Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.1787.194ON31931917150.0
YIL021W (RPB3)7.194ON31831916560.0
Skud_9.1487.194ON31831916430.0
Smik_9.1697.194ON31831916310.0
NCAS0E018307.194ON31832314420.0
KAFR0A026507.194ON31231914290.0
NDAI0G020007.194ON31132013980.0
CAGL0J02420g7.194ON31231913930.0
TDEL0H025307.194ON31132013770.0
TPHA0C045107.194ON31031913730.0
ZYRO0D15796g7.194ON30831913700.0
Kpol_1063.117.194ON31631913510.0
TBLA0J015207.194ON33533813250.0
KNAG0H027007.194ON32632613220.0
SAKL0F07458g7.194ON31532113140.0
Kwal_55.203807.194ON32332812771e-178
KLTH0E04598g7.194ON32832812651e-176
ADL120C7.194ON31132212511e-174
KLLA0D16170g7.194ON30732012491e-174
Ecym_43827.194ON31132212341e-171
Kpol_1018.1393.428ON3352912454e-23
CAGL0B04125g3.428ON3342902384e-22
KAFR0A055203.428ON3343022351e-21
ZYRO0C12364g3.428ON3352912341e-21
ADR031C3.428ON3642912291e-20
KNAG0A076003.428ON3342902262e-20
NDAI0A047703.428ON3352932253e-20
KLLA0D14861g3.428ON3342902244e-20
TPHA0D039203.428ON3352932244e-20
KLTH0F12056g3.428ON3502772228e-20
YPR110C (RPC40)3.428ON3352922228e-20
Kpol_473.33.428ON3202992201e-19
Suva_16.4383.428ON3352922211e-19
Kwal_23.39983.428ON3342902201e-19
SAKL0F06028g3.428ON3342962183e-19
Ecym_44503.428ON3342942183e-19
Smik_16.3533.428ON3352922173e-19
TDEL0F031003.428ON3352922173e-19
NCAS0A115203.428ON3352952104e-18
TBLA0F017003.428ON3332952094e-18
Skud_16.3973.428ON3352882086e-18
YCR067C (SED4)6.333ON1065110676.6
KAFR0A080802.1ON157642686.7
Suva_13.59singletonON114342669.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.178
         (319 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W (...   665   0.0  
YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA pol...   642   0.0  
Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W (...   637   0.0  
Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W (...   632   0.0  
NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.19...   560   0.0  
KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.19...   555   0.0  
NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.19...   543   0.0  
CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {...   541   0.0  
TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.19...   535   0.0  
TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON...   533   0.0  
ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa] ...   532   0.0  
Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa] ...   525   0.0  
TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7....   514   0.0  
KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.19...   513   0.0  
SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {O...   510   0.0  
Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W...   496   e-178
KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar...   491   e-176
ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON} Sy...   486   e-174
KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa] ...   485   e-174
Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to...   479   e-171
Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON} (370...    99   4e-23
CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {...    96   4e-22
KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON} Anc_3...    95   1e-21
ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {...    95   1e-21
ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON} S...    93   1e-20
KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa] ...    92   2e-20
NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON} Anc_3...    91   3e-20
KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]...    91   4e-20
TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {O...    91   4e-20
KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} high...    90   8e-20
YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON} ...    90   8e-20
Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON} com...    89   1e-19
Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {...    90   1e-19
Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C...    89   1e-19
SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {...    89   3e-19
Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar t...    89   3e-19
Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {...    88   3e-19
TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {O...    88   3e-19
NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa] ...    86   4e-18
TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.4...    85   4e-18
Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {...    85   6e-18
YCR067C Chr3 complement(233125..236322) [3198 bp, 1065 aa] {ON} ...    30   6.6  
KAFR0A08080 Chr1 complement(1618083..1622813) [4731 bp, 1576 aa]...    31   6.7  
Suva_13.59 Chr13 complement(88493..90265,90334..90459,90481..920...    30   9.7  

>Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W
           (REAL)
          Length = 319

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/319 (100%), Positives = 319/319 (100%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300
           DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300

Query: 301 ANASQMGNTGSSGGYDNAW 319
           ANASQMGNTGSSGGYDNAW
Sbjct: 301 ANASQMGNTGSSGGYDNAW 319

>YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA
           polymerase II third largest subunit B44, part of central
           core; similar to prokaryotic alpha subunit
          Length = 318

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/319 (95%), Positives = 315/319 (98%), Gaps = 1/319 (0%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREASKDNVDFIL++VDLAMANSLRR+MIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS+DIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHP+IQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGD FDYKA+ADTFYMNVESVGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300
           DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNN ASNMLG+NEDVMMTGAEQDPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300

Query: 301 ANASQMGNTGSSGGYDNAW 319
           +NASQMGNTG SGGYDNAW
Sbjct: 301 SNASQMGNTG-SGGYDNAW 318

>Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/319 (95%), Positives = 313/319 (98%), Gaps = 1/319 (0%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREASKD VDFIL++VDLAMANSLRR+MIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDGVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS+DIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHP+IQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGD FDYKAEADTFYMNVESVGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300
           DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNN A NMLGTNEDV+MTGAEQDPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNAAPNMLGTNEDVVMTGAEQDPY 300

Query: 301 ANASQMGNTGSSGGYDNAW 319
           +NASQMGNTGSS GYDNAW
Sbjct: 301 SNASQMGNTGSS-GYDNAW 318

>Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/319 (94%), Positives = 313/319 (98%), Gaps = 1/319 (0%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREASKDNVDFIL++VDLAMANSLRR+MIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS+DIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHP+IQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYWYEQDSAKEWPQSKNCEYED PNEGD FDYKAEADTFYMNVESVGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDAPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300
           DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNN +SN+LGTNEDVMM GAEQDPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNPSSNILGTNEDVMMAGAEQDPY 300

Query: 301 ANASQMGNTGSSGGYDNAW 319
           +NASQMGN+G SGGYD+AW
Sbjct: 301 SNASQMGNSG-SGGYDSAW 318

>NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.194
           YIL021W
          Length = 318

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/323 (83%), Positives = 292/323 (90%), Gaps = 9/323 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSE GPQVKIREA+KDNVDFIL++VDLA+ANS RR+MIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLLGRNIGHP+IQD+EGNGVLICKLRKGQELK+TC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYWYEQD+ KEWP SKNCEYEDPPNEG+ FDYKA+A+TFYMNVE+VGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASN---MLGTNEDVMMTGA-E 296
           DQVVVRG+DTLQKKVASILLALTQMDQ+KVNFA+  N V+     M G + DV M G  E
Sbjct: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREGMMNGGDNDVNMDGGME 300

Query: 297 QDPYANASQMGNTGSSGGYDNAW 319
           Q+ YAN +  G     G YDNAW
Sbjct: 301 QNSYANVANPG-----GAYDNAW 318

>KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.194
           YIL021W
          Length = 312

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/319 (84%), Positives = 289/319 (90%), Gaps = 7/319 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFIL++VDLAMANSLRR+MIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLLGRNIGHP+IQDKEGNGVLICKLRKGQELKLTC+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHT+YWYEQD  KEWP SKNCEYEDPPNE D FDYKA+ADTFYMNVE+VGSI+V
Sbjct: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300
           DQVVVRG+DTLQKKVASILLAL QMDQ+KVN+ASG     ++M     D+ M GAEQD +
Sbjct: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASG---ATADM--NQGDIAMGGAEQDAF 295

Query: 301 ANASQMGNTGSSGGYDNAW 319
              S M N+ ++G YDNAW
Sbjct: 296 --YSNMPNSNANGIYDNAW 312

>NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/320 (81%), Positives = 288/320 (90%), Gaps = 10/320 (3%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFIL+++DLA+ANS RR+MIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNIDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLLGRNIGHP+IQDKE NGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKENNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYWYEQD  KEWP SKNCEYEDPPNEG+ FDYKA+A+TFYMNVE+VGSI+V
Sbjct: 181 DPWNKLKHTDYWYEQDPQKEWPNSKNCEYEDPPNEGEPFDYKAKAETFYMNVETVGSISV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFAS-GDNNVASNMLGTNEDVMMTGAEQDP 299
           DQVVVRGI+TLQ+KVASILLALTQMDQ+K+ +A+  +    +NM+  N+DV M G   D 
Sbjct: 241 DQVVVRGINTLQQKVASILLALTQMDQEKMQYATVTEGQQGNNMM--NQDVDMDG---DA 295

Query: 300 YANASQMGNTGSSGGYDNAW 319
           YAN    G     G Y++AW
Sbjct: 296 YAN----GANNQPGAYNDAW 311

>CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021w RPB3
          Length = 312

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/319 (81%), Positives = 284/319 (89%), Gaps = 7/319 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA++DNVDFIL++VDLA+ANSLRR+MIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EF+AHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL+I
Sbjct: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHP+IQDKEGNGVLICKLRKGQELKLTC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKL+HTDYWYE+D  KEWPQSKNCEYEDPPN+ + FDYKA+ADTFYMNVE+VGSI V
Sbjct: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300
           DQVV+RGIDTLQKKVASI+LAL QMDQ+KVNFA+GD     N +  + D MM      PY
Sbjct: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGD--AKGNGIEEDGDAMMMNGHDGPY 298

Query: 301 ANASQMGNTGSSGGYDNAW 319
            +     N  SS  Y +AW
Sbjct: 299 GD-----NGRSSDTYGSAW 312

>TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/320 (80%), Positives = 280/320 (87%), Gaps = 10/320 (3%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSE GPQVKIREA+KDNVDFIL+ VDLAMANSLRRIM+AEIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHP+IQDKEGNGVLICKLRKGQEL + CVAKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYWYEQD +KEWP SKN EYEDPPN+ DAFDYKA+A+TFYMNVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAE-QDP 299
           DQVV+RGIDTLQKKVASILLAL QMDQ++VNF + +N  A    G N DV M G + Q+P
Sbjct: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAG-NVDVAMDGVQDQNP 299

Query: 300 YANASQMGNTGSSGGYDNAW 319
           Y+N          G YD AW
Sbjct: 300 YSNG--------GGAYDEAW 311

>TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON}
           Anc_7.194 YIL021W
          Length = 310

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/319 (80%), Positives = 285/319 (89%), Gaps = 9/319 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MS+EGPQVKIREA+KDNVDFI+++VDLAMAN+ RR+MIAEIPTLAIDSVEV +NTTVLAD
Sbjct: 1   MSDEGPQVKIREATKDNVDFIVSNVDLAMANAFRRVMIAEIPTLAIDSVEVISNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGL+PLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLVPLQSADIEQLEYSRDCFCEDHCDKCSVVLTLQALGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VS+LLGRNIGHP+IQDKEGNGVLICKLRKGQELK TC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSDLLGRNIGHPIIQDKEGNGVLICKLRKGQELKFTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHT+YWYEQD+AKEWPQSKNCEYEDPPNEG  FDYKA+ADTFYMNVE++G++T 
Sbjct: 181 DPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSEFDYKAKADTFYMNVETIGTVTS 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300
           DQV+VRGID LQKKVASILLAL ++DQDKVN+A  +N     M G  ED+ M G E DPY
Sbjct: 241 DQVIVRGIDILQKKVASILLALNRLDQDKVNYAGNNNVNNGEMDG--EDITMNGTENDPY 298

Query: 301 ANASQMGNTGSSGGYDNAW 319
           A       +G++  YD AW
Sbjct: 299 A-------SGNNNSYDGAW 310

>ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 308

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/319 (81%), Positives = 282/319 (88%), Gaps = 11/319 (3%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+++NVDFIL+ V+LAMANSLRR+MIAEIPTLAIDSVEVETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATRENVDFILSHVELAMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRN+GHP+IQDKEGNGVLICKLRKGQEL L CVAKKGIAKEHAKWGP+AAIEFEY
Sbjct: 121 VSNLMGRNLGHPIIQDKEGNGVLICKLRKGQELTLKCVAKKGIAKEHAKWGPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHT+YW+EQD AKEWP SKN EYEDPPNEG+ FDY+A A+TFYMNVESVGS++ 
Sbjct: 181 DPWNKLKHTEYWHEQDPAKEWPLSKNSEYEDPPNEGEPFDYRATANTFYMNVESVGSLST 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300
           DQVV+RGIDTLQKKVASILLALTQMDQDKVNFASG    A      + D MM G +  PY
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVNFASGAPMGAVG----DGDTMMNGDDY-PY 295

Query: 301 ANASQMGNTGSSGGYDNAW 319
                 G TG SG YD++W
Sbjct: 296 ------GATGGSGVYDDSW 308

>Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa]
           {ON} (29092..29787,29789..30043) [951 nt, 317 aa]
          Length = 316

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/319 (78%), Positives = 279/319 (87%), Gaps = 3/319 (0%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFIL+ VD+A+ANSLRR+MIAEIPTLAIDSVEV TNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSHVDMALANSLRRVMIAEIPTLAIDSVEVITNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGL+PLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYSKDLDI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHP+IQDKEGNGVLICKLRKGQELKLTC+AKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTD+W+EQD AKEWPQSKNCEYEDPP+EG+ FDYKA+AD F    E+VG+I+ 
Sbjct: 181 DPWNKLKHTDFWFEQDPAKEWPQSKNCEYEDPPHEGEVFDYKAQADAFLYECETVGTISS 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300
           DQVV+RGIDTLQKKVASILLALTQMDQDKV +A G+ N+ +  +  N D+ M G   DPY
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVKYA-GNTNIGAGGMEGNGDINMGGTGNDPY 299

Query: 301 ANASQMGNTGSSGGYDNAW 319
           +N            YD+AW
Sbjct: 300 SNNGGEMGGNGV--YDDAW 316

>TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7.194
           YIL021W
          Length = 335

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/338 (73%), Positives = 277/338 (81%), Gaps = 22/338 (6%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQ+KIREA+KDNVDFIL+++D+A+ANSLRR+MIAEIPTLAIDSVEVE NTTVLAD
Sbjct: 1   MSEEGPQIKIREATKDNVDFILSNIDMALANSLRRVMIAEIPTLAIDSVEVEMNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFI+HRLGLIPLQS DI+QLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLIPLQSADIDQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLLGRNIGHP+IQDKEGNGVLICKLRKGQELK+TCVAKKGIAKEHAKWG  AAIE+EY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKMTCVAKKGIAKEHAKWGATAAIEYEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYWYE D  KEWP SKNC+YEDPP EG+ FDYKA+A+TFYMNVE+VGSIT 
Sbjct: 181 DPWNKLKHTDYWYENDPLKEWPHSKNCQYEDPPTEGELFDYKAKANTFYMNVEAVGSITT 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASG--DNN-----------------VAS 281
           DQV++RGIDTLQKK A ILLAL+QM+Q+KVNF +G  DNN                    
Sbjct: 241 DQVIIRGIDTLQKKTAGILLALSQMEQEKVNFGTGTQDNNDLHQQDDHMGMSNGNDASYG 300

Query: 282 NMLGTNEDVMMTGAEQDPYANASQMGNTGSSGGYDNAW 319
           N +G+N D MM G             N     GY ++W
Sbjct: 301 NYMGSNNDGMMNGGGN---NIQGGYQNNMGPNGYSDSW 335

>KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.194
           YIL021W
          Length = 326

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/326 (77%), Positives = 287/326 (88%), Gaps = 7/326 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA++DNVDFIL++V+LAMANSLRR+M+AEIPTLAIDSV+VETNTTVLAD
Sbjct: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS+DIE+LEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHP+IQDKE NGVLICKLRKGQELK+TC+AKKGIAKEHAKWGP +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHT YWYE D+A+EWP S+NCEYEDPP EG+ FDYK++A+TFYMNVE++GSI+V
Sbjct: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGD-NNVASNML--GTNEDVMMTGAEQ 297
           DQVVVRGIDTLQKKVASILL+LTQM+Q+K NFA G+   +  NM+  G  +     G +Q
Sbjct: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGNDQ 300

Query: 298 DPYA-NASQMGNTGSSGG---YDNAW 319
           D Y  NA   GN GS  G   YD+AW
Sbjct: 301 DMYVPNAGTGGNIGSGSGSGVYDDAW 326

>SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 315

 Score =  510 bits (1314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/321 (75%), Positives = 271/321 (84%), Gaps = 8/321 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA+KD+VDFIL++VD+A+ANS RR+MIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHP+IQDKEGNGVLICKLRKGQELKL C+AKKGI+KEHAKW PA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYWYEQD A EWPQSKNCEYEDPPNE D FDY A+ +TFYM+VE+VGS+T 
Sbjct: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQ--D 298
           DQVV+RGI TLQ KVA IL +L +MDQ++VNF     N        N DV M G  +  D
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGN------ADNVDVAMDGENEMSD 294

Query: 299 PYANASQMGNTGSSGGYDNAW 319
           PY +     N G S G+D+AW
Sbjct: 295 PYTSNQDQYNGGPSAGFDDAW 315

>Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W
           (RPB3) - 45 kDa subunit of RNA polymerase II [contig
           149] FULL
          Length = 323

 Score =  496 bits (1277), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 239/328 (72%), Positives = 269/328 (82%), Gaps = 14/328 (4%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA+KDNVDFIL++VD+AMANSLRR+MIAEIPT+AIDSVEVETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS DI  L Y RDC+CED+CD+CSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLLGRNIGHP+IQDK+ NGVLICKLRKGQELKL CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYW+E D+A EWPQSKNCEYEDPPNE DAFDY+A+  TFYMNVESVGS+TV
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300
           DQVV+RG+ TLQ KVA IL +L +MDQDKVNF       A+ +   +   M    E    
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGG-----AAGLAEQDGGAMAAEPESGFG 295

Query: 301 ANASQ---------MGNTGSSGGYDNAW 319
                           N+G S G+D+AW
Sbjct: 296 YGNGGAGGGPGAGDFHNSGPSSGFDDAW 323

>KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar to
           uniprot|P16370 Saccharomyces cerevisiae YIL021W
          Length = 328

 Score =  491 bits (1265), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 238/328 (72%), Positives = 268/328 (81%), Gaps = 9/328 (2%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA+KDNVDFIL++VD+ MANSLRR+MIAEIPTLAIDSVEVETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFI+HRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHP+IQDK+GNGVLICKLRKGQELKL CVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYW+E D+A EWPQSKNCEYEDPPNE +AFDY A+  TFYMNVE+VGS+TV
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYNAKPTTFYMNVETVGSLTV 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFA---------SGDNNVASNMLGTNEDVM 291
           DQVV+RG+ TLQ KVA IL +L +MDQDKVNF           G   V  +         
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGTAGMVDQDGGAMPVEPDSGFAYGSGG 300

Query: 292 MTGAEQDPYANASQMGNTGSSGGYDNAW 319
            +          +  G+TG S G+D+AW
Sbjct: 301 PSSGSGMGGGPGAPFGHTGPSSGFDDAW 328

>ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL021W
           (RPB3)
          Length = 311

 Score =  486 bits (1251), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/322 (72%), Positives = 262/322 (81%), Gaps = 14/322 (4%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFIL++VDL++ANSLRRIMIAEIPTLAIDSVE+E+NT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL A GESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VS+L G+NIGHP+IQDKE NGVLICKLRKGQEL+L CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKL+HTDYW+EQD   EWP SKNCE+EDPPNE D FDY A+ +TFYMNVESVGSI  
Sbjct: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300
           DQVV+RGI TLQ KVA IL +L +MDQDKV F            G   D      +QDPY
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-----------GPTGDAAPMEVDQDPY 289

Query: 301 ANASQMGNT---GSSGGYDNAW 319
           +  S   N     +   YD+AW
Sbjct: 290 SATSGRFNEYNDNAHAAYDDAW 311

>KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 307

 Score =  485 bits (1249), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/320 (72%), Positives = 269/320 (84%), Gaps = 14/320 (4%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFIL++VDLA+ANSLRR+MI+EIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLALANSLRRVMISEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI+Q+ Y RDC+CEDHCD+CSV L L A GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSADIDQVVYCRDCYCEDHCDRCSVELILHAIGESESTTNVYAKDLQI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
            S+L GRNIGHP+IQD+E NGVLICKLRKGQE+++ C+AKKGI+KEHAKW P+AAIEFEY
Sbjct: 121 TSDLKGRNIGHPIIQDREANGVLICKLRKGQEIRVKCIAKKGISKEHAKWSPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYWYEQD+  EWPQSKNCE+EDPPNE + FDY+A+ +TFY+NVESVGSIT 
Sbjct: 181 DPWNKLKHTDYWYEQDARDEWPQSKNCEFEDPPNEDEDFDYRAKPNTFYINVESVGSITS 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGD-NNVASNMLGTNEDVMMTGAEQDP 299
           +QVVVRGI TLQ KVA IL +L +MDQ+KVNFA+G  +   S  +   ED+       DP
Sbjct: 241 EQVVVRGIKTLQDKVADILFSLKKMDQEKVNFAAGAVSTHVSQQVPMEEDM-------DP 293

Query: 300 YANASQMGNTGSSGGYDNAW 319
           Y      G  G S GYD+AW
Sbjct: 294 YG-----GPVGGS-GYDDAW 307

>Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADL120C
          Length = 311

 Score =  479 bits (1234), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/322 (71%), Positives = 266/322 (82%), Gaps = 14/322 (4%)

Query: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFIL++VDL++ANSLRRIMIAEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFI+HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120

Query: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
           VS+L G+NIGHP+IQDKE NG+L+CKLRKGQEL+L CVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240
           DPWNKLKHTDYW+EQD+  EWP SKNCE+EDP N+ D FDY A+ + FY+NVESVGSIT 
Sbjct: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240

Query: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300
           DQVV+RGI TLQ KVA IL +L +MDQDKV F             T+E+  M   + DPY
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGG----------PTSENAPME-VDHDPY 289

Query: 301 ANASQMGNT---GSSGGYDNAW 319
           +  +   N     ++  YD+AW
Sbjct: 290 SGTNGQYNEYNDNTNTAYDDAW 311

>Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON}
           (370051..371058) [1008 nt, 336 aa]
          Length = 335

 Score = 99.0 bits (245), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 136/291 (46%), Gaps = 51/291 (17%)

Query: 7   QVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           ++ I   +    +F L ++D ++AN+ RRIMI+E+P++A++ V    NT+VL DE +AHR
Sbjct: 41  EINISSINSREANFDLINIDTSIANAFRRIMISEVPSVAVEYVYFLNNTSVLQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------ST 110
           +GL+PL+ +D + L +      E+    D+ ++VL+L                       
Sbjct: 101 IGLVPLK-VDPDMLSWIDSELPEEEKFTDENTIVLSLNVKCTMNPDAPKDCTDPKILYKN 159

Query: 111 TNVYAKDLVIVSNLLGRNI----GHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKE 166
           +NVYA+DL       G+ +     +PV+       +L+CKLR GQE+ L      GI  +
Sbjct: 160 SNVYARDLKFEPQ--GKQVESFANYPVVP--ANPDILLCKLRPGQEISLKAHCILGIGSD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL----------KHTDYW-------------YEQDSAKEWPQ 203
           HAK+ P A   +   P   +          K   Y+             Y +D+ K+   
Sbjct: 216 HAKFSPVATASYRLMPHINITQPITGEDAKKFQKYFMPGVIGINDNGEAYVKDARKDTVS 275

Query: 204 SKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITVDQVVVRGIDTLQKK 254
            +   +  P  EG     +   + F +NVES G++T +++  + +  L+ K
Sbjct: 276 RE--VFRHPEFEGKVKLGRVR-NHFIVNVESTGAMTPEEIFFKSVRILRNK 323

>CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110c RPC40 DNA-directed RNA polymerase I
           III
          Length = 334

 Score = 96.3 bits (238), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 144/290 (49%), Gaps = 51/290 (17%)

Query: 7   QVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           QV   E  + N D I   +D ++AN+ RRIMIAE+P +A + V ++ NT+V+ DE +AHR
Sbjct: 43  QVSSHEERELNFDMI--GIDTSLANAFRRIMIAEVPAVAPEYVYIQNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEY--SRDCFCEDHCDKCSVVLTLQAFGESE--------------ST 110
           +GL+PL+ +D E+LE   + D    +  DK ++V+TL                     + 
Sbjct: 101 IGLVPLK-VDPEKLERLDTSDPDNLEFHDKNTIVMTLNVKCTRNPDAPKDCTDPTILYNN 159

Query: 111 TNVYAKDLVI--VSNLLGRNIGHPVIQ-DKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
            +VYA+DL     S+ +      PV+  D +   +L+ KLR GQE+ L+     G  K+H
Sbjct: 160 AHVYARDLKFEPHSSQVETFADCPVVPCDPD---ILLAKLRPGQEISLSTHCILGEGKDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKE----WPQ-----SKNCE--YEDPPNE- 215
           AK+ P A   +   P  ++         DSAK     +P+     ++N E    DP  + 
Sbjct: 217 AKFSPVATASYRLLPHIEILEP---ITGDSAKRFQACFPKGVIGINENGEAYVLDPRKDT 273

Query: 216 -------GDAFDYKAE----ADTFYMNVESVGSITVDQVVVRGIDTLQKK 254
                   + F+ K +     D F  NVES G++  + +V++ ID L+KK
Sbjct: 274 VSREVLRHEEFEGKVKLGRVRDHFVFNVESTGAMQPEDIVLKSIDILKKK 323

>KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON}
           Anc_3.428 YPR110C
          Length = 334

 Score = 95.1 bits (235), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/302 (27%), Positives = 133/302 (44%), Gaps = 65/302 (21%)

Query: 3   EEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEF 62
            E   VKI   ++   +F L  +D ++AN+ RRIMI+E+P +A++ V    NT+V+ DE 
Sbjct: 37  RESFDVKISSMNEREANFDLVHIDTSVANAFRRIMISEVPAVAVEYVYFLNNTSVIQDEV 96

Query: 63  IAHRLGLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESES----------- 109
           +AHR+GL+PL+ +D + L +      +D    D+ ++VLTL                   
Sbjct: 97  LAHRIGLVPLK-VDPDMLTWIDSSLPDDEKFTDENTIVLTLNVKCTRNPDAPRDCTDPNI 155

Query: 110 ---TTNVYAKDLVIVSNLLGRNIGHPVIQDKEGNGVLIC-------KLRKGQELKLTCVA 159
               +NVYA DL       G+      ++    N V+ C       KLR GQE+ L    
Sbjct: 156 LYRNSNVYASDLKFEPQ--GKQ-----VETFANNAVVPCDPKILLAKLRPGQEISLRAHC 208

Query: 160 KKGIAKEHAKWGPAAAIEFEYDP---------------WNK--------LKHTDYWYEQD 196
             GI  +HAK+ P A   +   P               + K        +K     Y QD
Sbjct: 209 ILGIGSDHAKFSPVATASYRLLPHIEITEPITGESAKRFQKCFPAGVIGIKENGDAYVQD 268

Query: 197 SAKEWPQSKNCEYEDPPNEGDAFDYKAE----ADTFYMNVESVGSITVDQVVVRGIDTLQ 252
           S K+    +   +E+       F+ K +     D F  NVES G++T +++  + +  L+
Sbjct: 269 SRKDTVSREVYRHEE-------FNGKVKLGRIRDHFVFNVESTGAMTPEEIFFKSVRILK 321

Query: 253 KK 254
            K
Sbjct: 322 NK 323

>ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 335

 Score = 94.7 bits (234), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 132/291 (45%), Gaps = 52/291 (17%)

Query: 8   VKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I   ++   +F L  VD ++AN+ RRIMI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRIGSLTEREANFDLVHVDTSIANAFRRIMISEVPSVATEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESES--------------TT 111
           GL+PL+ +D + L +      E+    D+ ++V+TL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDHSLPEEEKFTDENTIVMTLNVKCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLVIVSNLLGRNIGH----PVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           ++YA+DL       G  +      PVI       +L+ KLR GQE+ L      G+  +H
Sbjct: 161 HIYARDLKFEPQ--GSQVETFAKCPVIPTDP--DILLAKLRPGQEISLRAHCILGVGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKH------------------------TDYWYEQDSAKEWPQ 203
           AK+ P A   +   P   ++                         TD  Y QD+ K+   
Sbjct: 217 AKFSPVATASYRLLPHIDIREPIKGELAQKFQKCFPPGVIGINESTDEAYVQDARKDTVS 276

Query: 204 SKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITVDQVVVRGIDTLQKK 254
            +   +E+  N+      +   D F  NVES G++T +++  + +  L+ K
Sbjct: 277 REVLRHEEFSNKVKLGRVR---DHFVFNVESTGAMTPEEIFFKSVRVLKNK 324

>ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR110C
           (RPC40)
          Length = 364

 Score = 92.8 bits (229), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 131/291 (45%), Gaps = 53/291 (18%)

Query: 8   VKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I+   +   +F L  VD ++AN+ RRIMI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 72  VQIKSLDEREANFDLLRVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 131

Query: 68  GLIPLQSLDIEQLEYSRDCF--CEDHCDKCSVVLTLQA--------------FGESESTT 111
           GL+PL+ +D + L +        E   D+ +VVL+L                  E     
Sbjct: 132 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVLSLNVKCTHNPDAPKGSTDPKELYRNA 190

Query: 112 NVYAKDLVIVSNLLGRNIGH----PVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           ++YA+DL       G+ +      PV+       +L+ KLR GQE+ L      GI  +H
Sbjct: 191 HIYARDLKFEPQ--GKQLETFAKCPVV--PADPDILLAKLRPGQEISLRVHCILGIGSDH 246

Query: 168 AKWGPAAAIEFEYDPW-NKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEAD 226
           AK+ P A   +   P+ N ++       +   K +P       E    +G+AF   A  D
Sbjct: 247 AKFSPVATASYRLMPYINIVEPITGPDAEKFVKCFPPGVAAINE----KGEAFVQDARKD 302

Query: 227 T-----------------------FYMNVESVGSITVDQVVVRGIDTLQKK 254
           T                       F  NVES G++T +++  + +  L+ K
Sbjct: 303 TVSREVLRHPELEQKVKLGRVRDHFIFNVESAGAMTPEEIFFKSVRILKNK 353

>KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa]
           {ON} Anc_3.428 YPR110C
          Length = 334

 Score = 91.7 bits (226), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 129/290 (44%), Gaps = 51/290 (17%)

Query: 8   VKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           +KI   S+   +F L  +D ++AN+ RRIMI+E+P++A + V V  NT+V+ DE +AHR+
Sbjct: 42  IKISSMSEREANFDLVHIDTSVANAFRRIMISEVPSVAAEYVYVMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------STT 111
           G+IPL+ +D + L +      E+    D+ +VVLTL                       +
Sbjct: 102 GMIPLK-VDPDMLTWIDQSLSEEEKFTDENTVVLTLNVKCTRNLNAPKDCTDPKILYKNS 160

Query: 112 NVYAKDLVIVSNLLGRNIGH----PVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           +VYA+DL       G+ +      PV+       +L+ KLR  QE+ L      GI  +H
Sbjct: 161 SVYARDLRFEPQ--GKQLETFADCPVVPSDP--DILLAKLRPNQEISLRVHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNKL---------KHTDYWYEQ--------------DSAKEWPQS 204
           AK+ P A   +   P   +         K     + Q              ++ K+    
Sbjct: 217 AKFSPVATASYRLLPHINILEPITGESAKRFQACFPQGVIGIDSEGKAVVENARKDTVSR 276

Query: 205 KNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITVDQVVVRGIDTLQKK 254
           +   YE+     D        D F  NVES G++T +++  + +  L+ K
Sbjct: 277 EVLRYEE---FKDKVKLGRVRDHFIFNVESTGAMTPEEIFFKSVRILKNK 323

>NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 134/293 (45%), Gaps = 52/293 (17%)

Query: 8   VKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I   S+   +F L ++D +MAN+ RRIMI+E+P++A + V   TNT+V+ DE +AHR+
Sbjct: 42  VQITSLSEREANFDLINIDTSMANAFRRIMISEVPSVAAEYVYFLTNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTL-----QAFGESESTTN-------- 112
           G+IPL+ +D + L +      E+    D  +VV++L     +     +  T+        
Sbjct: 102 GMIPLK-VDPDMLSWIDTSLSEEEKFTDDNTVVMSLNIKCTRNLNAPKDCTDPKILYHNS 160

Query: 113 -VYAKDLVIVSNLLGRNIGH----PVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
            VYAKDL       G+ +      PV+       +L+ KLR  QE+ L      G+  +H
Sbjct: 161 SVYAKDLKFEPQ--GKQVETFAKCPVVPSDP--DILLAKLRPDQEISLRVHCILGVGGDH 216

Query: 168 AKWGPAAAIEFEYDPW-NKLK-----------------------HTDYWYEQDSAKEWPQ 203
           AK+ P +   +   P  N LK                        T   Y +D+ K+   
Sbjct: 217 AKFSPVSTASYRLLPHINILKPITGEQAIKFQKCFLPGVIGINEETGEAYVKDARKDTVS 276

Query: 204 SKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITVDQVVVRGIDTLQKKVA 256
            +   +E+     D        D F  NVES G++T +++  + +  L+ K +
Sbjct: 277 REVLRHEE---FNDKVKLGRIRDHFIFNVESTGAMTPEEIFFKSVRILKNKAS 326

>KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]
           {ON} highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 90.9 bits (224), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 132/290 (45%), Gaps = 51/290 (17%)

Query: 8   VKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I    +  V+F L  VD ++AN+ RRIMI+E+P++A + V    NT+VL DE +AHR+
Sbjct: 42  VQIESLDEREVNFDLVHVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVLQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCF--CEDHCDKCSVVLTLQ--------AFGESE------STT 111
           GL+PL+ +D + L +        E   D+ ++V++L         A  + E         
Sbjct: 102 GLVPLK-VDPDMLSWVDTSLPESERFTDENTIVMSLNVKCTRNPDAPKDCEDPKVLYRNA 160

Query: 112 NVYAKDLVIVSNLLGRNIGH----PVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           ++YA+DL       G+ +      PV+       +L+ KLR GQE+ L      GI  +H
Sbjct: 161 HIYARDLKFEPQ--GKQVEQFAKCPVVA--ADPDILLAKLRPGQEISLRAHCILGIGADH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADT 227
           AK+ P +   +   P  ++         D AK++ +       D   +G+A+      DT
Sbjct: 217 AKFSPVSTASYRLLPHIQITQP---ITGDDAKKFVKCFPKGVADVNEKGEAYIKDPRKDT 273

Query: 228 -----------------------FYMNVESVGSITVDQVVVRGIDTLQKK 254
                                  F  NVES G++T +++  + +  L+ K
Sbjct: 274 VSREVLRHDEFQGKVKLGRVRDHFIFNVESSGAMTPEEIFFKSVRILKNK 323

>TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 90.9 bits (224), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 134/293 (45%), Gaps = 47/293 (16%)

Query: 3   EEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEF 62
            E   + I   ++   +F L  +D ++AN+ RRIMIAE+P++A + V    NT+V+ DE 
Sbjct: 37  RESFDIHISSLTEKEANFDLVHIDTSIANAFRRIMIAEVPSVAAEYVYFMNNTSVIQDEV 96

Query: 63  IAHRLGLIPLQSLDIEQLEYSRDCFC--EDHCDKCSVVLTLQAF------GESEST---- 110
           +AHR+GLIPL+ +D ++L +        E   D+ ++V+TL A          ++T    
Sbjct: 97  LAHRIGLIPLR-VDPDKLSWIDSELPDEEKFTDENTIVITLDAKCTRNPDAPKDATDPKV 155

Query: 111 ----TNVYAKDLVIVSNLLGRNIGHPVIQDKEG--NGVLICKLRKGQELKLTCVAKKGIA 164
                +VYA+DL       G+       Q  E     +LI KLR GQE+ L      GI 
Sbjct: 156 LYRNAHVYARDLKFEPQ--GKQAELFADQPVEAIDPDILIAKLRPGQEISLRAHCILGIG 213

Query: 165 KEHAKWGPAAAIEFEYDP---------------WNK--------LKHTDYWYEQDSAKEW 201
            +HAK+ P A   +   P               + K        +   D  + +D+ K+ 
Sbjct: 214 GDHAKFSPVATASYRLLPHINITSPISGESAKRFQKCFPSGVIGINDKDEAFVKDARKDT 273

Query: 202 PQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITVDQVVVRGIDTLQKK 254
              +   +E+  N+      +   D F  NVES G++T +++  + +  L+ K
Sbjct: 274 VSREVLRHEEFQNKVKLGRVR---DHFVFNVESTGAMTPEEIFFKSVRILKNK 323

>KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} highly
           similar to uniprot|P07703 Saccharomyces cerevisiae
           YPR110C RPC40 RNA polymerase subunit common to RNA
           polymerase I and III
          Length = 350

 Score = 90.1 bits (222), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 123/277 (44%), Gaps = 47/277 (16%)

Query: 19  DFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSLDIE 78
           +F L +VD ++AN+ RRIMIAE+P++A + V    NT+V+ DE +AHR+GL PL+ +D +
Sbjct: 69  NFDLVNVDASIANAFRRIMIAEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLTPLK-VDPD 127

Query: 79  QLEYSRDCF--CEDHCDKCSVVLTLQAFGESE--------------STTNVYAKDLVIVS 122
            L +        E   D+ ++VLTL                        ++YA+DL    
Sbjct: 128 MLSWVDTSVPEAERFTDENTIVLTLNVRCTRNPDAPKDCTDPKILYRNAHIYARDLKFEP 187

Query: 123 NLLGRNI--GHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180
               R     +PV+       +L+ KLR GQE+ L      GI  +HAK+ P +   +  
Sbjct: 188 QGKQRETFAKNPVVPADP--DILLAKLRPGQEISLRAHCVLGIGSDHAKFSPVSTASYRL 245

Query: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADT------------- 227
            P   +         +SA+ + +  +       + G+AF   A  DT             
Sbjct: 246 MPHINITQP---ITGESAQRFAKCFSPGVIGINDNGEAFVKDARHDTVSREVLRHEEFEG 302

Query: 228 ----------FYMNVESVGSITVDQVVVRGIDTLQKK 254
                     F  NVES G++T +++  + +  L+ K
Sbjct: 303 KVKLGRVKNHFIFNVESAGAMTPEEIFFKSVRILKNK 339

>YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON}
           RPC40RNA polymerase subunit AC40, common to RNA
           polymerase I and III
          Length = 335

 Score = 90.1 bits (222), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 130/292 (44%), Gaps = 52/292 (17%)

Query: 7   QVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I        +F L ++D ++AN+ RRIMI+E+P++A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQA--------------FGESEST 110
           +GL+PL+ +D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLVIVSNLLGRNIGH----PVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKE 166
            +VYA+DL       GR        PV+       +L+ KLR GQE+ L      GI  +
Sbjct: 160 AHVYARDLKFEPQ--GRQSTTFADCPVVP--ADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL------------------------KHTDYWYEQDSAKEWP 202
           HAK+ P +   +   P   +                        + +D  Y +D+ K+  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTV 275

Query: 203 QSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITVDQVVVRGIDTLQKK 254
             +   YE+     D        + F  NVES G++T +++  + +  L+ K
Sbjct: 276 SREVLRYEE---FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON}
           complement(6708..7670) [963 nt, 321 aa]
          Length = 320

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 136/299 (45%), Gaps = 59/299 (19%)

Query: 3   EEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEF 62
            E  ++ I +  +   +  L +VD ++AN+LRRIMI+E+P++A + + +  NT+V+ DE 
Sbjct: 23  RENLEINISKVGERETNLDLINVDTSIANALRRIMISEVPSVAAEYIYILNNTSVIQDEV 82

Query: 63  IAHRLGLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE------------ 108
           IA R+GLIPL+ +D ++L +  +   ED    D+ ++VL+L                   
Sbjct: 83  IAQRIGLIPLK-VDPDRLTWLNNDLPEDEKFTDENTIVLSLNVKCTRNLDAPKDCTDPSI 141

Query: 109 --STTNVYAKDLVIVSNLLGRN----IGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKG 162
                ++YA+DL       G+        PV+       +LI KLR GQE+ L      G
Sbjct: 142 LYHNAHIYARDLKFEPQ--GKQEETFADSPVVS--ADPDILIAKLRPGQEISLRAHCILG 197

Query: 163 IAKEHAKWGPAAAIEFEYDP----WNKLK-------------------HTDYWYEQDSAK 199
           I  +HAK+ P     +   P      K+K                     D  Y +D+ K
Sbjct: 198 IGADHAKFSPVCTASYRLMPKIIITEKIKGESAKRFQKCFPPGVIDINENDEAYVKDARK 257

Query: 200 EWPQSKNCEYEDPPNEGDAFDYKAEADT----FYMNVESVGSITVDQVVVRGIDTLQKK 254
           +    +   +E+       F  K + D     F  N+E+VG+++ +++ ++ +  L+ K
Sbjct: 258 DTMTREVLRHEE-------FQDKVKLDRVRNHFIFNIETVGAMSAEEIFLKSVKILKNK 309

>Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 89.7 bits (221), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 131/292 (44%), Gaps = 52/292 (17%)

Query: 7   QVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I      + +F L ++D ++AN+ RRIMI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDARDANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAF------GESEST-------- 110
           +GL+PL+ +D + L +      +D    D+ +VVL+L            +ST        
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTVVLSLNVKCTRNLDAPKDSTDPKQLYNN 159

Query: 111 TNVYAKDLVIVSNLLGRN----IGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKE 166
            +VYA+DL       GR        PV+       +L+ KLR GQE+ L      G+  +
Sbjct: 160 AHVYARDLKFEPQ--GRQSTTFANCPVL--PADPDILLAKLRPGQEISLKAHCILGVGGD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL------------------------KHTDYWYEQDSAKEWP 202
           HAK+ P +   +   P   +                        + +D  Y +D+ K+  
Sbjct: 216 HAKFSPVSTASYRLLPQIDILQPIKGESAKRFEKCFPPGVIGIDESSDEAYVKDARKDTV 275

Query: 203 QSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITVDQVVVRGIDTLQKK 254
             +   YE+     D        + F  NVES G++T +++  + +  L+ K
Sbjct: 276 SREVLRYEE---FTDKVKLGRVRNHFVFNVESAGAMTPEEIFFKSVRILKNK 324

>Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C
           (RPC40) - RNA polymerase III (C) subunit [contig 255]
           FULL
          Length = 334

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 130/290 (44%), Gaps = 51/290 (17%)

Query: 8   VKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I    +   +F L +VD ++AN+ RRIMI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRISSLDEREANFDLVNVDASIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCF--CEDHCDKCSVVLTLQAFGESES--------------TT 111
           GL PL+ +D + L +        E   D+ ++VLTL                        
Sbjct: 102 GLTPLK-VDPDMLSWVDSSVPEAERFTDENTIVLTLNVKCTRNPDAPKDCTDPKILYRNA 160

Query: 112 NVYAKDLVIVSNLLGRNI----GHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           ++YA+DL       G+ +     +PV+       VL+ KLR GQE+ L      GI  +H
Sbjct: 161 HIYARDLKFEPQ--GKQLETFAKNPVV--PADPDVLLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADT 227
           AK+ P     +   P   +         +SA+++ +  +       +EG+A+   A  DT
Sbjct: 217 AKFSPVCTASYRLMPHINITSP---ITGESAQKFAKCFSPGVIGINDEGEAYVKDARHDT 273

Query: 228 -----------------------FYMNVESVGSITVDQVVVRGIDTLQKK 254
                                  F  NVES G++T +++  + +  L+ K
Sbjct: 274 VSREVLRHEEFEGKVKLGRIRDHFIFNVESAGAMTPEEIFFKSVRILKNK 323

>SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 129/296 (43%), Gaps = 63/296 (21%)

Query: 8   VKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           VKI    +   +F L  +D ++AN+ RRIMI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VKISSLDEREANFDLIHIDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESES--------------TT 111
           GL+PL+ +D + L +  +   E+    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLSWIDNSLTEEEKFTDENTIVLTLNVKCTRNPDAPKDCTDPKVLYRNS 160

Query: 112 NVYAKDLVIVSNLLGRNI----GHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           N+YA+ L       G+ +      PV+       +L+ KLR GQE+ L      GI  +H
Sbjct: 161 NIYARHLKFEPQ--GKQLETFAKSPVV--PADPDILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPN------EGDAFDY 221
           AK+ P     +   P   +         +SA      KN     PP       +G+A+  
Sbjct: 217 AKFSPVCTASYRLMPQINITEP---ITGESA------KNLVRCFPPGVIGINEQGEAYVE 267

Query: 222 KAEADT-----------------------FYMNVESVGSITVDQVVVRGIDTLQKK 254
            A  DT                       F  NVES G++T +++  + +  L+ K
Sbjct: 268 DARKDTVSREVLRHEEFEGKVKLGRVRDHFVFNVESAGAMTPEEIFFKSVRILKNK 323

>Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar to
           Ashbya gossypii ADR031C
          Length = 334

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 128/294 (43%), Gaps = 59/294 (20%)

Query: 8   VKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I        +F L  +D ++AN+ RRIMI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VQISHLDDREANFDLIHIDASIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCF--CEDHCDKCSVVLTLQA--------------FGESESTT 111
           GL+PL+ +D + L +        E   D+ +VV++L                  E  +  
Sbjct: 102 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVMSLNVKCTANPDAPKGSTDPKELYNNA 160

Query: 112 NVYAKDLVI--VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAK 169
           ++Y++DL        L     HPV+       +L+ KLR GQE+ L      G+  +HAK
Sbjct: 161 HIYSRDLKFEPQGKQLDSFAKHPVLPTDP--DILLAKLRPGQEISLRVHCILGVGGDHAK 218

Query: 170 WGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPN------EGDAFDYKA 223
           + P     +   P     H D   E    ++  +   C    PP       +G+A+   A
Sbjct: 219 FSPVCTASYRLMP-----HIDIL-ETIQGEDATKFVKCF---PPGVAAIDEKGEAYIKDA 269

Query: 224 EADT-----------------------FYMNVESVGSITVDQVVVRGIDTLQKK 254
             DT                       F  NVES G++T +++  + +  L+ K
Sbjct: 270 RKDTVSREVLRHPEFEGKVKLGRVKDHFIFNVESTGAMTPEEIFFKSVRILKNK 323

>Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 88.2 bits (217), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 130/292 (44%), Gaps = 52/292 (17%)

Query: 7   QVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I        +F L ++D ++AN+ RRIMI+E+P++A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQA--------------FGESEST 110
           +GL+PL+ +D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLVIVSNLLGRN----IGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKE 166
            +VYA+DL       G+        PV+       +L+ KLR GQE+ L      GI  +
Sbjct: 160 AHVYARDLKFEPQ--GKQSTTFADFPVV--PADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL------------------------KHTDYWYEQDSAKEWP 202
           HAK+ P +   +   P   +                        + +D  Y +D+ K+  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDESSDEVYVKDARKDTV 275

Query: 203 QSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITVDQVVVRGIDTLQKK 254
             +   Y++     D        + F  NVES G++T +++  + +  L+ K
Sbjct: 276 SREVLRYDE---FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 88.2 bits (217), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 128/292 (43%), Gaps = 54/292 (18%)

Query: 8   VKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I   ++   +F L  +D ++AN+ RRIMI+E+P+LA + V    NT+V+ DE +AHR+
Sbjct: 42  VQIESLTEREANFDLIHIDTSIANAFRRIMISEVPSLAPEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESES--------------TT 111
           GL+PL+ +D + L +      E+    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDSTLPEEERFTDENTIVLTLNVTCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLVI-----VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKE 166
           +VYA DL        + L  +    P   D     +L+ KLR GQE+ L      G+  +
Sbjct: 161 SVYAHDLKFEPQGRQAELFAKCPVVPADPD-----ILLAKLRPGQEISLRAHCILGVGGD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL------------------------KHTDYWYEQDSAKEWP 202
           HAK+ P A   +   P   +                        + T     +D+ ++  
Sbjct: 216 HAKFSPVATASYRLLPHINITKPITGESAKKFQKCFSPGVIDIDESTGEAVVKDARRDTV 275

Query: 203 QSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITVDQVVVRGIDTLQKK 254
             +   +E+     D+       D F  NVES G++T +++  + +  L+ K
Sbjct: 276 SREVLRHEE---FADSVKLGRVRDHFIFNVESTGAMTPEEIFFKSVRILKNK 324

>NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa]
           {ON} Anc_3.428 YPR110C
          Length = 335

 Score = 85.5 bits (210), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 133/295 (45%), Gaps = 58/295 (19%)

Query: 7   QVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V+I   ++   +F L ++D ++AN+ RRIMI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVEISSLNEREANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFLNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEYSRDCFC--EDHCDKCSVVLTLQAF------GESEST-------- 110
           +GLIPL+ +D + L +  +     E   D  ++VLTL            ++T        
Sbjct: 101 IGLIPLK-VDPDLLTWVDNELPDEEKFNDTNTIVLTLNVKCTRNPDAPKDATDPKILYRN 159

Query: 111 TNVYAKDLVIVSNLLGRNI----GHPVI---QDKEGNGVLICKLRKGQELKLTCVAKKGI 163
           ++VYA DL       G+ I    G PV+   QD     +L+ KLR GQE+ L      G 
Sbjct: 160 SSVYASDLKFEPQ--GKQIETFAGTPVVPCDQD-----ILLAKLRPGQEISLRAHCILGT 212

Query: 164 AKEHAKWGPAAAIEFEYDPWNKLKH------------------------TDYWYEQDSAK 199
             +HAK+ P +   +   P   +                          +   + +D+ K
Sbjct: 213 GGDHAKFSPVSTASYRLLPHINITKPIKGELAEKFQKCFLPGVIGIDNASGEAFVKDARK 272

Query: 200 EWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITVDQVVVRGIDTLQKK 254
           +    +   +E+     D        D F  NVES G++T +++  + +  L+ K
Sbjct: 273 DTVSREVLRHEE---FNDKVKLGRIRDHFIFNVESTGAMTPEEIFFKSVRILKNK 324

>TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.428
           YPR110C
          Length = 333

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 129/295 (43%), Gaps = 62/295 (21%)

Query: 8   VKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           +KI    + +  F L ++D ++AN+ RRIM+AE+P +A + V    NT+V+ DE +AHR+
Sbjct: 42  IKISNLDERDATFDLINIDTSIANAFRRIMMAEVPAVAAEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------STT 111
           GL+PL+ +D + L +      E+    D+ ++VL+L                     +  
Sbjct: 102 GLVPLK-VDPDMLTWVDQTLPEEERFTDENTIVLSLNVKCTKNDKAPKDCTDPKILYNNA 160

Query: 112 NVYAKDLVIVSNLLGRNI----GHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEH 167
           +VYA+DL       G+ +      PV+       +L+ KLR GQE+ L      GI  +H
Sbjct: 161 HVYARDLKFEPQ--GKQVETFANCPVVPTDP--DILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPP-----NEGDAFDYK 222
           AK+ P A   +   P   +       E    K+  + + C     P      +G+A+   
Sbjct: 217 AKFSPVATASYRLLPHINIT------EPIRGKDAEKFQKCFT---PGVIGIKDGEAYVKD 267

Query: 223 AEADT-----------------------FYMNVESVGSITVDQVVVRGIDTLQKK 254
           A  DT                       F  NVES G++  +++  + +  L+ K
Sbjct: 268 ARMDTVSREVFRHQEFADKVKLGRVRDHFVFNVESTGAMPPEEIFFKSVRILKNK 322

>Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 84.7 bits (208), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 125/288 (43%), Gaps = 44/288 (15%)

Query: 7   QVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I    +   +F L ++D ++AN+ RRIMI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVNISSLDEREANFDLINIDASIANAFRRIMISEVPCVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQA--------------FGESEST 110
           +GL+PL+ +D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTIVLSLNVKCTRNPDAPKDCTDPKELYNN 159

Query: 111 TNVYAKDLVIVSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKW 170
            +VYA+DL                       +L+ KLR GQE+ L      GI  +HAK+
Sbjct: 160 AHVYARDLKFEPQGRQSTTFAACSVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKF 219

Query: 171 GPAAAIEFEYDPW-NKLKH-----------------------TDYWYEQDSAKEWPQSKN 206
            P +   +   P  N L+                        +   Y +D+ K+    + 
Sbjct: 220 SPVSTASYRLLPQINILQSIKGESAKRFQKCFPPGVIGIDDTSREAYVKDARKDTVSREV 279

Query: 207 CEYEDPPNEGDAFDYKAEADTFYMNVESVGSITVDQVVVRGIDTLQKK 254
             YE+     D        + F  NVES G++T +++  + +  L+ K
Sbjct: 280 LRYEE---FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>YCR067C Chr3 complement(233125..236322) [3198 bp, 1065 aa] {ON}
           SED4Integral endoplasmic reticulum membrane protein that
           stimulates Sar1p GTPase activity; involved in COPII
           vesicle budding through disassociation of coat proteins
           from membranes onto liposomes; binds Sec16p; similar to
           Sec12p
          Length = 1065

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 53/110 (48%), Gaps = 7/110 (6%)

Query: 207 CEYEDPPNEGDAFDYKAEADTFYMNVESVGSITVDQVVVRGIDTLQKKVASILLALTQMD 266
            EY + P    A D  AEA+ +     S+     D +V   +  +   +AS L  + +  
Sbjct: 648 IEYRNIP----ASDSNAEAEQYVTTSSSMLLTPTDTMVSSPVSEIDP-IASELERMVETP 702

Query: 267 QDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY-ANASQMGNTGSSGGY 315
              ++ AS  ++VASN++  NE+++ T A QD   ++ S   ++  + G+
Sbjct: 703 THSISIASEFDSVASNLIP-NEEILSTSASQDSISSHPSTFSDSSITSGF 751

>KAFR0A08080 Chr1 complement(1618083..1622813) [4731 bp, 1576 aa]
           {ON} Anc_2.1 YNL242W
          Length = 1576

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 262 LTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPYANA 303
           + Q   DK+ F S +NN+ S ++   E    TG EQ  Y +A
Sbjct: 186 ILQQKLDKIRFTSKENNIRSILIEGVEISHFTGKEQQKYGDA 227

>Suva_13.59 Chr13 complement(88493..90265,90334..90459,90481..92013)
           [3432 bp, 1143 aa] {ON} YML091C (REAL)
          Length = 1143

 Score = 30.0 bits (66), Expect = 9.7,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 116 KDLV--IVSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKL 155
           K+LV  I+S + GR + H VI + + N V +  LR G  +KL
Sbjct: 804 KNLVNLIISKIPGRELTHLVINNSKFNEVFVPNLRNGSMIKL 845

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,695,587
Number of extensions: 1441779
Number of successful extensions: 2906
Number of sequences better than 10.0: 50
Number of HSP's gapped: 2949
Number of HSP's successfully gapped: 51
Length of query: 319
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 209
Effective length of database: 40,868,139
Effective search space: 8541441051
Effective search space used: 8541441051
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)