Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.1947.126ON21521511081e-156
Skud_9.1627.126ON2172139311e-129
YIL010W (DOT5)7.126ON2152158641e-118
Smik_9.1847.126ON2142118591e-118
SAKL0F05368g7.126ON2312236672e-88
Kpol_1062.577.126ON2192176601e-87
KLLA0D14333g7.126ON2052086462e-85
KAFR0K012007.126ON2021796417e-85
CAGL0C03850g7.126ON2092156113e-80
KNAG0G010207.126ON2072086001e-78
NCAS0F008107.126ON2312265986e-78
NDAI0H013107.126ON2611515843e-75
TDEL0H028807.126ON3541765889e-75
TBLA0A009407.126ON2881485794e-74
ADL018W7.126ON2442355668e-73
ZYRO0C05214g7.126ON2701475558e-71
Ecym_83517.126ON2242275501e-70
Kwal_55.208397.126ON3051915362e-67
TPHA0C043307.126ON2092135133e-65
KLTH0F12562g7.126ON2932094726e-58
NCAS0A091301.329ON373107850.017
TDEL0C015907.388ON249137720.69
Suva_16.1166.193ON78075683.3
ZYRO0B03256g7.388ON254169663.9
Smik_6.3966.193ON81575664.5
NDAI0D03540na 1ON110737664.8
YPL190C (NAB3)6.193ON80275665.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.194
         (215 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   431   e-156
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   363   e-129
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   337   e-118
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   335   e-118
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   261   2e-88
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   258   1e-87
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   253   2e-85
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   251   7e-85
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   239   3e-80
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   235   1e-78
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   234   6e-78
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   229   3e-75
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   231   9e-75
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   227   4e-74
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   222   8e-73
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   218   8e-71
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   216   1e-70
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   211   2e-67
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   202   3e-65
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   186   6e-58
NCAS0A09130 Chr1 complement(1807477..1808598) [1122 bp, 373 aa] ...    37   0.017
TDEL0C01590 Chr3 complement(275920..276669) [750 bp, 249 aa] {ON...    32   0.69 
Suva_16.116 Chr16 complement(195223..197565) [2343 bp, 780 aa] {...    31   3.3  
ZYRO0B03256g Chr2 (268100..268864) [765 bp, 254 aa] {ON} highly ...    30   3.9  
Smik_6.396 Chr6 (636768..639215) [2448 bp, 815 aa] {ON} YPL190C ...    30   4.5  
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    30   4.8  
YPL190C Chr16 complement(185317..187725) [2409 bp, 802 aa] {ON} ...    30   5.4  

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  431 bits (1108), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 215/215 (100%), Positives = 215/215 (100%)

Query: 1   MGEALRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGA 60
           MGEALRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGA
Sbjct: 1   MGEALRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGA 60

Query: 61  NELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120
           NELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED
Sbjct: 61  NELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120

Query: 121 LKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180
           LKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF
Sbjct: 121 LKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180

Query: 181 VDGKLRFKRVKISPEVSVGDAKKEVMELAEKFEKE 215
           VDGKLRFKRVKISPEVSVGDAKKEVMELAEKFEKE
Sbjct: 181 VDGKLRFKRVKISPEVSVGDAKKEVMELAEKFEKE 215

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  363 bits (931), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 177/213 (83%), Positives = 192/213 (90%)

Query: 1   MGEALRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGA 60
           MGEALRRS RIA SKRLLE+E SKLVP+SPPE  KKK+KT PK+   EPVK ED S   A
Sbjct: 1   MGEALRRSTRIAASKRLLEDEESKLVPISPPEVPKKKVKTAPKVKTSEPVKSEDDSLSAA 60

Query: 61  NELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120
            EL++GD IPDLSLL+EDNDP+SLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED
Sbjct: 61  TELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120

Query: 121 LKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180
           LK+HAAVFGLSAD V SQKKFQTKQ LPYHL+SDPKREFIGLLGAKKTPLSGSIRSHFVF
Sbjct: 121 LKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVF 180

Query: 181 VDGKLRFKRVKISPEVSVGDAKKEVMELAEKFE 213
           V+GKLRFKR+KISPEVSV DAKKEV+E+AE+ E
Sbjct: 181 VNGKLRFKRIKISPEVSVSDAKKEVLEIAERVE 213

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  337 bits (864), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 189/215 (87%)

Query: 1   MGEALRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGA 60
           MGEALRRS RIA SKR+LE E SKL P+S PE  KKKIKT PK +  + V +E + S   
Sbjct: 1   MGEALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDV 60

Query: 61  NELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120
           NEL++GD IPDLSLLNEDND +SLK+I + N++VVFFVYP+ASTPGCTRQACGFRDNY++
Sbjct: 61  NELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQE 120

Query: 121 LKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180
           LK++AAVFGLSADSV SQKKFQ+KQ LPYHLLSDPKREFIGLLGAKKTPLSGSIRSHF+F
Sbjct: 121 LKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIF 180

Query: 181 VDGKLRFKRVKISPEVSVGDAKKEVMELAEKFEKE 215
           VDGKL+FKRVKISPEVSV DAKKEV+E+AEKF++E
Sbjct: 181 VDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKEE 215

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  335 bits (859), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 164/211 (77%), Positives = 187/211 (88%)

Query: 1   MGEALRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGA 60
           MG+ALRRS RIA SKR LE+E SK  P+SPPE  KK++KT  K+ + E   + D+S+  +
Sbjct: 1   MGKALRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTS 60

Query: 61  NELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120
            ELK+GD IPDLSLL+EDND +SLK+IA+ENKIVVFFVYPKASTPGCTRQACGFRDNY+D
Sbjct: 61  TELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDD 120

Query: 121 LKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180
           LK+H+AVFGLS+DSV SQK+FQTKQ LPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF
Sbjct: 121 LKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180

Query: 181 VDGKLRFKRVKISPEVSVGDAKKEVMELAEK 211
           VDGKLRFKRVKISPEVSV DAKKE++ELAEK
Sbjct: 181 VDGKLRFKRVKISPEVSVNDAKKEILELAEK 211

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  261 bits (667), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 140/223 (62%), Positives = 166/223 (74%), Gaps = 12/223 (5%)

Query: 5   LRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLD--IEEPV------KREDHS 56
           LRRS R+A SK+L + E   + P +      +K K+  K++   E+ V      K ED  
Sbjct: 4   LRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSEDEP 63

Query: 57  SLGAN----ELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQAC 112
           +   N    EL+VGDDIPDL L N+D+  +SLKE+AK+N+IVVFF YPKASTPGCTRQ C
Sbjct: 64  TEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVC 123

Query: 113 GFRDNYEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSG 172
           G+RDNYEDLKEHAAVFGLSAD+  +QK FQTKQ LPY LLSDPKREFIGLLGAKKTP SG
Sbjct: 124 GYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSG 183

Query: 173 SIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEVMELAEKFEKE 215
            IRSH+VF +GKLRFKRVKISPE SV D KKEV+ELA+  EK+
Sbjct: 184 VIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDLEKD 226

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  258 bits (660), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 132/217 (60%), Positives = 161/217 (74%), Gaps = 6/217 (2%)

Query: 4   ALRRSARIATSKRLLE-NEGSKLVPVSPPEPAK-----KKIKTVPKLDIEEPVKREDHSS 57
           A+RRS RIA SKR LE +E  + V     E        KK K V    +++   + ++  
Sbjct: 3   AVRRSTRIANSKRKLEADEAERDVASKSGEETTSSKKLKKEKDVRVTKVDDKESKAENKP 62

Query: 58  LGANELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDN 117
            G  E+++GD+IPDL L N+D   +SL+++AK+N I+VFF YP+A TPGCTRQACGFRD 
Sbjct: 63  SGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDT 122

Query: 118 YEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSH 177
           Y+DLK+HAAVFGLSADS  SQKKFQ K  LPY LLSDPKREFIGLLGAKKTP SG IRSH
Sbjct: 123 YDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSH 182

Query: 178 FVFVDGKLRFKRVKISPEVSVGDAKKEVMELAEKFEK 214
           F+FVDGKLRFKR+KISPE+SV D KKEV+E+ E+F K
Sbjct: 183 FIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFSK 219

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  253 bits (646), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 163/208 (78%), Gaps = 12/208 (5%)

Query: 5   LRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKT---VPKLDIEEPVKREDHSSLGAN 61
           LRRS RI+  K  L++E +        EP K K KT   V K + ++ VK ED ++  A 
Sbjct: 4   LRRSNRISAKKEPLDSESA--------EPIKVKAKTESKVTKPNGKKEVKNEDSANKLA- 54

Query: 62  ELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121
           EL++GDDIPDL+LLN+D++P+SLKE+A +NK+VVFF YPKASTPGCTRQACG+RDNY +L
Sbjct: 55  ELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSEL 114

Query: 122 KEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFV 181
           KEHAAVFGLSAD+  SQK FQTKQ LP+ LLSDPKREFIG LGAKKT +SG +RSH++F 
Sbjct: 115 KEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFK 174

Query: 182 DGKLRFKRVKISPEVSVGDAKKEVMELA 209
           +GKL  KRV++SPEVS+ + KKEV+ELA
Sbjct: 175 NGKLEVKRVQVSPEVSIEEGKKEVLELA 202

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  251 bits (641), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 150/179 (83%), Gaps = 5/179 (2%)

Query: 33  PAKKKIKTVPKLDIEEPVKREDHSSLGANELKVGDDIPDLSLLNEDNDPVSLKEIAKENK 92
           P KK+  T+ K   EE V  E   ++ ++EL++GD +PD++L+N+DN  +SL+E+AK NK
Sbjct: 26  PEKKRRVTISK---EETV--ESSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNK 80

Query: 93  IVVFFVYPKASTPGCTRQACGFRDNYEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLL 152
           I+V F YPKASTPGCTRQACGFRDNY+++K+HAAVFGLSADSV+SQK+FQ KQ LP+ LL
Sbjct: 81  ILVLFAYPKASTPGCTRQACGFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELL 140

Query: 153 SDPKREFIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEVMELAEK 211
           SDPKRE IG+LGAKKTP SG IRSH+VF+DGKLRF+ +K+SPE S+ ++KKEVMELAEK
Sbjct: 141 SDPKRELIGILGAKKTPQSGIIRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELAEK 199

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  239 bits (611), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 126/215 (58%), Positives = 158/215 (73%), Gaps = 17/215 (7%)

Query: 5   LRRSARI-ATSKRLLENEGSKLVPVSPPEPAKKKIKTV--PKLDIEEPVKR----EDHSS 57
           LRRS R+ A     +++EG          P KKK K+V   K++ +EPVK+    E+  S
Sbjct: 3   LRRSTRLSAKHGNEVKDEG----------PIKKKAKSVLKEKVNTKEPVKKPNTKEEKVS 52

Query: 58  LGANELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDN 117
                L+VGDDIPD++L N+D   VSLK +AKENK+++ F+YPKASTPGCTRQACGFRDN
Sbjct: 53  SDEAILEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDN 112

Query: 118 YEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSH 177
           ++DLKEH  V GLS D+  +Q KF+ K  LPY LL DP REFIG+LGAKKTP SGSIRSH
Sbjct: 113 FDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSH 172

Query: 178 FVFVDGKLRFKRVKISPEVSVGDAKKEVMELAEKF 212
           FVF DGKL+FKR+KISPE+SV D KKEV+ELA+++
Sbjct: 173 FVFADGKLKFKRLKISPEISVADGKKEVLELAKQY 207

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  235 bits (600), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 154/208 (74%), Gaps = 4/208 (1%)

Query: 5   LRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGANELK 64
           LR+SAR+A  K+    + +   P +  +  KK         ++   + ED   + A  L+
Sbjct: 4   LRKSARVANIKK----QTTLTTPATSNKIVKKTSNAASHKKVKIVAETEDKPLVDAKVLE 59

Query: 65  VGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDLKEH 124
           +GD+IPDL+L++++ + VSL E+A  NKI+V F YP+ASTPGCTRQACGFRDNY +LK+H
Sbjct: 60  IGDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTRQACGFRDNYAELKKH 119

Query: 125 AAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVDGK 184
           AAV+GLSAD+V SQKKFQTKQ LPY+LLSDPKREFIG+LGAKKT  SG IRS+++F +GK
Sbjct: 120 AAVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTSQSGIIRSYWIFFNGK 179

Query: 185 LRFKRVKISPEVSVGDAKKEVMELAEKF 212
           LR K++K+SPE SV ++K EV+EL ++ 
Sbjct: 180 LRIKKIKVSPEASVAESKAEVLELVKEL 207

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  234 bits (598), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 128/226 (56%), Positives = 161/226 (71%), Gaps = 21/226 (9%)

Query: 5   LRRSARIATSKR---LLENEGSKLVPVSPPEPAKKKIKTV---------PKLD----IEE 48
           LRRS RI+T K+   L E +  ++ P    +   K  K V         PKLD    I +
Sbjct: 4   LRRSGRISTLKKTHFLTEEDSEEVKPAIKKQRVSKTKKIVIKKSNGKMKPKLDGKEEIVK 63

Query: 49  PVKREDHSSLGAN-----ELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKAS 103
            VK  D +++        EL++GDDIPD+ L +E+   VSLK++ +ENKIVVFF +PKA+
Sbjct: 64  SVKELDSTAVKNTDSIYKELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFPKAN 123

Query: 104 TPGCTRQACGFRDNYEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLL 163
           TPGCTRQACGFRDNY++LKEHAAV+G+SAD V +QKKF+TKQ LPY LLSD KR+FIGLL
Sbjct: 124 TPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFIGLL 183

Query: 164 GAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEVMELA 209
           GAKKTP SG IRS+F+FVDGKL+ KRVKISPE+SV +A+KEV   A
Sbjct: 184 GAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFA 229

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  229 bits (584), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 101/151 (66%), Positives = 132/151 (87%)

Query: 62  ELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121
           EL++GDDIPD++L N++   +SLKEIAK NKI+V F +P+ASTPGCTRQACGFRDNY++L
Sbjct: 108 ELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDEL 167

Query: 122 KEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFV 181
           K++A VFGLSAD++ SQKKF+ KQ LPY LLSDPKR+ IGLLGAKKTP SG++RS+++FV
Sbjct: 168 KKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFV 227

Query: 182 DGKLRFKRVKISPEVSVGDAKKEVMELAEKF 212
           +GKL  KR+K+SPE+SV ++KKEV+E A+K 
Sbjct: 228 EGKLSIKRIKVSPEISVAESKKEVIEFAKKL 258

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  231 bits (588), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 137/176 (77%), Gaps = 1/176 (0%)

Query: 41  VPKLDIEEPVKREDHSSLG-ANELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVY 99
           +PK D +E    ED      + EL +GD+IPD++L N+D   VSL+++AKE+KI++ F Y
Sbjct: 179 LPKKDEKETDVAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAY 238

Query: 100 PKASTPGCTRQACGFRDNYEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREF 159
           PKASTPGCTRQACG+RDNY++LKEHAAVFGLS D+  +QKKFQTKQ LP+ LL DP R  
Sbjct: 239 PKASTPGCTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVL 298

Query: 160 IGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEVMELAEKFEKE 215
           IG LGAKKT  SG++RSH+VF DGKL++KRVK+SPEVS+ D KKEV+ELA   + E
Sbjct: 299 IGHLGAKKTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASLQNE 354

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  227 bits (579), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 123/148 (83%)

Query: 62  ELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121
           EL+VGD++PD  L N++N+ +SLK++ +EN+IVV F YPKA+TPGCTRQACG RDNY DL
Sbjct: 126 ELEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNYNDL 185

Query: 122 KEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFV 181
           K++A VFG+SADSV +QK FQ KQ LPY LLSD  RE IG LG KKTP SG IRSHF+ V
Sbjct: 186 KKYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHFIIV 245

Query: 182 DGKLRFKRVKISPEVSVGDAKKEVMELA 209
           +GKL+FKRVKISPEVSV D KKEV+E++
Sbjct: 246 NGKLKFKRVKISPEVSVSDCKKEVLEIS 273

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  222 bits (566), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 122/235 (51%), Positives = 154/235 (65%), Gaps = 24/235 (10%)

Query: 1   MGEALRRSARIATSKRLLENEG-------SKLVPVSPPEPAKKKIKT-VPKLDIEEPVKR 52
           M   LRRS R+AT K    +E        +K V  +P   A KK+ T  PK  + E  K+
Sbjct: 1   MATELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVTEAPKK 60

Query: 53  E----------------DHSSLGANELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVF 96
           E                + S+    EL+VGD +P+++L N+D   V L ++ K+NKIVV 
Sbjct: 61  EAGAAKKVETPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVL 120

Query: 97  FVYPKASTPGCTRQACGFRDNYEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPK 156
           F YPKASTPGCTRQACGFRDNY++L++HA VFG+SADSV SQK FQ KQKLP+ LLSDPK
Sbjct: 121 FAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPK 180

Query: 157 REFIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEVMELAEK 211
           RE IG LGA+KT  +G IRSH+VFVDGKL  KR+KISPE+S+ D   EV+  A+K
Sbjct: 181 RELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKK 235

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  218 bits (555), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 124/147 (84%)

Query: 66  GDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDLKEHA 125
           GD IPD+ L N+D   +SLK+++ E+KIVV F YPKASTPGCTRQACGFRDNYED+KEHA
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 126 AVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVDGKL 185
           AVFGLSAD+V +QKKFQ KQ LP+ LLSDP+R  +GLLGAKK+P SG IRSH+VF DG L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 186 RFKRVKISPEVSVGDAKKEVMELAEKF 212
           + KRVKISPEVS+ + KKEV+EL ++F
Sbjct: 215 KHKRVKISPEVSIEEGKKEVLELVKQF 241

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  216 bits (550), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 156/227 (68%), Gaps = 24/227 (10%)

Query: 1   MGEALRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKT----------------VPKL 44
           M   LRRS R+AT K    NE  +   +     ++KKIKT                V  L
Sbjct: 1   MATELRRSTRLATRK---ANEKPEFEEI---RFSQKKIKTSSGVSGVKKKSNNGGSVGVL 54

Query: 45  DIEEPVKREDHSSLGANELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKAST 104
             +  +K E     G  EL+VGD++P+++L N+D+  V+LK++AK+NKIV+ F YPKA+T
Sbjct: 55  KADSVLKSEKVG--GPKELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANT 112

Query: 105 PGCTRQACGFRDNYEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLG 164
           PGCTRQACGFRDNYE+L++HA +FG+S+DSV SQK FQ+KQ LP+ LLSDP RE IG+LG
Sbjct: 113 PGCTRQACGFRDNYEELQKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLG 172

Query: 165 AKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEVMELAEK 211
           AKKT  +G IRSH++F +GKL++KRVK+SPE S+ +  +EV+ L +K
Sbjct: 173 AKKTAQAGVIRSHWIFCNGKLKYKRVKVSPETSISEGLEEVLGLIKK 219

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  211 bits (536), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 112/191 (58%), Positives = 135/191 (70%), Gaps = 16/191 (8%)

Query: 22  GSKLVP---VSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGANELKVGDDIPDLSLLNED 78
           GSK  P    +  EP  KK KT    D          SS G  EL+VGD++PD+ L N+D
Sbjct: 15  GSKRAPEDETTQKEPEVKKPKTAKSSD----------SSQG--ELEVGDEVPDVVLKNQD 62

Query: 79  NDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDLKEHAAVFGLSADSVISQ 138
            + VSLK++A+ENK+V+ F YPKASTPGCT QACGFRDNYEDLKE  AVFGLSAD+  +Q
Sbjct: 63  EEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDLKEVGAVFGLSADTPAAQ 122

Query: 139 KKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSV 198
           +KFQ    LP+ LLSDPKRE IGLLGAKK+P SG+ RSH+VF +GKL  KR+ +SPEVS+
Sbjct: 123 RKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKRSHWVFANGKLINKRIAVSPEVSI 181

Query: 199 GDAKKEVMELA 209
            DAK E  E A
Sbjct: 182 RDAKTEAHEAA 192

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  202 bits (513), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 102/213 (47%), Positives = 157/213 (73%), Gaps = 12/213 (5%)

Query: 5   LRRSARIATSKRL----LENEGSKLVPVSPPEPAKKKIKTVPKLDIE-EPVKREDHSSLG 59
           +RRS+RIA  K +    ++ E S  V        KK + +V K++ + +  +++D+    
Sbjct: 4   VRRSSRIANKKIIHQADVKAEHSSKVSKKAKTTVKKTL-SVSKIETDLKETQKDDY---- 58

Query: 60  ANELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYE 119
             E++VGD+IPDL+L N++ + +SL+++A++NKI+  FVYP+ASTPGCTRQACGFRDN++
Sbjct: 59  -EEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFD 117

Query: 120 DLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFV 179
           DLK+++ + GLS DS+ +QK F+TKQ LPY LL D +++ I +LG KK P SG IRS+F+
Sbjct: 118 DLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFI 176

Query: 180 FVDGKLRFKRVKISPEVSVGDAKKEVMELAEKF 212
           FVDGKL+ KRVK+SPEVS+ ++KKE+++L ++ 
Sbjct: 177 FVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  186 bits (472), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 143/209 (68%), Gaps = 25/209 (11%)

Query: 5   LRRSARIATS---KRLLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGAN 61
           LRRS R  +S   KR  E E      V+P  P  KK KT              + S G  
Sbjct: 4   LRRSTRKKSSDAPKRAPEEE-----EVAPNAPETKKAKT--------------NGSKG-- 42

Query: 62  ELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121
           EL+ GD++PD+ L N++ + VSLK + ++NK+VV F YPKASTPGCT+QACGFRDNYE+L
Sbjct: 43  ELEEGDEVPDVVLKNQEGEEVSLKSVVQQNKVVVVFAYPKASTPGCTKQACGFRDNYEEL 102

Query: 122 KEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFV 181
           K++AAVFGLS D+  +Q+KF+ K  LP+ LLSDP+R+ IG LGA K+P SG+ RS++VFV
Sbjct: 103 KKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFV 161

Query: 182 DGKLRFKRVKISPEVSVGDAKKEVMELAE 210
            GKLR KR+ +SPE SV +AKKE +E A+
Sbjct: 162 QGKLRTKRISVSPEASVSEAKKEAIEAAQ 190

>NCAS0A09130 Chr1 complement(1807477..1808598) [1122 bp, 373 aa]
           {ON} Anc_1.329 YJL053W
          Length = 373

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 49/107 (45%), Gaps = 11/107 (10%)

Query: 4   ALRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGANEL 63
            LR+S  I+ +KR        L+P  PP   +K    V    IEEPV+ E  +S G +  
Sbjct: 157 VLRKSTDISKTKRFWVYLYKDLIPQQPPTTVQKAPSKVQS--IEEPVEEEASNSNGTDAS 214

Query: 64  KVGDDI--------PDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKA 102
            V D+         P  S  N ++ PV L +I  EN + + F + KA
Sbjct: 215 DVNDNGESSIAAPPPSNSANNNESHPVKL-DIGIENCLHIEFEFSKA 260

>TDEL0C01590 Chr3 complement(275920..276669) [750 bp, 249 aa] {ON}
           Anc_7.388 YBL064C
          Length = 249

 Score = 32.3 bits (72), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 59/137 (43%), Gaps = 20/137 (14%)

Query: 95  VFFVYPKASTPGCTRQACGFRDNYEDL-KEHAAVFGLSADSVISQKKF-------QTKQK 146
           VFF +P   TP CT +   F     +  K    + GLSA+ V S KK+           K
Sbjct: 68  VFFSHPADFTPVCTTELGAFSKLKPEFDKRGVKLIGLSAEDVESHKKWIKDIEEVNGLNK 127

Query: 147 LPYHLLSDPKREFI---------GLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVS 197
             + +++D  +E           G     K P++ +IRS F+ +D   +  R+  +   S
Sbjct: 128 FEFPIIADVDKEIAFLYDMVDEEGFKQLGKAPVA-TIRSVFI-IDPSKKL-RISFTYPPS 184

Query: 198 VGDAKKEVMELAEKFEK 214
           VG    EV+ + +  +K
Sbjct: 185 VGRNTSEVLRVIDALQK 201

>Suva_16.116 Chr16 complement(195223..197565) [2343 bp, 780 aa] {ON}
           YPL190C (REAL)
          Length = 780

 Score = 30.8 bits (68), Expect = 3.3,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 30  PPEPAKKKIKTVPKLDIEEPVKREDHSSL-----GANELKVGDDIPDLSLLNEDNDPVSL 84
           PP    ++   +P+ D+ +P+  E+H        G N++    +IP  S L   N P  L
Sbjct: 251 PPLSDAQRRMRLPRADLSKPITEEEHDRYTAYLHGENKITEMHNIPPKSRLFIGNLP--L 308

Query: 85  KEIAKENKIVVFFVY 99
           K ++KE+   +F  Y
Sbjct: 309 KNVSKEDLFRIFSPY 323

>ZYRO0B03256g Chr2 (268100..268864) [765 bp, 254 aa] {ON} highly
           similar to gnl|GLV|KLLA0E20383g Kluyveromyces lactis
           KLLA0E20383g and similar to YBL064C uniprot|P34227
           Saccharomyces cerevisiae YBL064C PRX1 Mitochondrial
           peroxiredoxin (1-Cys Prx) with thioredoxin peroxidase
           activity has a role in reduction of hydroperoxides
           induced during respiratory growth and under conditions
           of oxidative stress
          Length = 254

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 73/169 (43%), Gaps = 22/169 (13%)

Query: 63  LKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL- 121
           L++G  +P+    N     ++  +   ++   VFF +P   TP CT +   F     +  
Sbjct: 43  LRIGSTVPNFDA-NTTFGKINFYDYLGDS-WGVFFSHPADFTPVCTTELGAFSKLKPEFD 100

Query: 122 KEHAAVFGLSADSVISQKKF-------QTKQKLPYHLLSDPKRE--FI-------GLLGA 165
           K +  + GLS + V S  ++           K  + +++D  +E  F+       G    
Sbjct: 101 KRNVKLVGLSVEGVPSHNEWIKDIEEISKLNKFGFPVIADENKEVAFLYNMVDEEGFKNL 160

Query: 166 KKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEVMELAEKFEK 214
            K P+S +IRS FV +D   +  R+  +   SVG    EV+ + +  +K
Sbjct: 161 GKGPVS-TIRSVFV-IDPSKKL-RISFTYPPSVGRNSAEVLRVVDALQK 206

>Smik_6.396 Chr6 (636768..639215) [2448 bp, 815 aa] {ON} YPL190C
           (REAL)
          Length = 815

 Score = 30.0 bits (66), Expect = 4.5,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 30  PPEPAKKKIKTVPKLDIEEPVKREDHSSL-----GANELKVGDDIPDLSLLNEDNDPVSL 84
           PP    ++    P+ D+ +P+  E+H        G N++    +IP  S L   N P  L
Sbjct: 296 PPLSDAQRRMRFPRADLSKPITEEEHDRYAAYLHGENKITEMHNIPPKSRLFIGNLP--L 353

Query: 85  KEIAKENKIVVFFVY 99
           K ++KE+   +F  Y
Sbjct: 354 KNVSKEDLFRIFSPY 368

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {ON}
           
          Length = 1107

 Score = 30.0 bits (66), Expect = 4.8,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 169 PLSGSIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEV 205
           P  G+I++ F   DG L FKR   SPE S  +  KEV
Sbjct: 154 PELGTIKAPFAAFDGNLPFKRGPSSPENSSKNDCKEV 190

>YPL190C Chr16 complement(185317..187725) [2409 bp, 802 aa] {ON}
           NAB3RNA-binding protein, subunit of Nrd1 complex
           (Nrd1p-Nab3p-Sen1p); complex interacts with the exosome
           to mediate 3′ end formation of some mRNAs, snRNAs,
           snoRNAs, and CUTs; required for termination of
           non-poly(A) transcripts and efficient splicing
          Length = 802

 Score = 30.0 bits (66), Expect = 5.4,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 30  PPEPAKKKIKTVPKLDIEEPVKREDHSSL-----GANELKVGDDIPDLSLLNEDNDPVSL 84
           PP    ++    P+ D+ +P+  E+H        G N++    +IP  S L   N P  L
Sbjct: 282 PPLSDAQRRMRFPRADLSKPITEEEHDRYAAYLHGENKITEMHNIPPKSRLFIGNLP--L 339

Query: 85  KEIAKENKIVVFFVY 99
           K ++KE+   +F  Y
Sbjct: 340 KNVSKEDLFRIFSPY 354

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.133    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,236,185
Number of extensions: 1044062
Number of successful extensions: 2715
Number of sequences better than 10.0: 52
Number of HSP's gapped: 2707
Number of HSP's successfully gapped: 52
Length of query: 215
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 110
Effective length of database: 41,441,469
Effective search space: 4558561590
Effective search space used: 4558561590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)