N +  Y                   LI+      +I LK
Sbjct: 767  LPQVLLIQFKRFSFINNVDKDNAMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLK 826

Query: 983  NNDT----MKYRLFGVVNHTG-TLISGHYTSLVNKDLEHNVDIGRSKWYYFDD----EVV 1033
            N+ T      Y+L GV+ H G +   GHYT+ V    EHN      KWY  DD    E+ 
Sbjct: 827  NHATGIADRNYKLTGVIYHHGISSDGGHYTADVYHS-EHN------KWYRIDDVNIIELE 879

Query: 1034 KADKKHGSDKSLKISSSDAYVLFYER 1059
              D   G +++    S  AY+L Y++
Sbjct: 880  DDDVLKGGEEA--SDSRTAYILMYQK 903

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 8/100 (8%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKV--FRTLFISSKYKSYLQQSRGN-RLHSPRLSNSLNM 658
            GL NLGN+CY+NS+IQ L    V  +   F+ SK+   +     N +    +L N++  
Sbjct: 323 CGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVYPDNNLKCQWIKLLNAMK- 381

Query: 659 LFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQE 698
              ++Y NG   + PT F K + Q   +    + QQD  E
Sbjct: 382 CEPELYPNG---IKPTTFKKCIGQNHQEFS-SNRQQDAME 417

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
            {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 8/72 (11%)

Query: 989  YRLFGVVNHTGT-LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKI 1047
            Y L GV+ H G    SGHY S +  D++ +      KWY F+D+ V    K   +     
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDED------KWYNFNDDKVSVVPKEKIEGLAGG 478

Query: 1048 SSSD-AYVLFYE 1058
              SD A +L Y+
Sbjct: 479  GESDSALILIYK 490

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 46/111 (41%), Gaps = 9/111 (8%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDK 662
           G +N+GNTCY+N+ +Q L+  +  R + +   Y      +  +  H  ++   +   F+ 
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMILD--YNQNSTTTPVDETHK-KIVVEMKRCFEN 166

Query: 663 MYLNGGCSVVPTGFLKVVNQLRPDLKIPD------DQQDTQEFLMILLDRL 707
           +      SV+P   L  + +  P     D       QQD +E    L   +
Sbjct: 167 LKSKSYKSVMPMVLLTALRKCYPQFAERDPQSGFYKQQDAEELFTQLCQSM 217

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR---GNRL 647
           TGL N+GNTCY+NS++Q  F+    R   +  +Y+  ++  R   GN L
Sbjct: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL--EYQETMEHFRHHTGNEL 778

>KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly
           similar to uniprot|P38237 YBR058C Saccharomyces
           cerevisiae UBP14 Ubiquitin-specific protease that
           specifically disassembles unanchored ubiquitin chains
          Length = 762

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 48/117 (41%), Gaps = 27/117 (23%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFR------------TLFISSKYKSYLQQSRGNRLHSP 650
           GL+NLGN+CY+NS++Q L    + R             L++SS  +  L + R    + P
Sbjct: 310 GLQNLGNSCYLNSVLQVLLNGDLSRWSLEGLGDFPGDVLYVSSNLRCQLIKMRNALKNEP 369

Query: 651 RLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRL 707
                      + Y +G   V PT F   +     +      QQD  EF    +D L
Sbjct: 370 -----------EKYPHG---VKPTTFKHCIGGTHEEFS-SGRQQDALEFFSYFVDLL 411

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 55/129 (42%), Gaps = 7/129 (5%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKV--FRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNML 659
            GL NLGN+CY+NS++Q LF   V  +    +    +  +  S   +    +L N++   
Sbjct: 313 CGLNNLGNSCYMNSVLQVLFNGAVPDWSLEVLGDFPRDVVYPSTNLKCQLIKLRNAIKR- 371

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719
               Y  G   + P+ F + + +   +      QQD  EF    +D L  +L ++    N
Sbjct: 372 NPSDYTTG---IKPSTFKRCIGESHEEFS-SGRQQDAMEFFTYFIDELDKKLFSRGSNPN 427

Query: 720 DYPNLLLYD 728
           D     + D
Sbjct: 428 DQLRFTMED 436

>KLLA0E14125g Chr5 (1250334..1251767) [1434 bp, 477 aa] {ON} similar
            to uniprot|P43589 Saccharomyces cerevisiae YFR005C SAD1
            Conserved zinc-finger domain protein involved in pre-mRNA
            splicing required for assembly of U4 snRNA into the U4/U6
            particle
          Length = 477

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 19/129 (14%)

Query: 939  TVKTINFVTLPKILVIHLSRF---YYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVV 995
            ++KT   +  PK L++H +RF   +  +  +N T++ +   L         + Y+L   +
Sbjct: 361  SIKTYRILKHPKFLILHFNRFDKGFTSIKDRNKTLVEFSEKLEF-----SGVHYKLLVNI 415

Query: 996  NHTGTL---ISGHYTSLVNKDLEHNVDIGRSKWYYFDD-EVVKADKKHGSDKSLKISSSD 1051
             H   +   IS     L ++   H  D  R +WY FDD EV K +K+        +   +
Sbjct: 416  THDCVIQMKISDTEDLLASRWKVHLADTLRDQWYEFDDIEVNKVEKEF-------LFLKE 468

Query: 1052 AYVLFYERV 1060
             Y+  ++RV
Sbjct: 469  CYIQIWQRV 477

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFR 627
           TGL N+GNTCY+NS++Q  F+    R
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLR 726

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFIS 632
           GL N+GNTCY+NS++Q  FA    R    S
Sbjct: 726 GLNNIGNTCYLNSLLQYYFAIAPLRNYICS 755

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
            YER151C (REAL)
          Length = 910

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 63/146 (43%), Gaps = 43/146 (29%)

Query: 948  LPKILVIHLSRF-YYDLTKKNNTVITY------------------PLIL------NIILK 982
            LP++L+I   RF + +   K+N +  Y                   LI+      +I LK
Sbjct: 772  LPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELIIPEESMSSITLK 831

Query: 983  NN----DTMKYRLFGVVNHTGTLI-SGHYTSLVNKDLEHNVDIGRSKWYYFDD----EVV 1033
            N+    D   Y+L GV+ H G     GHYT+ V    EHN      KWY  DD    E+ 
Sbjct: 832  NHTSGADDRIYKLTGVIYHHGVGSDGGHYTADVYHS-EHN------KWYRIDDVNITELE 884

Query: 1034 KADKKHGSDKSLKISSSDAYVLFYER 1059
              D   G +++    S  AY+L Y++
Sbjct: 885  DDDVLKGGEEA--SDSRTAYILMYQK 908

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 22/31 (70%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFIS 632
           TG+ N+GNTCY+NS++Q  F+    R+  ++
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN 766

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 770

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 53/112 (47%), Gaps = 9/112 (8%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFR-TLFISSKYKSYLQQSRGNRLHSP--RLSNSLNML 659
           GL NLGN+CY+NS++Q L    +    L     + + +   R N LH    ++ N++  L
Sbjct: 317 GLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTN-LHCQLIKIRNAMT-L 374

Query: 660 FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 711
               Y  G   + PT F KV+     +      QQD+ EF   L D+L  E+
Sbjct: 375 QQSRYPEG---IKPTTFKKVIGGSHEEFS-SGRQQDSLEFFSYLSDKLDREI 422

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
            weakly similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072w UBP16
          Length = 483

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 41/86 (47%), Gaps = 11/86 (12%)

Query: 938  TTVKTINFVTLPKILVIHLSRFYYD-LTKKNN--------TVITYPLILNIILKNNDT-- 986
            + +K   FV  P I VIHLSR  Y+ +T   N        T+  +  +      N  T  
Sbjct: 324  SILKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEFTKR 383

Query: 987  MKYRLFGVVNHTGTLISGHYTSLVNK 1012
            ++YRL  +V HTG+  SGHY  L  K
Sbjct: 384  VRYRLKSIVIHTGSHYSGHYQVLRRK 409

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
           (REAL)
          Length = 790

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 64/307 (20%), Positives = 109/307 (35%), Gaps = 88/307 (28%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSY--LQQSRGNR---LHSPR---- 651
           I GL N GNTC++NS++Q L ++K       ++  K+Y  ++Q+  N+    H P     
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSKELMEFLDNNVIKTYEEMEQNEHNKEESEHEPEQGEY 159

Query: 652 -------------------------------------------LSNSLNMLFDKMYLNGG 668
                                                      L + L  L DK Y +  
Sbjct: 160 NNKKNSNRSGKVYGKHKKKLNRKLSSKEEERENQEPDITFSTALRDLLAALNDKYYRDKP 219

Query: 669 CSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLH--------DELSNQPHVAND 720
                +    +    R ++ +  DQ+D QEF   +L  L         ++L + P   ++
Sbjct: 220 YFKTNSLLKSMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDSTPIAKSN 279

Query: 721 YPNLLLYDADGLKVSNKEY--KHWFDKNVIGNG-----------ISPIDDIFQGQMENSL 767
            P   L     L      Y      D N I +            ++P+D I   ++   L
Sbjct: 280 LPEDALVGQQNLGEVGTVYIPTEQIDPNSILHDKSIQNLTPFRLMTPLDGITAERI-GCL 338

Query: 768 QCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENA 827
           QC   G     YS F  LSL +P  ++  +         +KL   ++ ++  E++ G   
Sbjct: 339 QCGENG--GIRYSVFSGLSLNLPNENIGST---------LKLSQLLSDWSKPEIIEG--- 384

Query: 828 WDCPRCG 834
            +C RC 
Sbjct: 385 VECNRCA 391

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 65/164 (39%), Gaps = 36/164 (21%)

Query: 692 DQQDTQEFLMILLDRLHDELSN---------QPHVANDYPNLLLYDADGLKVSNKEY--K 740
           DQ+D QEF   +L  L   + +         +P   +D P   +   + L      Y   
Sbjct: 225 DQEDAQEFFQTILSELEKNVESIYGKPEKDPKPVPQDDLPEDAIVGQEHLGEIGDVYIPT 284

Query: 741 HWFDKN-VIGNG---------ISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIP 790
              D N V+ +G         ++P+D I   ++   LQC   G     YS F  LSL +P
Sbjct: 285 EQIDPNSVLASGRKFYSPYKIVTPLDGITAERI-GCLQCGENG--GIRYSVFSGLSLNLP 341

Query: 791 RRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 834
                   +G P    +KL   ++ ++  E++ G    DC RC 
Sbjct: 342 S-----DNIGSP----IKLSQLLDEWSKPEIIEG---VDCNRCA 373

 Score = 36.2 bits (82), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 20/24 (83%)

Query: 601 ITGLRNLGNTCYINSMIQCLFAAK 624
           + GL N GNTC++NS++QCL ++K
Sbjct: 83  VGGLVNDGNTCFMNSVLQCLASSK 106

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFR--TLFISSKYKSYLQQSRGNR 646
           TG+ N+GNTCY+NS++Q  F+    R   L  S  Y+ +    R  +
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAK 798

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 36.6 bits (83), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 17/88 (19%)

Query: 979  IILKNNDTMKYRLFGVVNHTGTLIS-GHYTS-LVNKDLEHNVDIGRSKWYYFDD----EV 1032
             +  +NDT  Y+L GVV H G   S GHYT+ ++++D E        KWY  DD    E+
Sbjct: 758  FLFSDNDT-SYKLTGVVYHHGLSSSGGHYTADVLHQDEE--------KWYRIDDTTVTEI 808

Query: 1033 VKADKKHGSDKSLKISSSDAYVLFYERV 1060
             K +   G ++     S  AY+L Y+R 
Sbjct: 809  NKEEVVTGGEEGSH--SRTAYILIYQRA 834

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFR 627
           TGL N+GNTCY+NS++Q  F     R
Sbjct: 696 TGLNNIGNTCYLNSLLQYYFTISPLR 721

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFR 627
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 36.2 bits (82), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFR 627
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score = 36.2 bits (82), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFR 627
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 735 TGINNIGNTCYLNSLLQYYFSIAPLR 760

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 51/140 (36%), Gaps = 34/140 (24%)

Query: 694 QDTQEFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGIS 753
           QD  EFL  LL+ + D L                 A GL V N               I+
Sbjct: 403 QDAHEFLNFLLNEVSDYLGAHSEQI----------AQGLDVKNP------------GDIN 440

Query: 754 PIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCI 813
            ++ +FQG + N  +C  C  TT+    F   ++ + + S               ++  +
Sbjct: 441 FVNRLFQGTLTNRTKCLTCDNTTYRNEPFLDFAIEVQQDS------------ETDIQTTL 488

Query: 814 NMFTSDEVLSGENAWDCPRC 833
             F   E+L+G N + C  C
Sbjct: 489 ADFHQKELLNGANKFYCDVC 508

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 57/130 (43%), Gaps = 17/130 (13%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNNTV----ITYPLILNIILKNNDTM--KYRLFG- 993
            + +    LP  L +H+ RF Y   +  N      I YPL L +    + ++  +Y L G 
Sbjct: 516  RVVGLKQLPFYLALHMKRFKYSERQNCNVKLFNRIHYPLHLKVCSTFDSSVCKQYELVGL 575

Query: 994  VVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISS--SD 1051
            VV+  G    GHY S+   +        R  W  FDDE V+   +    K +  S   + 
Sbjct: 576  VVHMGGGPHHGHYVSICKNE--------RFGWLLFDDETVETVNESTVLKFVGNSDDLTT 627

Query: 1052 AYVLFYERVH 1061
            AY+LFY+  +
Sbjct: 628  AYLLFYKETN 637

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFIS 632
           TG+ N+GNTCY+NS++Q  F     R   ++
Sbjct: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin-specific
            protease
          Length = 782

 Score = 35.8 bits (81), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 10/81 (12%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLT--KKNNTVITY--PLILN-IILKNNDTM--- 987
            K T VK    V  P +L++HLSR  +D    +KN   +++   L++N  +++NN  +   
Sbjct: 435  KSTIVKKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFEEELVVNRQVIENNKCVGIR 494

Query: 988  --KYRLFGVVNHTGTLISGHY 1006
               Y+L  ++ H G+  +GHY
Sbjct: 495  KDSYKLRSMLRHQGSHSTGHY 515

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
           Anc_8.202 YER151C
          Length = 854

 Score = 35.8 bits (81), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 53/133 (39%), Gaps = 25/133 (18%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDK 662
           G+ N  N C+++S++Q L +   F  +       S + +   N+         L   FDK
Sbjct: 420 GIINSANICFMSSVLQVLLSCAPFINILNVVSINSNIMKPGVNQTKLLDACIKLYSRFDK 479

Query: 663 ----------------------MYLNGGCSVVPTGFLKVVNQLRP--DLKIPDDQQDTQE 698
                                  Y     ++ P  F KV++ +    DLK    Q+D +E
Sbjct: 480 ESFEAEKEKEKDNESSSKKQSSQYNAKATAISPEEFYKVLSTISKFKDLKW-GHQEDAEE 538

Query: 699 FLMILLDRLHDEL 711
           FL  LLD+LH+E 
Sbjct: 539 FLTHLLDQLHEEF 551

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 35.8 bits (81), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 603 GLRNLGNTCYINSMIQCLFAAKVFRTLFISSK 634
           GL N+GNTCY+NS++Q  F+    R   ++ K
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742

>KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {ON}
           Anc_8.202 YER151C
          Length = 829

 Score = 35.8 bits (81), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 60/141 (42%), Gaps = 39/141 (27%)

Query: 603 GLRNLGNTCYINSMIQCLFAAK-------VFRTLFISSKYKS------------YLQQSR 643
           G+ N  N C+++S++Q L   +       V  T  + S+  S            Y Q  R
Sbjct: 393 GIINTANVCFLSSVLQVLLYCQPFIDVLNVLSTRNVHSRIASSQSKLLDACITIYKQFDR 452

Query: 644 GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPD------LKIPD------ 691
            N L S +   S+    D++  N      PT +  V++ + PD        IP       
Sbjct: 453 ENFLESKKRQQSVE---DEIEDNEKT---PT-YGSVIDAINPDEFYRTISTIPKFKDLQW 505

Query: 692 -DQQDTQEFLMILLDRLHDEL 711
             Q+D +EFL  LLD+LH+EL
Sbjct: 506 GQQEDAEEFLTHLLDQLHEEL 526

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa] {ON}
            YPL072W (UBP16) - putative deubiquitinating enzyme
            [contig 24] FULL
          Length = 749

 Score = 35.8 bits (81), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 936  KLTTVKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITYPLILNII---LKNNDT---- 986
            K T VK       P IL++HLSR  ++     +N+  +T+   L+     ++NN      
Sbjct: 434  KSTIVKKTVVTESPDILILHLSRSVFNGMNYTRNSCYVTFEEELHTQEQEIENNRCVGVK 493

Query: 987  -MKYRLFGVVNHTGTLISGHY 1006
             +KY+L  +V H GT   GHY
Sbjct: 494  PIKYKLKAMVKHEGTHSQGHY 514

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 35.4 bits (80), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 37/141 (26%)

Query: 948  LPKILVIHLSRFYY--DLTKKNNTV---------------------ITYPL--ILNIILK 982
            LP++L+I L RF +  +  K +N                       +T P+  + +  L+
Sbjct: 783  LPRVLLIQLKRFAFVTNSNKDSNMSNYNAYSGRIEKIRKKIIYGHDLTIPIESVSSTSLR 842

Query: 983  NNDTMKYRLFGVVNHTGTLI-SGHYTSLVNKDLEHNVDIGRSKWYYFDD---EVVKADKK 1038
            ++   +Y+L GV+ H G+    GHYT+    D+ H      +KWY  DD     +K D  
Sbjct: 843  DDANREYKLTGVIYHHGSSPDGGHYTA----DVFHQ---QTNKWYRIDDVNISELKNDHV 895

Query: 1039 HGSDKSLKISSSDAYVLFYER 1059
              +D +  + +  AY+L YE+
Sbjct: 896  LDADDN-DMGTRTAYILIYEK 915

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098W UBP9 Ubiquitin-specific protease that
            cleaves ubiquitin-protein fusions
          Length = 714

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 55/126 (43%), Gaps = 17/126 (13%)

Query: 941  KTINFVTLPKILVIHLSRFYYDLTKKNNTV----ITYPLILNIILKNNDTM--KYRLFG- 993
            + +    LP  L +H+ RF Y   +  N      I YPL L +    + ++  +Y L G 
Sbjct: 518  RVVGLKQLPFYLALHMKRFKYSEEQNCNVKLFNRIRYPLDLKVCSTFDASVCKQYELVGL 577

Query: 994  VVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLKISS--SD 1051
            VV+  G    GHY SL   +        R  W  FDDE V+   +    K +  S   + 
Sbjct: 578  VVHMGGGPHHGHYVSLCKNE--------RFGWLLFDDETVETVNESTVLKFVGNSDDLTT 629

Query: 1052 AYVLFY 1057
            AY+LFY
Sbjct: 630  AYLLFY 635

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 60/131 (45%), Gaps = 29/131 (22%)

Query: 940  VKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNI--ILKNND------TMK 988
            ++ ++   LP +L++ L RF + +   + K N  I + + LN+    K  D       + 
Sbjct: 352  IRQLSMAKLPPVLMLQLKRFEHLINGTSVKINDYIFFSVDLNMKDYCKPMDDQHPVPNLT 411

Query: 989  YRLFGVVNHTGTLISGHYTSL--VNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKSLK 1046
            ++L  ++ H GT+  GHYT++  +N D+          W  F+D +V    +    K   
Sbjct: 412  FKLSAIIPHQGTVDKGHYTTICRINGDV----------WAKFNDSMVTLISEEDMLK--- 458

Query: 1047 ISSSDAYVLFY 1057
                 AY+L+Y
Sbjct: 459  ---EQAYLLYY 466

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 602 TGLRNLGNTCYINSMIQCLFAAKVFR 627
            GL N+GNTCY+NS++Q  F     R
Sbjct: 726 AGLNNIGNTCYLNSLLQYYFCISPLR 751

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin- specific
            protease
          Length = 752

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 10/77 (12%)

Query: 940  VKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITYPLILNI---ILKNNDT-----MKY 989
            VK       P+IL++HLSR  ++ T   +N+  + +   L+     ++NN       +KY
Sbjct: 436  VKKTVVTESPEILILHLSRSVFNGTNYTRNSCYVNFDEELHTQEQTIENNRCVGVKPIKY 495

Query: 990  RLFGVVNHTGTLISGHY 1006
            +L  +V H GT   GHY
Sbjct: 496  KLKSMVKHQGTHSQGHY 512

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 108,148,728
Number of extensions: 4779399
Number of successful extensions: 16159
Number of sequences better than 10.0: 282
Number of HSP's gapped: 15996
Number of HSP's successfully gapped: 533
Length of query: 1062
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 942
Effective length of database: 39,721,479
Effective search space: 37417633218
Effective search space used: 37417633218
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)