Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.1092.293ON49149124040.0
Smik_9.892.293ON49149123220.0
Skud_9.832.293ON49149123140.0
YIL090W (ICE2)2.293ON49149123100.0
NCAS0B062202.293ON48648716250.0
NDAI0B035202.293ON50149515920.0
TDEL0G022302.293ON48848815750.0
CAGL0D04202g2.293ON49950315460.0
ZYRO0A02024g2.293ON48648015260.0
KAFR0J013302.293ON49149214940.0
KNAG0A053902.293ON49749214890.0
SAKL0E07524g2.293ON47949113930.0
KLTH0G10516g2.293ON47448613290.0
Kpol_1003.422.293ON49048913251e-180
Kwal_27.115002.293ON47548813161e-179
Ecym_33322.293ON51351611611e-154
ADL208W2.293ON50250611361e-151
KLLA0E08207g2.293ON48649311221e-149
TPHA0C034402.293ON57954010931e-143
TBLA0B069902.293ON53653010731e-141
TBLA0B059802.293ON49350110551e-139
Skud_16.4443.493ON17357676.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.109
         (491 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   930   0.0  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   899   0.0  
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   895   0.0  
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   894   0.0  
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   630   0.0  
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   617   0.0  
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   611   0.0  
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   600   0.0  
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   592   0.0  
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   580   0.0  
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   578   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   541   0.0  
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   516   0.0  
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   514   e-180
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   511   e-179
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   451   e-154
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   442   e-151
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   436   e-149
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   425   e-143
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            417   e-141
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   410   e-139
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...    30   6.9  

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/491 (93%), Positives = 460/491 (93%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLS               NVL
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARRNGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKN 120
           ARRNGGRLYIFLTSCLYYSQHFVIA           NDELGNVLKNRSNESESFLEALKN
Sbjct: 61  ARRNGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSNESESFLEALKN 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
           SLNSNQINYVL     RFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
           QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH
Sbjct: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI 360
           NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI
Sbjct: 301 NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI 360

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420
           NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTIL
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 481 VYATELVGSGS 491
           VYATELVGSGS
Sbjct: 481 VYATELVGSGS 491

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/491 (89%), Positives = 451/491 (91%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLS               NVL
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARRNGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKN 120
           ARR GG+LYIFLTSCLYYSQHF+IA           NDELGNVLK R NESESFLEALKN
Sbjct: 61  ARRYGGKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPNESESFLEALKN 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
           SLNSNQINYVL     RFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL
Sbjct: 121 SLNSNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
           Q+GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI 360
           NVILKNAE+LWGSFIPR RK T D H+K+IS+LSFEKVSLISKPFW+F KNFTFSVPLSI
Sbjct: 301 NVILKNAEMLWGSFIPRGRKKTGDFHDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSI 360

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420
           NEFCQVTIKMASESVSPAIV+NLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG DQPEIIVDSWGFWNWCNIFCTIL
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGSDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 481 VYATELVGSGS 491
           VYATEL+GSGS
Sbjct: 481 VYATELIGSGS 491

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/491 (89%), Positives = 454/491 (92%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MTSLSKSFMQSGR+CAACFYLLFTLLSIPISFKVGGLECGLS               NVL
Sbjct: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARRNGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKN 120
           A+R+GG+LYIFLT+CLYYSQHFVIA           NDELGNVLKNRSNESESFL+ALK+
Sbjct: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
           SLNSNQINYVL     RFVVQPWQF+LTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
           Q+GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI 360
           NV+LKNAE+LWGSFIPR RK T D H+KIISILSFEKVSLIS+PFW+F KNFTFSVPLSI
Sbjct: 301 NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI 360

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420
           NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIM+GLYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW 420

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG +QPEIIVDSWGFWNWCNIFCTIL
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTIL 480

Query: 481 VYATELVGSGS 491
           VYATEL+GSGS
Sbjct: 481 VYATELIGSGS 491

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/491 (89%), Positives = 450/491 (91%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLS               NVL
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARRNGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKN 120
           ARR+GGRLYIF T+CLYYSQHF+IA           NDELGNVLKN+ NESESFLEALKN
Sbjct: 61  ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKN 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
           SLNSNQINYVL     RFVVQPWQF+LTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSNTWIISSLL SGGVITASLYYLYRIYVTPIWPLSIQTASLLG VLSMVCGLGLYGIVS
Sbjct: 181 NSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVS 240

Query: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
           Q+GSVIESSLFFAYIVRCIYEISPKLATTATDEIL+LFKDVWQKHQRNLPTADNLLCYFH
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI 360
           NVILKNAEVLWGSFIPR RK T D H+K+ISILSFEKVSLISKPFW+F KNFTFSVPLSI
Sbjct: 301 NVILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSI 360

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420
           NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG DQPEIIVDSWGFWNWCNIFCTIL
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 481 VYATELVGSGS 491
           VYATEL+GSGS
Sbjct: 481 VYATELIGSGS 491

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/487 (63%), Positives = 377/487 (77%), Gaps = 9/487 (1%)

Query: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARR 63
           +S SF++  RIC+A FYLLFTL+SIPISFK+GGL CGL+               ++ AR+
Sbjct: 2   ISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARK 61

Query: 64  NGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALK-NSL 122
            G R++I LT+ LYY QHF+IA           N++L ++L++ +   +S  +  K N  
Sbjct: 62  YGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVA 121

Query: 123 NSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182
           +S Q N+VL     RF VQPWQFIL+ STPFFTLSEGFFTILAIQA+GETN+WL  ++NS
Sbjct: 122 SSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINS 181

Query: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQR 242
           NTW+ISSLLASGGVITASLYYLYRIYVTPIW LS+QTASLLGF LS+V GLG+YGIV+ +
Sbjct: 182 NTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDK 241

Query: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302
           GSVIESS+FFAYIVRCIYEISPKLATTAT+EIL++FK+VWQ+HQ NL + +NLL Y+HNV
Sbjct: 242 GSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNV 301

Query: 303 ILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINE 362
           +LKN E +W SF        +D     I+  S E+V  I  P W+  K FT +VP SINE
Sbjct: 302 VLKNIETIWESF------KIND--NSFITSFSTERVITIFMPIWKLLKTFTITVPSSINE 353

Query: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422
            C VT KMA ES+SPA+++NLCFRVL+FYSATRIIPALQR++D +LRKSRRIMK LYWYS
Sbjct: 354 LCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYS 413

Query: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTILVY 482
           PCILIAMY HLILQYSGELK +LC+WGC+ K F  DQP+IIVDSWGFWNWCNIF TILVY
Sbjct: 414 PCILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVY 473

Query: 483 ATELVGS 489
           A+EL+G+
Sbjct: 474 ASELIGT 480

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/495 (61%), Positives = 376/495 (75%), Gaps = 7/495 (1%)

Query: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARR 63
           +S SFM+  R  +A FYLLFTL+SIPISFK+GGL+CGL+               ++LAR+
Sbjct: 2   ISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARK 61

Query: 64  NGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKNSLN 123
            G    IFLT  LYYSQH +IA           +++L   L + + + +   + ++ +L+
Sbjct: 62  YGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLS 121

Query: 124 SNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183
           S   N+ L      F VQPW+++L+ STPFFTLSEGFFTILAIQAVGETN+WL N++NSN
Sbjct: 122 STNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSN 181

Query: 184 TWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQRG 243
           TWIISSLL SGGVITASLYYLYRIYVTPIW LSIQTASLLGF LS+V GLGLYGIV+++G
Sbjct: 182 TWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKG 241

Query: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVI 303
           SVIESSLFFAYIVRCIYEISPKLATTATDEIL++FK+VWQ+HQ NLPT DNLL Y++N +
Sbjct: 242 SVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFV 301

Query: 304 LKNAEVLWGSFI-------PRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSV 356
           L++ ++LW   +       P     +S     + + LS + +  I KP W+  KNFT SV
Sbjct: 302 LRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSV 361

Query: 357 PLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMK 416
           P SI+E   VT +MA ESVSPA+VINLCFRVL+FYSATRIIPALQR+ND +L+KSRRIMK
Sbjct: 362 PSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMK 421

Query: 417 GLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIF 476
            LYWYSPC+LIAMYTHLILQYSGELKKDLC+WGC+ KW  P+QPE+IVDSWGFWNWCNIF
Sbjct: 422 ILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNIF 481

Query: 477 CTILVYATELVGSGS 491
            TI++YA+EL G+ +
Sbjct: 482 FTIIIYASELFGTTA 496

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/488 (61%), Positives = 370/488 (75%), Gaps = 3/488 (0%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MT++SKSF+Q  R+  A FYLL TL++IPISFKVGGL CGLS               +++
Sbjct: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60

Query: 61  ARRNGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKN 120
           A+  G + YI  T+ +YY QHF+IA           N+EL  VL++ S   +S +  L+N
Sbjct: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
           ++ SN  +++L     R+VVQPWQ +LT ST FF LSEGFFT+L IQA+GETNRWL +++
Sbjct: 121 NVFSNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSNTWII+SLL SGGVITASLYYLYRIYVTPIW LS+QTASLLGF LS+VCG+GL+GIVS
Sbjct: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240

Query: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
           + GSVIESSLFFAYIVRCIYEISPKLATTATDEIL++ K  WQKHQ+NL T +NLL Y+ 
Sbjct: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300

Query: 301 NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI 360
           +V+LKNAE++W S + R + + +       +I    K+     P W+F K F  SVP SI
Sbjct: 301 DVVLKNAEMVWESIVLRTKNSDAT---TFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSI 357

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420
               QVT+K+ASESVSPAIV+NLCFRVL+FYSATRIIPALQRKN ++LRKSRRIM  LYW
Sbjct: 358 GGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYW 417

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGEL  DLC+WGCSEKWFG  QP+I +++W FWNWCNIF T+L
Sbjct: 418 YSPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVL 477

Query: 481 VYATELVG 488
           +Y +EL+G
Sbjct: 478 IYGSELIG 485

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/503 (61%), Positives = 370/503 (73%), Gaps = 21/503 (4%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           M  +++   +S RI +A  YL+ TL+SIPISFK+GGL+CGLS               +VL
Sbjct: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60

Query: 61  ARRNGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESE-----SFL 115
           ARR+  R Y+F TS LYYSQH VIA           N+E    L    +  E     SFL
Sbjct: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120

Query: 116 EALKNSL-----NSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVG 170
           + LK+ +       N  N+ L     +F+VQPWQ++L+ STPFFTL EGFFTILAIQA+G
Sbjct: 121 DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG 180

Query: 171 ETNRWLSNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMV 230
           ETN+WLS ++NSNTWII+SLL SGGVIT SLYYLYRIYVTPIW L+IQ+ASLLGFVLS+V
Sbjct: 181 ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV 240

Query: 231 CGLGLYGIVSQRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLP 290
             LGLYGI+S++GSVIESSLFFAYIVRCIYEISPKLAT AT+EILDL KDVWQ HQRNL 
Sbjct: 241 FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL 300

Query: 291 TADNLLCYFHNVILKNAEVLWGSFI-PRRRKTTSDLHEKIISILSFEKVSLISKPFWRFC 349
             DNLL Y+HNV+LKNAE++W SFI PR R   +   EKI       +  L   P W+F 
Sbjct: 301 NRDNLLAYYHNVVLKNAEMVWESFILPRSRSLNA--MEKI-------RFWLDVTPVWKFF 351

Query: 350 KNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLR 409
           KNFT SVP SI E   VT KMASES+SPA+++NLCFR+L+FYSATRIIPALQR + K+ R
Sbjct: 352 KNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQR 411

Query: 410 KSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG-PDQPEIIVDSWG 468
           +SRRI+K LYWYSPC+LIAMYTHLILQYSGELK++LC+WGC+  WFG  DQP I+ DSW 
Sbjct: 412 QSRRILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWS 471

Query: 469 FWNWCNIFCTILVYATELVGSGS 491
           FWNWCNIF T+LVYA EL+G+ +
Sbjct: 472 FWNWCNIFWTVLVYANELIGTQA 494

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/480 (62%), Positives = 358/480 (74%), Gaps = 1/480 (0%)

Query: 9   MQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARRNGGRL 68
           +QS R+  ACFYLL  L++IPISFKVGGL CGLS               ++  R    R 
Sbjct: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64

Query: 69  YIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKNSLNSNQIN 128
           Y+F T+ +YYSQH +IA           N+EL  +L++ S   +S LE LK++  S   N
Sbjct: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHSN 124

Query: 129 YVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTWIIS 188
           ++L      ++VQPWQ+IL+ ST FF+LSEGFFTILAIQAVGE++RWL  ++NSN W I+
Sbjct: 125 WILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184

Query: 189 SLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQRGSVIES 248
           SLL SGGVITA+LYYLYRIYVTP+W LSIQTASLLGF LS+VCGLGLYGIVS+ GSVIES
Sbjct: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244

Query: 249 SLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVILKNAE 308
           SLFFAYIVRCIYEISPKLATTATDEIL++FK+ WQKHQRN  + +NLL Y+H+V+L +AE
Sbjct: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304

Query: 309 VLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINEFCQVTI 368
           ++W S I  +  TTSD            K + I KP   F KNFT SVP SI    QVT+
Sbjct: 305 MMWES-IVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQVTL 363

Query: 369 KMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSPCILIA 428
           KMAS+SVSPAIV+NL FRVL+FYSAT+IIPALQ K D+QL KSRRIM  LYWYSPCILIA
Sbjct: 364 KMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIA 423

Query: 429 MYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTILVYATELVG 488
           MYTHLILQYSGEL +DLC+WGC+  WF  +Q +I+VDSWGFWNWCNIF TILVY +EL+G
Sbjct: 424 MYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSELIG 483

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/492 (59%), Positives = 366/492 (74%), Gaps = 8/492 (1%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MT LSKS ++  RI +  FYLLFTL+SIP+SFK+GG+ CGLS               ++L
Sbjct: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60

Query: 61  ARRNGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKN 120
           AR++G R YI LTS +YY QH +IA           NDEL  VLK+ + + E  +     
Sbjct: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVA--NQ 118

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
            L  ++ N++L      +VV+PW+F+L+ STPFF L+EGFFTILAIQA+GETNRWLS++ 
Sbjct: 119 DLMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEK 178

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSN+WIISSLLAS GV+TASLYYLYRIYVTPIW LS QTA+LLG VLS+  GLG++GI+S
Sbjct: 179 NSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIIS 238

Query: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
           +RGSV+ESSLFFAYIVRCIYEISPKLATTATDEIL+LFK+VWQ+HQ  LP  DN+L Y+ 
Sbjct: 239 ERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYR 298

Query: 301 NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI 360
           +VILKN E++W +F+ + ++ +   +  + S  + E   +   P W+F KNFT SVP SI
Sbjct: 299 SVILKNTEMIWEAFLSKTKQHS---NHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSI 355

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420
           +E   + ++MASES+SPA+V+NLCFRVL+FYSATRIIP+LQRK  +  RKSRRIMK LYW
Sbjct: 356 SELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYW 415

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKW-FGPDQPE--IIVDSWGFWNWCNIFC 477
           YSPCILIAMYTHLILQYSGELK++L +WG   K  F  D+ E  I+VDSW FWNWCNIF 
Sbjct: 416 YSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFW 475

Query: 478 TILVYATELVGS 489
           TIL+Y  EL G+
Sbjct: 476 TILIYGGELFGT 487

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/492 (58%), Positives = 362/492 (73%), Gaps = 6/492 (1%)

Query: 3   SLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLAR 62
           +L+  F++  RIC+   YLL TL+SIPISFKVGGL CGL+               +++AR
Sbjct: 4   TLTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIAR 63

Query: 63  RNGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKNSL 122
           +NG R+YI L+S LYY QHF+IA           N EL  +++N +   ES    L  S+
Sbjct: 64  KNGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSM 123

Query: 123 NSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182
           +S++ N++      ++VV PW+F+L+ STPFFTLSEGFFTILAIQA+GETN+WL  + NS
Sbjct: 124 SSSEANWIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNS 183

Query: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQR 242
           N WIISSLL S  VI+A+LYYLYRIYVTPIW L++QTASLLGFVLS+V GLG+YGIVS  
Sbjct: 184 NAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDS 243

Query: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302
           GSVIESSLFFAYIVRCIYEISPKLATTATDE+L+LFKDVWQK Q NLP  +NL+ Y++NV
Sbjct: 244 GSVIESSLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNV 303

Query: 303 ILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINE 362
           ILKN E+ W +FI   R  TS       S+L         KP W+F KNFT SVP SI E
Sbjct: 304 ILKNIEMAWDNFI--LRTGTSGTFNYNPSLL-LNNTWKFCKPIWKFFKNFTLSVPFSIRE 360

Query: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422
              +T KM+ ESVSPA+VINLCFR+L+FYSATRI+P+LQRK+ ++ R+SR++M+ +YWYS
Sbjct: 361 ILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYS 420

Query: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG--PDQPE-IIVDSWGFWNWCNIFCTI 479
           PCILIAMY HLILQYS ELK +LC+WGC+    G   DQ E ++VD+W FWNWCN+FCTI
Sbjct: 421 PCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTI 480

Query: 480 LVYATELVGSGS 491
           LVYA EL+G  +
Sbjct: 481 LVYANELIGDTT 492

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/491 (55%), Positives = 343/491 (69%), Gaps = 17/491 (3%)

Query: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARR 63
           L +S +QS R C   FYLL  L++IPISF+VGGL CGLS                +++++
Sbjct: 2   LPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSKK 61

Query: 64  NGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSN-ESESFLEALKNSL 122
              RLY  +TS +YY QHF+I            NDEL   +    N   ES +  L+N  
Sbjct: 62  YN-RLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRN-- 118

Query: 123 NSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182
            S + +++      +F V+PWQF+L  STP+FTL EGFFT+L IQA+GETN+WL    NS
Sbjct: 119 KSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178

Query: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQR 242
           NTWII SLL SGGVIT SLYYLYRIYVTP+W LSIQTASLLGF LS+VCGLGLYGIVS +
Sbjct: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238

Query: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302
           GSVIESSLFFAYIVRCIYEISP+LAT+A DEI  + KD WQKHQ NLPT DNLL Y+ NV
Sbjct: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYRNV 297

Query: 303 ILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINE 362
           +LKN E++W + + +   T+           + + V L  +P W+F KNFT SVP SI E
Sbjct: 298 VLKNGEMIWDAIVQKTGTTSPS---------TTQMVWLRLQPLWKFTKNFTISVPSSIRE 348

Query: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422
             +VT+KMA+ESV+P +VINL FR+L+FYSATRIIPALQ+ +    + SRR+M+ +YWYS
Sbjct: 349 IFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYS 408

Query: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQP--EIIVDSWGFWNWCNIFCTIL 480
           PCI+IAMYTHLILQYSGEL  DLC+WGC   W   + P  +++VD+WGFWNWCN+FCT+ 
Sbjct: 409 PCIVIAMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLA 467

Query: 481 VYATELVGSGS 491
           +Y  EL+G  S
Sbjct: 468 IYGLELIGGKS 478

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/486 (54%), Positives = 338/486 (69%), Gaps = 15/486 (3%)

Query: 6   KSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARRNG 65
           +S +QS R+C   FYLL  L++IPISF+VGGL CGLS                + AR  G
Sbjct: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63

Query: 66  GRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKNSLNSN 125
                 L S  YY+QHF I            NDEL   +   +   ES ++ L+++  S 
Sbjct: 64  ---LAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDESLIDLLRSTTQSQ 120

Query: 126 QINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTW 185
              +V      ++VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN W
Sbjct: 121 --TWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMW 178

Query: 186 IISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQRGSV 245
           +IS L+ASGGVITA+LYYLYRIYVTPIW LS+QTASLLGF  S+V GLG+YGIVS RGS 
Sbjct: 179 VISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGST 238

Query: 246 IESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVILK 305
           IESSLFFAYIVRC+YEISP+LAT+A DEI  L K+ W    R+L ++D LL Y+ ++ILK
Sbjct: 239 IESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILK 298

Query: 306 NAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINEFCQ 365
           N E++W + + R           + +  S+ +V    +P W+F K+FT SVP SI E   
Sbjct: 299 NGEMVWDAILARTNVNVGASGTPVWA--SWNRV----QPLWKFVKHFTSSVPSSIQEIFY 352

Query: 366 VTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSPCI 425
           +T++MA E+++PA+VINLCFR+L+FYSATRIIPALQ+K+    R+SRR M+ LYWYSPCI
Sbjct: 353 LTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRRFMRMLYWYSPCI 409

Query: 426 LIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTILVYATE 485
           +IAMYTHLILQYSG++  DLC+WGC   W  PD P+++VDSWGFWNWCNIFCT+ +YA+E
Sbjct: 410 VIAMYTHLILQYSGQISNDLCLWGCF-PWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASE 468

Query: 486 LVGSGS 491
           L+GS S
Sbjct: 469 LLGSKS 474

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  514 bits (1325), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 256/489 (52%), Positives = 325/489 (66%), Gaps = 1/489 (0%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           M  + K+ ++S ++   CFYLL  + +IPISFK+GGL CGL+               N++
Sbjct: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNII 60

Query: 61  ARRNGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKN 120
           ARR G +  I +TS  +Y Q+F+I            N++L   +++     E+FL+ L+ 
Sbjct: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
            +  +  N++L      + V+PWQ IL+ STP FTL EGFFTIL IQ +GE N WL ++ 
Sbjct: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSN WIISSLL SGG+IT SLYYLYRIY TPIW LS+  A+LLGF LS+V  LG+YGIVS
Sbjct: 181 NSNIWIISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240

Query: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
             GSVIESSLFFAYIVRCIYEI+P+LATTAT+E L+  K+VWQ H  NL  AD  + YF+
Sbjct: 241 HNGSVIESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFY 300

Query: 301 NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI 360
           +     A   W  F   R      LH   +   S   +     P W   K  TFSVP SI
Sbjct: 301 DSFHMQAHKFWTLF-TSRTPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSI 359

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420
           +E   +T++MA +SVSPAI+INLCFR+++FYSATRIIPA+Q++   + RK R IMK LYW
Sbjct: 360 SELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYW 419

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGELKKDLC+WGC   WFG DQ  I VD+W FWNWCNIF TI+
Sbjct: 420 YSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTII 479

Query: 481 VYATELVGS 489
           +Y +EL+G 
Sbjct: 480 IYGSELIGG 488

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  511 bits (1316), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 260/488 (53%), Positives = 339/488 (69%), Gaps = 15/488 (3%)

Query: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARR 63
           + +S +QS R+C   FYLL  L++IPI+F+VGGL CGLS                + AR 
Sbjct: 2   IPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARA 61

Query: 64  NGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKNSLN 123
            G   +  L S  YY+QHF I            NDEL + +   +   ES ++ L++S +
Sbjct: 62  RG---FAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRSSTH 118

Query: 124 SNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183
           S    ++       +VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN
Sbjct: 119 SQP--WIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSN 176

Query: 184 TWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQRG 243
            W+IS L+ SGGVITA+LYYLYRIYVTPIW LS+QTASLLGF  S+V GLG++GIVS RG
Sbjct: 177 VWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRG 236

Query: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVI 303
           S IESSLFFAYIVRC+YEISP+LAT+A DEI +L KD W    R+L ++D  L Y+ ++I
Sbjct: 237 STIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDII 296

Query: 304 LKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINEF 363
           LKN E++W + + R     S      ++ +S+ +V    +P W+F K+FT SVP SI E 
Sbjct: 297 LKNGEMIWDAVLARTNVNVSGAGP--VAWISWHRV----QPLWKFVKHFTSSVPSSIQEI 350

Query: 364 CQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSP 423
             +T+ MA E+++PA+VINLCFR+L+FYSATRIIPALQRK+    R+SRR M+ LYWYSP
Sbjct: 351 FLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQRKHK---RRSRRFMRMLYWYSP 407

Query: 424 CILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTILVYA 483
           CI+IAMYTHLI+QYSG++  DLC+WGC   W  P+  +++VDSWGFWNWCNIFCT+ +YA
Sbjct: 408 CIVIAMYTHLIMQYSGQISNDLCLWGCF-PWSPPEGSKVVVDSWGFWNWCNIFCTMAIYA 466

Query: 484 TELVGSGS 491
           +EL GS S
Sbjct: 467 SELFGSKS 474

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  451 bits (1161), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 241/516 (46%), Positives = 323/516 (62%), Gaps = 35/516 (6%)

Query: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARR 63
           LS+  ++S R   A FYL   L++IPISF+VGGL CGLS                +    
Sbjct: 2   LSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTTN 61

Query: 64  NGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKNSLN 123
             G+ +  L S +YY QHF+I            +D+L  ++ + +  + S     + ++N
Sbjct: 62  GSGK-FKLLASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNVN 120

Query: 124 -----------SNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGET 172
                       N+ +        +++V+PWQ++L  +TP+FTL+EGFFT+LAIQA+GET
Sbjct: 121 ESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET 180

Query: 173 NRWLSNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCG 232
            RWL    NSNTW+I SLL SG VIT S++YLYRIYVTPIWPLS+QTA+LLGF LS+V G
Sbjct: 181 GRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG 240

Query: 233 LGLYGIVSQRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTA 292
           LGLYGI+S +GS IESSLFFAY+VRCIYEISP+LA TA  EI  +  D WQ  Q  L + 
Sbjct: 241 LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-SK 299

Query: 293 DNLLCYFHNVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEK--VSLISKP------ 344
           +NLL Y +N  + NAE  W S + +    T+   E+  +I  +     S I+K       
Sbjct: 300 NNLLTY-YNTFVSNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIILQ 358

Query: 345 ---------FWRFCKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATR 395
                     W F KNF+  +P SI+E   VT+KMA ES++PA++ NL FRVL+FYSATR
Sbjct: 359 TQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATR 418

Query: 396 IIPALQRKNDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSE--K 453
           IIPALQ+       +SR++M+ +YWYSPCI+IAMYTHLIL+YSGEL  DLCIWGC     
Sbjct: 419 IIPALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLN 476

Query: 454 WFGPDQPEIIVDSWGFWNWCNIFCTILVYATELVGS 489
           +    + + +VD+W FWNWCN+F T+L+YA EL+GS
Sbjct: 477 FSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  442 bits (1136), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 240/506 (47%), Positives = 316/506 (62%), Gaps = 30/506 (5%)

Query: 6   KSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARRNG 65
           K  ++S R   A FYL   L+++PISF++GGL CGLS                + A   G
Sbjct: 4   KGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAATRG 63

Query: 66  GRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRS------------NESES 113
              +  + S LYY QHF++            ND+L   L                N +ES
Sbjct: 64  DE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMNES 122

Query: 114 FLEALKNSLNSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETN 173
            L+ L  S +       L     R+VV+PWQ++L  +TP FTL+EGFFT+LAIQ +GET 
Sbjct: 123 LLQLLGRSRDDRATMAYLHYY--RYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180

Query: 174 RWLSNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGL 233
           RWL    NS  W+ISSL+ SG VIT S+YYLYRIYVTPIWPLS+ TA+LLGF LS+V GL
Sbjct: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240

Query: 234 GLYGIVSQRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTAD 293
           GLYGI+S +GS IESSLFFAY+V CIYEISP+LA TA  EI  +  + WQ  Q  LP  +
Sbjct: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP-KN 299

Query: 294 NLLCYFHNVILKNAEVLWGSFIPRRRKTTS-DLHEKIISILSFEKVSLI-------SKPF 345
           +LL Y+ N IL NAE LW   + +     S +L +   S++  + + L+       S+  
Sbjct: 300 SLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQL 358

Query: 346 WRFCKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKND 405
           W F KNF+  +P SI+E   VT+ +A ES++ A+V NL FRV++FYSATRIIPALQR   
Sbjct: 359 WSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATG 418

Query: 406 KQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPD--QPEII 463
               +SR++M+ +YWYSPCI+IAMYTH+IL+YSGEL  +LCIWGC   W   +  +   +
Sbjct: 419 GT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCF-PWLQSEANRDRWV 475

Query: 464 VDSWGFWNWCNIFCTILVYATELVGS 489
           VD+WGFWNWCN+F T+L+YA EL+GS
Sbjct: 476 VDAWGFWNWCNLFFTLLIYAVELIGS 501

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  436 bits (1122), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 240/493 (48%), Positives = 299/493 (60%), Gaps = 50/493 (10%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           M  + KS +Q+ RI     YL   L++IPISF+VGGL CGLS                ++
Sbjct: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99

Query: 61  ARRNGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKN 120
               G  L    ++ +YY QH +I                             FL   +N
Sbjct: 100 LLDRGSAL----STLIYYLQHLLIPSILFM-----------------------FLSYFEN 132

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
            ++S+ ++          +V+PWQ  L  STP FTL EG FTILAIQA+GET RWL    
Sbjct: 133 -IDSDTVDSEYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
            SN W+I SLL SGG+IT SL+Y YRIYVTP+W LS  +ASLLGF  S+VCG+GLYGI +
Sbjct: 192 RSNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250

Query: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
             GSV+ESSLFFAY+VR +YEISPK+A  A DEI D+ K+ W+ HQ NLP  DNLL    
Sbjct: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL---- 306

Query: 301 NVILKNAEVLWGSFI---PRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVP 357
            ++ KN   +W   +   PR  K           I   ++   I  P W   KNFT SVP
Sbjct: 307 ELMTKNYRAIWSQIVEHTPRNHK----------YIKMMDQCKWILNPLWNSVKNFTKSVP 356

Query: 358 LSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKG 417
           +SI E   VT KMA ES+ PA+VINL FR+L+FYSATRIIP LQR N K+ R  RRIM  
Sbjct: 357 ISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNF 415

Query: 418 LYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFC 477
           +YWYSPCI+IAMYTHLIL+YSG+LK DLCIWGC        +P+I+VDSW FWNWCNI+ 
Sbjct: 416 VYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGCFPY---ETEPKIVVDSWSFWNWCNIYS 472

Query: 478 TILVYATELVGSG 490
           T+L+YA EL+GS 
Sbjct: 473 TMLIYALELMGSN 485

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  425 bits (1093), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 242/540 (44%), Positives = 316/540 (58%), Gaps = 63/540 (11%)

Query: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARR 63
           + +  + SG      FYLL  +++IPISFK+GG+ CGLS                ++ +R
Sbjct: 51  IPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKR 110

Query: 64  NGGRLYI-FLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVL----------KNRSNESE 112
                 +  L S L+Y Q+F+I+           N +L   L          KN +N   
Sbjct: 111 LTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKY 170

Query: 113 SFLEALK---------------NSLNS----------------NQIN-YVLXXXXXRFVV 140
             L  +K               N LN                  ++N ++L        +
Sbjct: 171 QILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYIFI 230

Query: 141 QPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTWIISSLLASGGVITAS 200
           +PW+F+L  STPFFTL EGFFTIL IQ +GETN WL    +S+ W+I SLL+SGGVITA+
Sbjct: 231 KPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITAT 290

Query: 201 LYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQRGSVIESSLFFAYIVRCIY 260
           LYYL RIYVTP W L++ TAS+LGF LS+V GLG++GIVS+ GS IESSLFFAYIVRCIY
Sbjct: 291 LYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIY 350

Query: 261 EISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVILKNAEVLWGSFIPRRRK 320
           E+SP+LA +ATDE L+ F +VWQ +Q  +  ADN+L Y    I+      + SF      
Sbjct: 351 EMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMD----AFSSF----SS 402

Query: 321 TTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINEFCQVTIKMASESVSPAIV 380
               L  K I  L   K +LI K FW F KNFT +VP SIN+  Q+T +MA +S+SPAI+
Sbjct: 403 IEHHLFPKTIE-LGISK-NLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAII 460

Query: 381 INLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGE 440
           INL FR+++FYSATRIIPA+QR+           M  +YW+SPC+LIAMYTHLILQ+SGE
Sbjct: 461 INLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGE 520

Query: 441 LKKDLCIWGCSEKWFGPDQP---------EIIVDSWGFWNWCNIFCTILVYATELVGSGS 491
           LKK++C+W C E W                IIVDSW FWNWCNIF TI++YA+EL+G  S
Sbjct: 521 LKKNICLWNC-ENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS 579

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  417 bits (1073), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 231/530 (43%), Positives = 323/530 (60%), Gaps = 47/530 (8%)

Query: 6   KSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLARRNG 65
           KS  QS R+   CFYL+  L++IP +FK+GGL CGLS               +++A+R  
Sbjct: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTL 65

Query: 66  GRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVL-KNRSNESESFLEALKNSLN- 123
              YI L++ +YY QH VIA           +  L  +L  N++++  S L  +KN  + 
Sbjct: 66  NNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDTSK 125

Query: 124 --SNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLN 181
             S   +Y+L      + VQPW ++L+ STPFFTL EGFFTIL IQA+GET  WL     
Sbjct: 126 SVSQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWLLLKKQ 185

Query: 182 SNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQ 241
              + + + L S GVI  ++++LY+IY   +W LSIQTASLLG  +S+V  +G++GI S 
Sbjct: 186 KKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFST 245

Query: 242 RGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHN 301
            GS+IESSLF  YI+RC YEISP+L+T+AT EILD  K+ WQ HQ ++   +++L Y++N
Sbjct: 246 NGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNN 305

Query: 302 VILK--NAEVLWGSFIPRRRKTT------------------SDLHE--KIISILSFEKVS 339
           V+LK  N+  L+ S   +   T+                  +D+ +   +I ++ F+ + 
Sbjct: 306 VLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIY 365

Query: 340 ----LISKPFWRFCKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATR 395
               + + P +   K+F  ++P S+    QVT K+A +SVSP+IVINLCFRVL+FYSATR
Sbjct: 366 QNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATR 425

Query: 396 IIPALQRKNDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGC----- 450
           IIPA+QRKN  + ++SR  +K  Y +SPCI+IAMYT+LILQYSGELK DLCIWGC     
Sbjct: 426 IIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISK 485

Query: 451 --SEKW------FGPDQP----EIIVDSWGFWNWCNIFCTILVYATELVG 488
             S++        G D      E IV+SWGFWNWCNIFCTI +Y  EL+G
Sbjct: 486 SISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  410 bits (1055), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 230/501 (45%), Positives = 314/501 (62%), Gaps = 24/501 (4%)

Query: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           M+ + K+  +S R   A  YLL  L+++PI+F++GGL+CGL+               N +
Sbjct: 1   MSQVLKNLGESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAI 60

Query: 61  ARRNGGRLYIFLTSCLYYSQHFVIAXXXXXXXXXXXNDELGNVLKNRSNESESFLEALKN 120
           AR+   + +I  T+ LYY Q+F I            + EL   + + +   E+    LKN
Sbjct: 61  ARKLRWQRFIAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKN 120

Query: 121 --SLNSNQINYVLXXXXXRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSN 178
             +  S  I+++       + +  W+F L+ STP F L EGFFTILAIQ +GETN WL+ 
Sbjct: 121 NDTYPSKTISFI-YKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTT 179

Query: 179 DLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGI 238
             NS+ WII SL+ S  ++T S+YY+Y+IYVTP+W LS Q ASLL F  S+V G+ +YGI
Sbjct: 180 VKNSSIWIILSLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGI 239

Query: 239 VSQRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCY 298
           VS RGSV+ESSLFFAYIV CIYEISP +ATTA D+I D  K+ WQ HQRN   +DNLL Y
Sbjct: 240 VSHRGSVVESSLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIY 299

Query: 299 FHNVILKNAEVLWGSFIPRR--RKTTSDLHEKIISILSFEKVSLISKPF---WRFCKNFT 353
           ++N ++KN +     FI  +  + TT D      + L F+ V +  K F    +  K FT
Sbjct: 300 YYNSLIKNVD----EFIKLKIIKLTTKDNFSNKFNSLLFQCVKISKKSFKFILKLSKRFT 355

Query: 354 FSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRK------NDKQ 407
             +P SI E   +T+KMASES+SP I++NLC+RVL+FY+ATRIIPAL+ +      N+ +
Sbjct: 356 LGIPSSIYELYSITLKMASESISPVILVNLCYRVLIFYAATRIIPALESRSNGFSNNNIK 415

Query: 408 LRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSW 467
            + + + MK LYWYSPCILIAMYT+LILQYSGELK +  +W  S         E++VDSW
Sbjct: 416 TKSNSKFMKVLYWYSPCILIAMYTNLILQYSGELKSEFKLWNNSN------NNEVVVDSW 469

Query: 468 GFWNWCNIFCTILVYATELVG 488
            FWNWCNIF TI +Y +EL+G
Sbjct: 470 RFWNWCNIFWTITLYGSELIG 490

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 177 SNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPI-WPLSIQTASLLGFVLSMVCG 232
           + D NS+        A+ G+ T SLY ++  +  P+ WPL + T   L FV +   G
Sbjct: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAG 86

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,381,877
Number of extensions: 1847746
Number of successful extensions: 6422
Number of sequences better than 10.0: 41
Number of HSP's gapped: 6484
Number of HSP's successfully gapped: 43
Length of query: 491
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 377
Effective length of database: 40,409,475
Effective search space: 15234372075
Effective search space used: 15234372075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)