Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.1957.128ON18918910001e-140
YIL009C-A (EST3)7.128ON1811906974e-94
Smik_9.1857.128ON1821906768e-91
Skud_9.1637.128ON1801896628e-89
NCAS0E021507.128ON1851943953e-48
NDAI0E036907.128ON1962013625e-43
TDEL0H029007.128ON1881963554e-42
Kpol_1062.557.128ON1821933423e-40
Zrou_YGOB_EST37.128ON1681723343e-39
CAGL0C03828g7.128ON1801923137e-36
KAFR0L004807.128ON1801893137e-36
KNAG0L009607.128ON1851923102e-35
Sklu_YGOB_EST37.128ON1961953103e-35
TPHA0C043107.128ON2012092894e-32
ADL016C7.128ON2021932634e-28
Kwal_YGOB_EST37.128ON1921912433e-25
Kthe_YGOB_EST37.128ON1931922303e-23
KLLA0D14289g7.128ON1841942242e-22
ZYRO0C05258gsingletonOFF87791832e-17
TBLA0A009607.128ON2151341861e-16
Sklu_YGOB_Anc_7.128singletonOFF98981344e-10
Kwal_55.20848singletonOFF96971091e-06
KLTH0F12606gsingletonOFF96971002e-05
TDEL0C021507.331ON87882664.4
KLTH0D07106g2.541ON1042122638.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.195
         (189 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.195 Chr9 complement(324112..324381,324353..324373,324377....   389   e-140
YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp...   273   4e-94
Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 b...   265   8e-91
Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 b...   259   8e-89
NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 ...   156   3e-48
NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 ...   144   5e-43
TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 ...   141   4e-42
Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 ...   136   3e-40
Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [5...   133   3e-39
CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 a...   125   7e-36
KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,...   125   7e-36
KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558...   124   2e-35
Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196...   124   3e-35
TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa...   115   4e-32
ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, ...   105   4e-28
Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [57...    98   3e-25
Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026...    93   3e-23
KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} simil...    91   2e-22
ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa] {OF...    75   2e-17
TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 ...    76   1e-16
Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF} ...    56   4e-10
Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa] {OF...    47   1e-06
KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa] {...    43   2e-05
TDEL0C02150 Chr3 (370261..372897) [2637 bp, 878 aa] {ON} Anc_7.3...    30   4.4  
KLTH0D07106g Chr4 complement(621467..624595) [3129 bp, 1042 aa] ...    29   8.9  

>Suva_9.195 Chr9
           complement(324112..324381,324353..324373,324377..324652)
           [567 bp, 189 aa] {ON} YIL009C-A (REAL)
          Length = 189

 Score =  389 bits (1000), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 189/189 (100%), Positives = 189/189 (100%)

Query: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMCPQILT 60
           MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMCPQILT
Sbjct: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMCPQILT 60

Query: 61  NPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRIT 120
           NPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRIT
Sbjct: 61  NPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRIT 120

Query: 121 SETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQVGSLN 180
           SETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQVGSLN
Sbjct: 121 SETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQVGSLN 180

Query: 181 NFPFVYKYL 189
           NFPFVYKYL
Sbjct: 181 NFPFVYKYL 189

>YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp,
           181 aa] {ON}  EST3Component of the telomerase
           holoenzyme, involved in telomere replication
          Length = 181

 Score =  273 bits (697), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 159/190 (83%), Gaps = 10/190 (5%)

Query: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEH-HHIPSDHVIPALAQQDLALPHMCPQIL 59
           MP+V LES+S+  DS+FLQPWIK LI+DNSEH  + PS HVIP+L +QDLALPHM P IL
Sbjct: 1   MPKVILESHSKPTDSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTIL 60

Query: 60  TNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRI 119
           TNP HFA+IT+FYNVCDY+VYAS+RDS+HQIL         VEFS++CVS+FER +N RI
Sbjct: 61  TNPCHFAKITKFYNVCDYKVYASIRDSSHQIL---------VEFSQECVSNFERTHNCRI 111

Query: 120 TSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQVGSL 179
           TSETTNCLMIIGDADL YVT+++A++ F I LS+IS+ E VP+L +NQATIFDIDQVGSL
Sbjct: 112 TSETTNCLMIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVNQATIFDIDQVGSL 171

Query: 180 NNFPFVYKYL 189
           + FPFVYKYL
Sbjct: 172 STFPFVYKYL 181

>Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 bp,
           182 aa] {ON} YIL009C-A (REAL)
          Length = 182

 Score =  265 bits (676), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 153/190 (80%), Gaps = 9/190 (4%)

Query: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHHHI-PSDHVIPALAQQDLALPHMCPQIL 59
           MPRV LES+S+  DSIFLQPWIK L++DNSEHH   PSDHVIP L +QDL LPHM  +IL
Sbjct: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKIL 60

Query: 60  TNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRI 119
           TNP HFA+ITRFYNVCDY+V AS+RDSTHQIL        LVEFS +CVS+FERI+N RI
Sbjct: 61  TNPCHFAKITRFYNVCDYKVCASIRDSTHQIL--------LVEFSPECVSNFERIHNCRI 112

Query: 120 TSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQVGSL 179
           T+ET NCLMIIGDA L   TS++  + F IRLSSIS+++ VP+L INQ TIFDIDQVGSL
Sbjct: 113 TAETVNCLMIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSL 172

Query: 180 NNFPFVYKYL 189
           + FPFVYKYL
Sbjct: 173 SAFPFVYKYL 182

>Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 bp,
           180 aa] {ON} YIL009C-A (REAL)
          Length = 180

 Score =  259 bits (662), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 152/189 (80%), Gaps = 9/189 (4%)

Query: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMCPQILT 60
           MPR+ LES+S+  DSIFLQPWIK L+ DNS+ H  PS+ VIP+L +QDL +PHM  QILT
Sbjct: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHR-PSERVIPSLTRQDLLVPHMSAQILT 59

Query: 61  NPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRIT 120
           NP HF +ITRFY+V +Y+V AS+RDSTHQIL        LVEFSE+CVSDFER +N RIT
Sbjct: 60  NPCHFTKITRFYDVSNYKVCASIRDSTHQIL--------LVEFSEECVSDFERSHNCRIT 111

Query: 121 SETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQVGSLN 180
           SET NCLMIIGDADL YVTS Q +ARF IR+SSIS +E +P+L INQ TIFDIDQVGSL+
Sbjct: 112 SETINCLMIIGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLS 171

Query: 181 NFPFVYKYL 189
            FPFVYK+L
Sbjct: 172 TFPFVYKFL 180

>NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 bp,
           185 aa] {ON} Anc_7.128 YIL009C-A
          Length = 185

 Score =  156 bits (395), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 124/194 (63%), Gaps = 14/194 (7%)

Query: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDN-SEHHHIPSDHV--IPALAQQDLALPHMCPQ 57
           MPRV L S   Q DSIFLQPWI+ L+ ++  +  ++P +    +P+L + DL  P   P+
Sbjct: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60

Query: 58  ILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNF 117
           +LTN  HF ++T+F+ + +Y + AS+RDS  Q         +LVEF+ KCVS+FER ++ 
Sbjct: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQ---------LLVEFTPKCVSNFERRHHR 111

Query: 118 RITSETTNCLMIIGDADLAYVTSTQALARF--MIRLSSISTSETVPILIINQATIFDIDQ 175
           R+TSET NCL++IGDA + Y +  Q   +F  +  + S + S  VPIL INQA++FD DQ
Sbjct: 112 RLTSETLNCLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQ 171

Query: 176 VGSLNNFPFVYKYL 189
           V  L +FPFVY  L
Sbjct: 172 VQHLRSFPFVYSTL 185

>NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 bp,
           196 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 196

 Score =  144 bits (362), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 119/201 (59%), Gaps = 21/201 (10%)

Query: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHH-HIPSDH--VIPALAQQDLALPHMCPQ 57
           MPRV L S     DS+FLQPWI  +I    +   ++P +    I  L+++D+  P +   
Sbjct: 1   MPRVILSSKQTVSDSVFLQPWIANIIRKEIQAKTYLPGNQRLSIARLSRRDMDAPEISET 60

Query: 58  ILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNF 117
           IL N  HFA++T+F++V +Y+++AS+RDST+Q         ILVEF+ +CV +FER+   
Sbjct: 61  ILNNYSHFAKVTKFFSVNNYKIFASIRDSTYQ---------ILVEFTPQCVLEFERVYRS 111

Query: 118 RITSETTNCLMIIGDADLAYVTSTQALARF-MIRLSSISTSET--------VPILIINQA 168
           RITSET NCL +IGD  + Y T +Q  + F    L S++  +          P+L INQA
Sbjct: 112 RITSETVNCLFVIGDCTVIYKTRSQIRSSFPKFDLQSLAGEKNSNKNGFGLFPVLQINQA 171

Query: 169 TIFDIDQVGSLNNFPFVYKYL 189
           ++FD DQV  L  FPF+Y  L
Sbjct: 172 SLFDSDQVQLLFEFPFIYNKL 192

>TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 bp,
           188 aa] {ON} Anc_7.128 YIL009C-A
          Length = 188

 Score =  141 bits (355), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 78/196 (39%), Positives = 119/196 (60%), Gaps = 20/196 (10%)

Query: 1   MPRVFLESNSRQVDSIFLQPWIKL----LIDDNSEHHHIPSDHVIPALAQQDLALPHMCP 56
           MP+  L S+S+Q D++FL PWI+     LI D S+   +P  + IP L  +DL  P + P
Sbjct: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIR-LPVFNFIPKLQLKDLRKPQLSP 59

Query: 57  QILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINN 116
           +IL NP HF ++ +F++V  ++V+A+VRDS HQ         ILVEF+ +CVS+FER + 
Sbjct: 60  RILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQ---------ILVEFTPQCVSEFERTHR 110

Query: 117 FRITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTS------ETVPILIINQATI 170
            RIT ET + L II D  L +      L  F I + +  ++       T+P+LI+NQA+ 
Sbjct: 111 SRITLETEHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQ 170

Query: 171 FDIDQVGSLNNFPFVY 186
           F++DQ+ S  +FP++Y
Sbjct: 171 FEMDQIESFEHFPYLY 186

>Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 aa]
           {ON} (125085..125366,125368..125634) [549 nt, 183 aa]
          Length = 182

 Score =  136 bits (342), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 110/193 (56%), Gaps = 20/193 (10%)

Query: 1   MPRVFLESN-SRQVDSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLA-----LPHM 54
           MP++ L SN S  VDS +LQ WI L+ID N ++    +  VIP L +         +  +
Sbjct: 1   MPKIILPSNKSSCVDSTYLQEWIDLIIDRNYDN----TGEVIPILDEYGFNDSQSYMSSV 56

Query: 55  CPQILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERI 114
              I+  P+HFA++T F+NV DY VYAS+RD   Q+LS         EF+  CVS FER+
Sbjct: 57  INLIIKKPYHFAKVTNFFNVVDYSVYASIRDRKFQVLS---------EFTSNCVSSFERL 107

Query: 115 NNFRITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETV-PILIINQATIFDI 173
            N RIT  T NCL +IGD  L ++T  +    + + LSSI    ++ P+L INQA +FD 
Sbjct: 108 YNSRITENTINCLFLIGDCKLKFMTYWEIKELYKLDLSSICNKNSLYPVLSINQARMFDW 167

Query: 174 DQVGSLNNFPFVY 186
            Q+ S   F ++Y
Sbjct: 168 SQIKSFEKFDWIY 180

>Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [507
           bp, 168 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 168

 Score =  133 bits (334), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 104/172 (60%), Gaps = 17/172 (9%)

Query: 14  DSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMCPQILTNPFHFARITRFYN 73
           DS+FLQPWI+  +   +EH     D +IP +  QDL+ P +  ++L+N  HF ++TRF++
Sbjct: 12  DSVFLQPWIQTAL---AEHDPRLGDRLIPPVPTQDLSQPELSSKVLSNIRHFVKVTRFFD 68

Query: 74  VCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRITSETTNCLMIIGDA 133
           V  Y VYAS+RDS  Q         +LVEF+ +CVSDFER    RIT+ETTNC+ II D 
Sbjct: 69  VDHYTVYASIRDSKAQ---------LLVEFTPQCVSDFERRYYTRITAETTNCVFIIADC 119

Query: 134 DLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQVGSLNNFPFV 185
            L Y + +     + I    ++  ET P+L +NQ  IFD DQV SL  +P V
Sbjct: 120 QLIYHSPSYIENHYKI----VTRGET-PVLRVNQTAIFDWDQVESLETYPLV 166

>CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 aa]
           {ON} similar to uniprot|Q03096 Saccharomyces cerevisiae
           YIL009ca
          Length = 180

 Score =  125 bits (313), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 109/192 (56%), Gaps = 15/192 (7%)

Query: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMCPQILT 60
           MP    +S S  V+S++L  W++ ++ ++    +I    VIP +   + ++P +  +I  
Sbjct: 1   MPPFIPKSRSNAVESVYLHGWVRDMLLESKTSQNIA---VIPRVDPDEASIPLLSRRIYA 57

Query: 61  NPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRIT 120
           N  HF +IT+F+ V +Y VYASV+DS HQILS         +F+ KCVS+FE  N  RIT
Sbjct: 58  NRRHFVKITKFFQVHNYSVYASVKDSQHQILS---------QFTPKCVSEFESRNRSRIT 108

Query: 121 SETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTS---ETVPILIINQATIFDIDQVG 177
           S+T N L +IGDA L  +   +    F  ++ S+        +P LIINQA I D DQV 
Sbjct: 109 SDTVNTLFMIGDAKLGIMVVDELRHYFGEKIVSLFNGLDMPYIPYLIINQAFILDYDQVE 168

Query: 178 SLNNFPFVYKYL 189
           +    PFVY+Y+
Sbjct: 169 AFKMTPFVYQYI 180

>KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,
           180 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 180

 Score =  125 bits (313), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 105/189 (55%), Gaps = 15/189 (7%)

Query: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMC-PQIL 59
           MP V L S   + DSIF+  WIK L+D+N +    P    IP +   ++  P    P +L
Sbjct: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSRPSLL 60

Query: 60  TNPF--HFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNF 117
           T     HF +I +FY V +++++AS+RD+  QIL         VEF+  CVS FER N  
Sbjct: 61  TTKVKCHFTKIVKFYKVENFKIFASIRDTRFQIL---------VEFTPHCVSTFERTNRC 111

Query: 118 RITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQVG 177
           R+TS+TTNC ++IGD  + Y +S +    + +   +      +P+L INQA+I D DQ  
Sbjct: 112 RLTSDTTNCTLLIGDCSIEYKSSHEISQNYRLNFPN---KRLLPVLTINQASILDRDQAT 168

Query: 178 SLNNFPFVY 186
            L  FPFVY
Sbjct: 169 LLEQFPFVY 177

>KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558
           bp, 185 aa] {ON} Anc_7.128 YIL009C-A ribosomal
           frameshifting
          Length = 185

 Score =  124 bits (310), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 106/192 (55%), Gaps = 14/192 (7%)

Query: 1   MPRVFLESNSRQV-DSIFLQPWIKLLIDDNSEHHHI--PSDHVIPALAQQDLALPHMCPQ 57
           MP V L     +  + IF  PWIK L+   +E   +  P   +IP L   DL  P    +
Sbjct: 1   MPAVKLSQTGHKFQEWIFTHPWIKNLVKLPTEEISLMRPVRQIIPKLTTNDLKNPTRSKR 60

Query: 58  ILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNF 117
           +L N  HFA++ +FY+V +Y+V+A +RDS  Q         +LVEF  +CVS FER ++ 
Sbjct: 61  VLKNKTHFAKVMKFYSVHNYKVFACIRDSECQ---------LLVEFHPECVSYFERFHHC 111

Query: 118 RITSETTNCLMIIGDADLAYVTSTQALARFMIRL--SSISTSETVPILIINQATIFDIDQ 175
           RITS T NCL +IG+ DL Y +  +    F I +        + +P+L+INQAT+ D  Q
Sbjct: 112 RITSGTVNCLFVIGNCDLEYRSVARVNDEFRINILPRKQKLMDQIPVLVINQATVADWGQ 171

Query: 176 VGSLNNFPFVYK 187
           + +   FPFV++
Sbjct: 172 MEAQTTFPFVHQ 183

>Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196
           aa] {ON} ANNOTATED BY YGOB - Ribosomal frameshifting
           (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 196

 Score =  124 bits (310), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 113/195 (57%), Gaps = 18/195 (9%)

Query: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHH---HIPSD--HVIPALAQQDLALP-HM 54
           MP+V L S +++ DSI+L  WI   I  +        I  D    +P+L  +D+    H+
Sbjct: 1   MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 55  CPQILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMC-ILVEFSEKCVSDFER 113
             +I+ N  HF ++T+FY V +Y+VYAS RDS          +C ILVEF+  CVS+FER
Sbjct: 61  SRKIILNHRHFIKLTKFYQVNNYQVYASARDS----------LCSILVEFTACCVSNFER 110

Query: 114 INNFRITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTS-ETVPILIINQATIFD 172
           +++ RITSETTN L +IGD  L ++       +F I ++  +     VPIL +NQA ++D
Sbjct: 111 LHHSRITSETTNTLFVIGDVKLVFMDKASVSQKFGIDITQFNPQLNLVPILRVNQAFVYD 170

Query: 173 IDQVGSLNNFPFVYK 187
           +DQV S   FPF Y+
Sbjct: 171 MDQVESNRKFPFFYQ 185

>TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa]
           {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 201

 Score =  115 bits (289), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 103/209 (49%), Gaps = 36/209 (17%)

Query: 1   MPRVFLESN-SRQVDSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMCPQIL 59
           MP++ L S  +   DSIFL+PWIK  I+D  ++      ++   L   ++ L      IL
Sbjct: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIEDGKKNSIGKIGNLDELLNNTNVKLQ----LIL 56

Query: 60  TNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRI 119
             P    ++T  YN+ +Y V+ S+RD+ HQ+L         VEF+  CVS+FER    RI
Sbjct: 57  KYPNQLVKLTNIYNILNYCVFGSIRDNKHQLL---------VEFTSNCVSNFERNYKIRI 107

Query: 120 TSETTNCLMIIGDADLAYVTSTQALARFMIR----------------------LSSISTS 157
           T +T NCL +IGD  + YVT  + L  F I                       LS    +
Sbjct: 108 TDQTKNCLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFN 167

Query: 158 ETVPILIINQATIFDIDQVGSLNNFPFVY 186
              PIL +NQ  IFD DQV +  N+PFVY
Sbjct: 168 RLYPILQVNQVMIFDWDQVVTFENYPFVY 196

>ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, 202
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YIL009C-A (EST3)
          Length = 202

 Score =  105 bits (263), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 98/193 (50%), Gaps = 16/193 (8%)

Query: 1   MPRVFLESNSRQVDSIFLQPW-----IKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMC 55
           MP+V L S + + DSIFL+ W     +  L    +       +  IPAL      L  + 
Sbjct: 1   MPKVVLASRAHKADSIFLREWLVDAVVPALERSGACAPWAGVECFIPALPPATATL-SLE 59

Query: 56  PQILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERIN 115
           P ++ NP  F RI RF  V D+ V A  RD+           CILVEF+  CVS+FER  
Sbjct: 60  PTVIQNPKRFLRIVRFTRVHDFAVCAVARDAG---------CCILVEFTPHCVSNFERRY 110

Query: 116 NFRITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQ 175
           + RITS T N L +IG+  L +   + A A F +  + ++ S T+P+L +    IFD DQ
Sbjct: 111 HQRITSSTVNSLFVIGNTSLLFYARSDAAAAFEVP-ALMNGSSTLPVLRVGDCAIFDQDQ 169

Query: 176 VGSLNNFPFVYKY 188
           V S   FP V ++
Sbjct: 170 VESHRRFPLVQEH 182

>Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [579
           bp, 192 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 192

 Score = 98.2 bits (243), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 101/191 (52%), Gaps = 15/191 (7%)

Query: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHH-HIPS----DHVIPALAQQDLALPHMC 55
           MP+       +Q +S FL+ WI+  + +  + H  +P     +  +P++ + D  +  + 
Sbjct: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPM-QLS 59

Query: 56  PQILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERIN 115
            Q+L N  HF +IT F+ + ++ VYAS RD + QIL         VEF+ KCVS FER +
Sbjct: 60  SQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL---------VEFTPKCVSQFERRH 110

Query: 116 NFRITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQ 175
             RIT+ T N + +IG   + Y+   +    +       +    +P+L++N+ T+FD+DQ
Sbjct: 111 GLRITARTVNTIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQ 170

Query: 176 VGSLNNFPFVY 186
           V S   F ++Y
Sbjct: 171 VESRRKFNYLY 181

>Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026)
           [582 bp, 193 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006).
           Replaces KLTH0F12606g.
          Length = 193

 Score = 93.2 bits (230), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 107/192 (55%), Gaps = 15/192 (7%)

Query: 1   MPRVFLESNSRQVDSIFLQPWI-KLLIDDNSEHHHIP----SDHVIPALAQQDLALPHMC 55
           M ++   +  +Q +S+FL+ WI   ++    EH  +P      + +P LA+    +P   
Sbjct: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60

Query: 56  PQILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERIN 115
            +IL N  HF +IT F+ V  + V+AS RD+  +IL         VEF+ +CVS FER+N
Sbjct: 61  -EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL---------VEFTPQCVSAFERLN 110

Query: 116 NFRITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQ 175
           + RIT++T N +++IG   L Y+   +A  ++ + +        VP+L++ Q  +FD+DQ
Sbjct: 111 SIRITAKTVNTILLIGSGTLKYLPVHEAYTQWSLSIPLDPRVPVVPVLVVEQCAVFDLDQ 170

Query: 176 VGSLNNFPFVYK 187
           V +  +F ++Y+
Sbjct: 171 VEARPSFDYLYQ 182

>KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} similar
           to uniprot|Q03096 Saccharomyces cerevisiae YIL009C-A
           EST3 Component of the telomerase holoenzyme involved in
           telomere replication
          Length = 184

 Score = 90.9 bits (224), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 90/194 (46%), Gaps = 17/194 (8%)

Query: 1   MPRVFLESNSRQVDSIFLQPWIKLLID----DNSEHHHIPSD-HVIPALAQQDLALPHMC 55
           MP V L S     DS+FLQ WIK  +      N +    P    ++  L + D+      
Sbjct: 1   MPNVVLSSRLTNNDSVFLQEWIKPSVRPYYLKNEKTKFWPEQRELVTDLLEHDIIESAFQ 60

Query: 56  PQILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERIN 115
             +   P  F RI +F+ V DY VYA++RDST           IL  F+  CV D+E IN
Sbjct: 61  TALNPAPQRFVRIVKFHRVNDYTVYATIRDST---------ALILCYFTVDCVLDYETIN 111

Query: 116 NFRITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQ 175
           N RIT  T N L +IG+  L +    +    F      +     VP+L I +A +FD DQ
Sbjct: 112 NDRITLNTLNTLFVIGNVTLQFWNHRECKLWFNQDFPGL---RMVPVLKIEKARMFDRDQ 168

Query: 176 VGSLNNFPFVYKYL 189
           + S   F +VY  L
Sbjct: 169 ISSNVQFEWVYDTL 182

>ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa]
          {OFF} some similarities with uniprot|Q03096
          Saccharomyces cerevisiae YIL009C-A
          Length = 87

 Score = 75.1 bits (183), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 53/79 (67%), Gaps = 3/79 (3%)

Query: 14 DSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMCPQILTNPFHFARITRFYN 73
          DS+FLQPWI+  +   +EH     D +IP +  QDL+ P +  ++L+N  HF ++TRF++
Sbjct: 12 DSVFLQPWIQTAL---AEHDPRLGDRLIPPVPTQDLSQPELSSKVLSNIRHFVKVTRFFD 68

Query: 74 VCDYRVYASVRDSTHQILS 92
          V  Y VYAS+RDS  Q+LS
Sbjct: 69 VDHYTVYASIRDSKAQLLS 87

>TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 bp,
           215 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 215

 Score = 76.3 bits (186), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 71/134 (52%), Gaps = 17/134 (12%)

Query: 64  HFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRITSET 123
           H  +IT+F+ V +Y++ ASV+D+  QIL         VE +  CV+++ER    R+TS T
Sbjct: 91  HIIKITKFFKVNNYKICASVQDAECQIL---------VELTPICVTEYERKTRDRMTSNT 141

Query: 124 TNCLMIIGDADLAYVTSTQALARF--------MIRLSSISTSETVPILIINQATIFDIDQ 175
            +CL +IGD  L +    + L  F        +  L+++     +P+L+INQ    D   
Sbjct: 142 LDCLFVIGDCRLYFQNKNEVLHNFNCNTFRNIIPGLNALDRDSLIPVLVINQIICVDRHP 201

Query: 176 VGSLNNFPFVYKYL 189
             SL+  PF++ YL
Sbjct: 202 SKSLSTLPFLHSYL 215

>Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF}
          ANNOTATED BY YGOB -
          Length = 98

 Score = 56.2 bits (134), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 55/98 (56%), Gaps = 6/98 (6%)

Query: 1  MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHH---HIPSD--HVIPALAQQDLALP-HM 54
          MP+V L S +++ DSI+L  WI   I  +        I  D    +P+L  +D+    H+
Sbjct: 1  MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 55 CPQILTNPFHFARITRFYNVCDYRVYASVRDSTHQILS 92
            +I+ N  HF ++T+FY V +Y+VYAS RDS   ILS
Sbjct: 61 SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSILS 98

>Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa]
          {OFF} [contig 138] FULL
          Length = 96

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 53/97 (54%), Gaps = 6/97 (6%)

Query: 1  MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHH-HIPS----DHVIPALAQQDLALPHMC 55
          MP+       +Q +S FL+ WI+  + +  + H  +P     +  +P++ + D  +  + 
Sbjct: 1  MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPM-QLS 59

Query: 56 PQILTNPFHFARITRFYNVCDYRVYASVRDSTHQILS 92
           Q+L N  HF +IT F+ + ++ VYAS RD + QILS
Sbjct: 60 SQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILS 96

>KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa]
          {OFF} no similarity
          Length = 96

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 52/97 (53%), Gaps = 6/97 (6%)

Query: 1  MPRVFLESNSRQVDSIFLQPWI-KLLIDDNSEHHHIP----SDHVIPALAQQDLALPHMC 55
          M ++   +  +Q +S+FL+ WI   ++    EH  +P      + +P LA+    +P   
Sbjct: 1  MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60

Query: 56 PQILTNPFHFARITRFYNVCDYRVYASVRDSTHQILS 92
           +IL N  HF +IT F+ V  + V+AS RD+  +ILS
Sbjct: 61 -EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILS 96

>TDEL0C02150 Chr3 (370261..372897) [2637 bp, 878 aa] {ON} Anc_7.331
           YDL154W
          Length = 878

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 2/82 (2%)

Query: 100 LVEFSEKCVSDFERINNFRITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSET 159
           L  F +K +  +  I+ FR  SET N    +GD       + Q L   +  +  I TS+ 
Sbjct: 330 LTVFLKKGIESYHLISTFRFDSETDNLFSKLGDR--VNPLALQGLIDQVENIIDIETSKE 387

Query: 160 VPILIINQATIFDIDQVGSLNN 181
             +++IN     ++D+   L N
Sbjct: 388 TKLVVINDGIDENLDKYKKLYN 409

>KLTH0D07106g Chr4 complement(621467..624595) [3129 bp, 1042 aa]
           {ON} similar to uniprot|P36097 Saccharomyces cerevisiae
           YKL033W Protein of unknown function localized to the
           cytoplasm.
          Length = 1042

 Score = 28.9 bits (63), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 18/122 (14%)

Query: 67  RITRFYNVCDYRVYASVRDSTHQILSVFREMCILVE------FSEK-CVSDFERINNFRI 119
           ++TR  N   +    +++   + + +++   C+  E      FS K CVSDF    N R 
Sbjct: 389 KVTRISNAIQFEDIKALQTIQYGLQTLYSYQCLDFEMVDGLVFSLKSCVSDFLEQKNLRF 448

Query: 120 TS---ETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTS--ETVPILIINQATIFDID 174
           T    +    ++I+G   L    ++Q L      L  IST+  ET+  L+    T +  D
Sbjct: 449 TEGKLKEQGGMVIVGQDFLTLTETSQPL------LPKISTALEETLSQLLHTLGTCYSRD 502

Query: 175 QV 176
            +
Sbjct: 503 HI 504

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.138    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,903,799
Number of extensions: 724178
Number of successful extensions: 2278
Number of sequences better than 10.0: 27
Number of HSP's gapped: 2290
Number of HSP's successfully gapped: 27
Length of query: 189
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 86
Effective length of database: 41,670,801
Effective search space: 3583688886
Effective search space used: 3583688886
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 62 (28.5 bits)