Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.107na 1ON65765732550.0
Skud_9.81na 1ON64866314010.0
Smik_9.87na 1ON63266211551e-149
YIL092Wna 1ON63361710011e-127
NCAS0C00250singletonON330122830.15
NCAS0H03500singletonON315122820.21
NDAI0E04940singletonON193159790.29
TBLA0C03840singletonON274133751.5
NCAS0B00390singletonON300118742.0
TBLA0F03150singletonON257132723.4
KLLA0C10945g5.236ON40587724.5
ZYRO0G03168g2.470ON606145708.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.107
         (657 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.107 Chr9 (183200..185173) [1974 bp, 657 aa] {ON}  YIL092W...  1258   0.0  
Skud_9.81 Chr9 (165744..167690) [1947 bp, 648 aa] {ON}  YIL092W ...   544   0.0  
Smik_9.87 Chr9 (168203..170101) [1899 bp, 632 aa] {ON} YIL092W (...   449   e-149
YIL092W Chr9 (189066..190967) [1902 bp, 633 aa] {ON} Putative pr...   390   e-127
NCAS0C00250 Chr3 complement(31338..32330) [993 bp, 330 aa] {ON}        37   0.15 
NCAS0H03500 Chr8 (661479..662426) [948 bp, 315 aa] {ON}                36   0.21 
NDAI0E04940 Chr5 (1121677..1122258) [582 bp, 193 aa] {ON}              35   0.29 
TBLA0C03840 Chr3 complement(918471..919295) [825 bp, 274 aa] {ON}      33   1.5  
NCAS0B00390 Chr2 complement(51434..52336) [903 bp, 300 aa] {ON}        33   2.0  
TBLA0F03150 Chr6 complement(764616..765386) [771 bp, 257 aa] {ON...    32   3.4  
KLLA0C10945g Chr3 (941764..942981) [1218 bp, 405 aa] {ON} simila...    32   4.5  
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    32   8.6  

>Suva_9.107 Chr9 (183200..185173) [1974 bp, 657 aa] {ON}  YIL092W
           (REAL)
          Length = 657

 Score = 1258 bits (3255), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/657 (94%), Positives = 618/657 (94%)

Query: 1   MVNKSKFNGGNGNAPSSXXXXXXXXXXXXXSVASSVRCENFGIARTDDDEKQVSMIFDKM 60
           MVNKSKFNGGNGNAPSS             SVASSVRCENFGIARTDDDEKQVSMIFDKM
Sbjct: 1   MVNKSKFNGGNGNAPSSRNNKKKYNNYRKKSVASSVRCENFGIARTDDDEKQVSMIFDKM 60

Query: 61  NHLKKFSAEEDDDKNLFVQWSDDITDTLSGLWWTGTFLKLLISSALTGRAKKWFDSTTEG 120
           NHLKKFSAEEDDDKNLFVQWSDDITDTLSGLWWTGTFLKLLISSALTGRAKKWFDSTTEG
Sbjct: 61  NHLKKFSAEEDDDKNLFVQWSDDITDTLSGLWWTGTFLKLLISSALTGRAKKWFDSTTEG 120

Query: 121 IDDHSIRTYTLEKFLALLSGEFDGVRVLRRESFAELLKLSINSETSLEKFAKISEFLTPY 180
           IDDHSIRTYTLEKFLALLSGEFDGVRVLRRESFAELLKLSINSETSLEKFAKISEFLTPY
Sbjct: 121 IDDHSIRTYTLEKFLALLSGEFDGVRVLRRESFAELLKLSINSETSLEKFAKISEFLTPY 180

Query: 181 YLSSSAALDLFLTKLKPCLQKQLGDAAFPMTLDIALLVAACEFAKGTSEERKDKXXXXXX 240
           YLSSSAALDLFLTKLKPCLQKQLGDAAFPMTLDIALLVAACEFAKGTSEERKDK      
Sbjct: 181 YLSSSAALDLFLTKLKPCLQKQLGDAAFPMTLDIALLVAACEFAKGTSEERKDKNAENNN 240

Query: 241 XXXXXXPIDLDPSTRKKRDTVKTNKKCKRKSIHENIDNAIKKSNGKKNVNEEELQVLHPK 300
                 PIDLDPSTRKKRDTVKTNKKCKRKSIHENIDNAIKKSNGKKNVNEEELQVLHPK
Sbjct: 241 NNNDSNPIDLDPSTRKKRDTVKTNKKCKRKSIHENIDNAIKKSNGKKNVNEEELQVLHPK 300

Query: 301 RRRQNESGKQISLPTAALADILPLNQNISNINASNKQFNAXXXXXXXXXXXXXXFQHHLT 360
           RRRQNESGKQISLPTAALADILPLNQNISNINASNKQFNA              FQHHLT
Sbjct: 301 RRRQNESGKQISLPTAALADILPLNQNISNINASNKQFNASSSLDSYTSLKSNSFQHHLT 360

Query: 361 NETPILDGNRSFPITTPAVASLAYDKVENIKNETNIHDEAINDIPLSLASSNDFVKKSVA 420
           NETPILDGNRSFPITTPAVASLAYDKVENIKNETNIHDEAINDIPLSLASSNDFVKKSVA
Sbjct: 361 NETPILDGNRSFPITTPAVASLAYDKVENIKNETNIHDEAINDIPLSLASSNDFVKKSVA 420

Query: 421 ESMSWKSIRGNVGVPNSNVKSFLRGDESNHQMARRSHATHVSSHSNIFKPAQTACYDSNK 480
           ESMSWKSIRGNVGVPNSNVKSFLRGDESNHQMARRSHATHVSSHSNIFKPAQTACYDSNK
Sbjct: 421 ESMSWKSIRGNVGVPNSNVKSFLRGDESNHQMARRSHATHVSSHSNIFKPAQTACYDSNK 480

Query: 481 TNFTENNKIGEINKLNPFTKNENTIKSDKSKGPKNPVTSVKVNKPSYFIDLEKPQSMHNE 540
           TNFTENNKIGEINKLNPFTKNENTIKSDKSKGPKNPVTSVKVNKPSYFIDLEKPQSMHNE
Sbjct: 481 TNFTENNKIGEINKLNPFTKNENTIKSDKSKGPKNPVTSVKVNKPSYFIDLEKPQSMHNE 540

Query: 541 NRSVGLLAQKSYPLHNFAVRTRNARFNDRPSNYTSAHGNLNAIHPLSLKINNIQCLSKPG 600
           NRSVGLLAQKSYPLHNFAVRTRNARFNDRPSNYTSAHGNLNAIHPLSLKINNIQCLSKPG
Sbjct: 541 NRSVGLLAQKSYPLHNFAVRTRNARFNDRPSNYTSAHGNLNAIHPLSLKINNIQCLSKPG 600

Query: 601 KREADTNKEVNVPKMTVQEKGTVNSIIAKDNDGRSNSVENPFLGNTLNETKLNSYYI 657
           KREADTNKEVNVPKMTVQEKGTVNSIIAKDNDGRSNSVENPFLGNTLNETKLNSYYI
Sbjct: 601 KREADTNKEVNVPKMTVQEKGTVNSIIAKDNDGRSNSVENPFLGNTLNETKLNSYYI 657

>Skud_9.81 Chr9 (165744..167690) [1947 bp, 648 aa] {ON}  YIL092W
           (REAL)
          Length = 648

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/663 (48%), Positives = 400/663 (60%), Gaps = 21/663 (3%)

Query: 1   MVNKSKFNGGN-----GNAPSSXXXXXXXXXXXXXSVASSVRCENFGIARTDDDEKQVSM 55
           MVNKSK NGGN     G                  SV SS++C+NFG+A+  DDE+QVS 
Sbjct: 1   MVNKSKTNGGNDTITNGKTLPLRINKGTCRSRRKKSVVSSIKCKNFGLAKPADDEEQVSK 60

Query: 56  IFDKMNHLKKFSAEEDDDKNLFVQWSDDITDTLSGLWWTGTFLKLLISSALTGRAKKWFD 115
           I DKMNHLKKFSA+E DD++LFVQW DDI++TLSGLW TGTFLKLLISSAL+GRAKKWFD
Sbjct: 61  ILDKMNHLKKFSADEGDDESLFVQWIDDISNTLSGLWCTGTFLKLLISSALSGRAKKWFD 120

Query: 116 STTEGIDDHSIRTYTLEKFLALLSGEFDGVRVLRRESFAELLKLSINSETSLEKFAKISE 175
            TTEGIDDH ++TYTLE FLALLSGEFDG R LRRE F+ELL L I+SETSLEKFA IS 
Sbjct: 121 LTTEGIDDHLMKTYTLENFLALLSGEFDGARFLRRERFSELLNLPIDSETSLEKFANISG 180

Query: 176 FLTPYYLSSSAALDLFLTKLKPCLQKQLGDAAFPMTLDIALLVAACEFAKGTSEERKDKX 235
            LTPYYLSSSA LDL LTKL PCLQKQL  +AFPMTLD+ALL+AACEFAKG S ER D  
Sbjct: 181 LLTPYYLSSSATLDLLLTKLGPCLQKQLKSSAFPMTLDVALLMAACEFAKGASIERNDIN 240

Query: 236 XXXXXXXXXXXPIDLDPSTRKKRDTVKTNKKCKRKSIHENIDNAIKKSNGKKNVNEEELQ 295
                                K+   KT K           D   +K   K   NE E Q
Sbjct: 241 DNIISSGATSSKKKKSTFKDSKKYKAKTTKG--------TTDIDFEKDVRKGYNNEMEPQ 292

Query: 296 VLHPKRRRQNESGKQISLPTAALADILPLNQNISNINASNK-QFNAXXXXXXXXXXXXXX 354
           +   KRR+Q+E   Q+SL     A+ LP    ++N  A  K + ++              
Sbjct: 293 IPSCKRRKQSEHCTQLSLAMTKNAETLPSENALANTYAPRKVRSSSNNSLDSFAPLKSNK 352

Query: 355 FQHHLTNETPILDGNRSFPITTPAVASLAYDKVENIKNETNIHDEAINDIPLSLASSNDF 414
            Q ++ N    LD +R+F  TT    +LA DK E  +++T  +D+  ++  LS +  N  
Sbjct: 353 HQSYVVNAIATLDSDRTFTSTTS--TALADDKSEYTRDKTIFYDKPTDEPSLSSSGGNYA 410

Query: 415 VKKSVAESMSWKSIRGNVGVPNSNVKSFLRGDESNHQMARRSHATHVSSHSNIFKPAQTA 474
            ++    SM+    + +V VPN  +K    GD SN    R   A H+ S S +    QT 
Sbjct: 411 ARRDTLHSMTSTPFKDSVQVPNPRLKDISGGDVSNRHTTRPYQAMHIFSRSALVVNDQTV 470

Query: 475 CYDSNKTNFTENNKIGEINKLNPFTKNENTIKSDKSKGPKNPVTSVKVNKPSYFIDLEKP 534
                KT F ++N+I +I   NPFT N+N  K    KG + P+ SV+VN+ S F+DLEKP
Sbjct: 471 ----KKTQFIKSNQIEDIINSNPFTSNKNEKKVKALKGLETPIASVQVNELSCFVDLEKP 526

Query: 535 QSMHNENRSVGLLAQKSYPLHNFAVRTRNARFNDRPSNYTSAHGNLNAIHPLSLKINNIQ 594
           +S + EN+   LL QK YPLHNFAVRTRNA+F++RPSNYTSAHG    I PLS  I  IQ
Sbjct: 527 RSANIENKRSELLTQKFYPLHNFAVRTRNAQFSERPSNYTSAHGIKGNIRPLSTNIQKIQ 586

Query: 595 CLSKPGKREADTNKEVNVPKMTVQEKGTVNSIIAKDNDGRSNSVENPFLGNTLNETKLNS 654
             S+ G R+ADTN EV    M VQ K +VNS   ++ +   N V NPFL NT++  K ++
Sbjct: 587 SFSRSGSRKADTNTEVISSHMLVQHKRSVNS-ENREGNRTFNDVTNPFLANTMSGRKQSN 645

Query: 655 YYI 657
           YY+
Sbjct: 646 YYM 648

>Smik_9.87 Chr9 (168203..170101) [1899 bp, 632 aa] {ON} YIL092W
           (REAL)
          Length = 632

 Score =  449 bits (1155), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 292/662 (44%), Positives = 381/662 (57%), Gaps = 41/662 (6%)

Query: 1   MVNKSKFNGG-----NGNAPSSXXXXXXXXXXXXXSVASSVRCENFGIARTDDDEKQVSM 55
           M +KS  N G     NG+  S              +VA S+R +NFG+AR  DDE+Q S+
Sbjct: 1   MADKSSTNDGDSLVTNGHILSQRGSKKAYNKCKKKNVAPSIRWKNFGVARQADDEQQASL 60

Query: 56  IFDKMNHLKKFSAEEDDDKNLFVQWSDDITDTLSGLWWTGTFLKLLISSALTGRAKKWFD 115
           I DKM+HLKKFS+ E DD+NLFVQW+DDITDTLSGLW TG FLKLLISSAL+GRAK+WFD
Sbjct: 61  ILDKMSHLKKFSSNEGDDENLFVQWADDITDTLSGLWCTGIFLKLLISSALSGRAKEWFD 120

Query: 116 STTEGIDDHSIRTYTLEKFLALLSGEFDGVRVLRRESFAELLKLSINSETSLEKFAKISE 175
           ST EGIDD+ +  YTLEKFLALLS EFDG ++LRRE F +LL+L I+SE SLE F+ ISE
Sbjct: 121 STLEGIDDNVVNAYTLEKFLALLSEEFDGAKLLRRERFTKLLRLPIDSEKSLETFSYISE 180

Query: 176 FLTPYYLSSSAALDLFLTKLKPCLQKQLGDAAFPMTLDIALLVAACEFAKGTSEERKDKX 235
            LTPYYLS+SAALDLFLTKL+P  QK+L ++ FPMTLD+ALL+ ACEFAK  S  RKD+ 
Sbjct: 181 HLTPYYLSTSAALDLFLTKLEPQFQKELENSVFPMTLDMALLMTACEFAKRASSHRKDRK 240

Query: 236 XXXXXXXXXXXPIDLDPSTRKKRDTVKTNKKCKRKSIHENIDNAIKKSNGKKNVNEEELQ 295
                        D D  T KKR T   NKKCK K I EN  N  +KSN KK  +E+EL 
Sbjct: 241 KNTS---------DFDIGTSKKRAT-NLNKKCKTKIIREN--NTNRKSNRKKCFSEKELL 288

Query: 296 VLHPKRRRQNESGKQISLPTAALADILPLNQNIS-NINAS-NKQFNAXXXXXXXXXXXXX 353
           +   KRR+Q+E G Q  L      +  P  + +S N+  S N Q N              
Sbjct: 289 IPDLKRRKQSECGIQFPLVVPEHKE-FPSERKVSVNVCISKNGQSNLSNPPDFHAYLKDT 347

Query: 354 XFQHHLTNETPILDGNRSFPITTPAVASLAYDKVENIKNETNIHDEAINDIPLSLASSND 413
             Q +  + T  L  NR   I+  A   L   KV  +KNE   ++E  +  P SL + N 
Sbjct: 348 KSQQYADSATSNLINNR--LISCTATDKLIGGKVVTMKNENTAYNEPTDGRPSSLENRNR 405

Query: 414 FVKKSVAESMSWKSIRGNVGVPNSNVKSFLRGDESNHQMARRSHATHVSSHSNIFKPAQT 473
            VK++  + MS  S +    + +S  +S   G+         S   H+ S     +P   
Sbjct: 406 AVKENTLQFMSSNSFKECGKIHDSRTRSISGGN----MTISSSQTMHMFS-----RPGSL 456

Query: 474 ACYDSNKTN-FTENNKIGEINKLNPFTKNENTIKSDKSKGPKNPVTSVKVNKPSYFIDLE 532
           A     + N  + +N+I  ++  NPFT N        SK  KN   S++++  S  + L+
Sbjct: 457 AIDHQARNNEVSMSNRIKVVDNYNPFTANLKV-----SKSSKNVPASMRMDDLSGTVGLK 511

Query: 533 KP-QSMHNENRSVGLLAQKSYPLHNFAVRTRNARFNDRPSNYTSAHGNLNAIHPLSLKIN 591
              ++ + EN S  L ++KSYPL+NFAVRTRNA FNDRPSNYTSAH   +  +P S  I+
Sbjct: 512 NALRTTYEENESYQLSSKKSYPLNNFAVRTRNAHFNDRPSNYTSAHAITSVTYPSSSSIS 571

Query: 592 NIQCLSKPGKREADTNKEVNVPKMTVQEKGTVNSIIAKDNDGRS--NSVENPFLGNTLNE 649
            IQC ++P  +E    K +    M  Q+K   N+  +K+   RS  N V NPFL N + +
Sbjct: 572 TIQCFTRPNSKEPSPKKVIISSCMVAQKKELANT-KSKEAKNRSSFNEVTNPFLVNVIEK 630

Query: 650 TK 651
            K
Sbjct: 631 NK 632

>YIL092W Chr9 (189066..190967) [1902 bp, 633 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm and to
           the nucleus
          Length = 633

 Score =  390 bits (1001), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 250/617 (40%), Positives = 345/617 (55%), Gaps = 38/617 (6%)

Query: 36  VRCENFGIARTDDDEKQVSMIFDKMNHLKKFSAEEDDDKNLFVQWSDDITDTLSGLWWTG 95
           + C NF + R  DD++Q   + DK++HLKKFSAE+ DD N+FVQW+DDITD L GL  TG
Sbjct: 48  IACNNFCVTRQIDDDEQAFKMLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTG 107

Query: 96  TFLKLLISSALTGRAKKWFDSTTEGIDDHSIRTYTLEKFLALLSGEFDGVRVLRRESFAE 155
           TFLKLLISSAL+GRAK WFDSTTEGIDDH I+ Y+ EKFLALLS EFDG R LRRE F E
Sbjct: 108 TFLKLLISSALSGRAKTWFDSTTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTE 167

Query: 156 LLKLSINSETSLEKFAKISEFLTPYYLSSSAALDLFLTKLKPCLQKQLGDAAFPMTLDIA 215
           LL LSI+SE SLE FA  S  LTPYYLSS AALDLFLTKL+P LQKQL + AFPMTL++A
Sbjct: 168 LLTLSIDSEKSLEAFAHKSGRLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLA 227

Query: 216 LLVAACEFAKGTSEERKDKXXXXXXXXXXXXPIDLDPSTRKKRDTVKTNKKCKRKSIHEN 275
           LL+ ACEFAK  S  +K +              D D  T K ++T   +K    K+I +N
Sbjct: 228 LLITACEFAKRASNHKKYRYKNTR---------DSDICTPKSKNTAIVSKLSNTKTISKN 278

Query: 276 IDNAIKKSNGKKNVNEEELQVLHPKRRRQNESGKQISLPTAALADILPLNQNISNINASN 335
               I+KS+ K   ++    +  PKRR+QNE G ++ L      +IL  ++N+S    ++
Sbjct: 279 --KVIEKSDKKNYFDKNSQHIPDPKRRKQNEPGMRLFLVMDEEKNIL-TSRNVSANAYTS 335

Query: 336 KQFNAXXXXXXXXXXXXXXFQHHLTNETPILDGNRSFPITTPAVASLAYDKVENIKNETN 395
           K  +                Q  +    PI   N    +T      L  D+V   K ET 
Sbjct: 336 KNGHTNLSDLHTNLKNSKSQQCAV---EPISILNSGSLVTGTINIDLINDEVLGTKEETT 392

Query: 396 IHDEAINDIPLSLASSNDFVKKSVAESMSWKSIRGNVGVPNSNVKSFLRGDESNHQMARR 455
            +DE ++    SL      VKK+  + ++    + N  +  + + S L    SN      
Sbjct: 393 TYDERMDGNSRSLNERCCAVKKNSLQPITSNIFQKNAEIQGTKIGSVLDSGISN------ 446

Query: 456 SHATHVSSHSNIFKPAQTACYDS--NKTNFTENNKIGEINKLNPFTKNENTIKSDKSKGP 513
                 SS   +F P  +A   +   K   ++++++ +I + NPF  NE   K + S+  
Sbjct: 447 ----SFSSTEYMFPPTSSATVSNPVKKNEISKSSQVKDIAQFNPFMTNEKEKKLNPSESF 502

Query: 514 KNPVTSVKVNKPSYFIDLEK-PQSMHNENRSVGLLAQKSYPLHNFAVRTRNARFNDRPSN 572
           K+P  S+++N+ S    L   P +++ +++ + L  +K YPLHNFAVRTR+A FNDRPSN
Sbjct: 503 KSPGVSMEINRLSRIAGLRNIPGNIYEDSKMLNLKTRKCYPLHNFAVRTRSAHFNDRPSN 562

Query: 573 YTSAHGNLNAIHPLSLKINNIQCLSKPGKREADTNKEVNVPKMTVQEKGTVNSIIAKDND 632
           Y S H  +NA        ++IQC+++  + +A+TNK            G+  S   +   
Sbjct: 563 YISPHETINATLRSPASFDSIQCITRSKRVDAETNKAT----------GSAKSENIETKS 612

Query: 633 GRSNSVENPFLGNTLNE 649
            +   V NPFL NT N+
Sbjct: 613 RKFPEVINPFLVNTTNK 629

>NCAS0C00250 Chr3 complement(31338..32330) [993 bp, 330 aa] {ON} 
          Length = 330

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 4/122 (3%)

Query: 77  FVQWSDDITDTLSGLWWTGTFLKLLISSALTGRAKKWFDSTT---EGIDDHSIRTYTLEK 133
           F  W +++      L W+G   + L+ S+LTG A  +F  +    E  D   I   TL+ 
Sbjct: 102 FDTWRNELISAAGVLPWSGQDARSLVRSSLTGSAMGYFTWSCQIKEKEDKVDISKQTLDY 161

Query: 134 FLALLSGEFDGVRVLRRESFAELLKLSINSETSLEKFAKISEFLTPYYLSSSAALDLFLT 193
           F+ L++ ++    V+  +   + L L   S  ++E        L P   S   A  L L+
Sbjct: 162 FIKLMADKYTNANVIDVQ-VQDFLFLRPKSSKAVETLELHLRNLIPSLFSEDVARTLMLS 220

Query: 194 KL 195
           KL
Sbjct: 221 KL 222

>NCAS0H03500 Chr8 (661479..662426) [948 bp, 315 aa] {ON}
          Length = 315

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 52/122 (42%), Gaps = 4/122 (3%)

Query: 77  FVQWSDDITDTLSGLWWTGTFLKLLISSALTGRAKKWFDSTT---EGIDDHSIRTYTLEK 133
           F  W +++      L WTG   + L+ ++LTG A  +F  +    E  D   +   TL+ 
Sbjct: 101 FDTWRNELISAAGVLPWTGQDARSLVRTSLTGSAMGYFTWSCQIKEKEDKVDMSKQTLDD 160

Query: 134 FLALLSGEFDGVRVLRRESFAELLKLSINSETSLEKFAKISEFLTPYYLSSSAALDLFLT 193
           F+ L++ ++     +  +   + L L   S  ++E        L P  LS   A  L L 
Sbjct: 161 FIKLMADKYTNANAIDVQ-VQDFLFLRPKSSKAVETLEAHLRNLIPSLLSEDIARTLMLG 219

Query: 194 KL 195
           KL
Sbjct: 220 KL 221

>NDAI0E04940 Chr5 (1121677..1122258) [582 bp, 193 aa] {ON}
          Length = 193

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 73/159 (45%), Gaps = 12/159 (7%)

Query: 52  QVSMIFDKMN-----HLKKFSAEEDD--DKNLFVQWSDDITDTLSGLWWTGTFLKLLISS 104
           Q SM ++K+         KFS    D  D N    W++ I  TL      G     L+ S
Sbjct: 28  QKSMTYEKLTLRALESCVKFSGGLSDTIDVN---TWAEKIAWTLKNSAAKGFDAASLVES 84

Query: 105 ALTGRAKKWFDSTTEGIDDHSIRTYTLEKFLALLSGEFDGVRVLRRESFAELLKLSINSE 164
            L+  A+ WF  T + + D +I +   + FL L+  +F  +  L+ +  ++L+ L I S 
Sbjct: 85  RLSSPAENWFIETIKDLGD-TIESERPQFFLNLVIEKFKDLN-LKTKRLSKLMNLRITSG 142

Query: 165 TSLEKFAKISEFLTPYYLSSSAALDLFLTKLKPCLQKQL 203
            S   F + S  L   Y+S    L++F++K+   ++  L
Sbjct: 143 ESGHIFERTSLELPEEYISRQCLLEIFVSKVPSFIRDHL 181

>TBLA0C03840 Chr3 complement(918471..919295) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 11/133 (8%)

Query: 102 ISSALTGRAKKWFDSTTEGIDDHSIRTYTL--EKFLALLSGEFDGVRVLRR-ESFAELLK 158
           +++ L G A  WF  T  G  D S   +    E F     G+FD   V+++  S  +  K
Sbjct: 54  LAANLYGPALDWF-MTFSGNHDVSEMAFDAFKEAFKQAFQGKFDSYDVIQKLSSLTQKDK 112

Query: 159 LSINSETSLEKFAKISEFLTPYYLSSSAALDLFLTKLKPCLQKQL---GDAAFPMTLDIA 215
           +    E  +  F +  + L P  LS+   ++LF+  LKP  +K L     ++F     +A
Sbjct: 113 I----EAYVSTFNRYRKLLPPRSLSNDVLINLFIKGLKPNTRKDLRLRTVSSFYEATQLA 168

Query: 216 LLVAACEFAKGTS 228
           +    C +  G S
Sbjct: 169 IRAEHCCYYPGIS 181

>NCAS0B00390 Chr2 complement(51434..52336) [903 bp, 300 aa] {ON} 
          Length = 300

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 54/118 (45%), Gaps = 15/118 (12%)

Query: 65  KFSAEEDDDKNLFVQWSDDITDTLSGLWWTGTFLKLLISSALTGRAKKWFDS-TTEGIDD 123
           KF   ED+    + +W+D +     GL   G     LI  ++ GR  + F+S   E I++
Sbjct: 31  KFDGIEDNSMT-YQKWADRLMWLSEGLNVIGNDALNLIGESIDGRLLEKFNSRRYEYINE 89

Query: 124 HSIRTYTLEKFLALLSGEFDGVRVLRRESFAELLKLSI----NSETSLEKFAKISEFL 177
           HS     LE++L LL G+     +       ELL+  +     S  SL+KF  I E L
Sbjct: 90  HS--NAPLEEYLKLLKGDIVSWNI-------ELLESGLFYFDGSRKSLDKFCSIVESL 138

>TBLA0F03150 Chr6 complement(764616..765386) [771 bp, 257 aa] {ON}
           gene extends into a gap in the genome sequence
          Length = 257

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 56/132 (42%), Gaps = 9/132 (6%)

Query: 102 ISSALTGRAKKWFDSTTEGIDDHSIRTYTL--EKFLALLSGEFDGVRVLRRESFAELLKL 159
           +++ L G A  WF  T  G  D S   +    E F     G+FD   V+++ S    L  
Sbjct: 54  LAANLYGPALDWF-MTFSGNHDVSEMAFDAFKEAFKQAFQGKFDSYDVIQKLS---SLTQ 109

Query: 160 SINSETSLEKFAKISEFLTPYYLSSSAALDLFLTKLKPCLQKQL---GDAAFPMTLDIAL 216
               E  +  F +  + L P  LS+   ++LF+  LKP  +K L     ++F     +A+
Sbjct: 110 KDKIEAYVSTFNRYRKLLPPRSLSNDVLINLFIKGLKPNTRKDLRLRTVSSFYEATQLAI 169

Query: 217 LVAACEFAKGTS 228
               C +  G S
Sbjct: 170 RAEHCCYYPGIS 181

>KLLA0C10945g Chr3 (941764..942981) [1218 bp, 405 aa] {ON} similar
           to YLR015W, uniprot|P43132 Saccharomyces cerevisiae
           YLR015W (BRE2)
          Length = 405

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 46/87 (52%), Gaps = 8/87 (9%)

Query: 356 QHHLTNETPILDGNRSFPITTPAVASLAYDKVENIKNETNIHDEA---INDIPLSLASSN 412
           Q+++T +TP+    R+F +  P  A+L  DK++     T+  D++   + D    LA S 
Sbjct: 38  QYYITEDTPL--NKRNF-MYQPCAANLMLDKLKYCG--TDYFDKSSINLMDRSDKLAFSL 92

Query: 413 DFVKKSVAESMSWKSIRGNVGVPNSNV 439
           D    SV+E+  W+S+R +V +    +
Sbjct: 93  DDHSVSVSENCGWRSVRSDVCMKEGKI 119

>ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} similar
           to uniprot|P46680 Saccharomyces cerevisiae YMR092C AIP1
           Actin cortical patch component probable binding site on
           actin lies on front surface of subdomains 3 and 4
          Length = 606

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 58/145 (40%), Gaps = 15/145 (10%)

Query: 517 VTSVKVNKPSYFIDLEKP---QSMHNENRSVGLLAQKSYPLHNFAVRTRNARFNDRPSNY 573
           + S+ ++   +F  + K    +S+   N+ +  LA    PL + +   R   +N  PS  
Sbjct: 308 IISLSLDGTLHFFQVGKEGVVKSLKGHNKGITALAVN--PLVSGSFDGRVMTWNSEPSEM 365

Query: 574 TSAHGNL-----NAIHPLSLKINNIQCLSKPGKREADTNKEVNVPKMTVQEKGTVNSIIA 628
            S H NL     N+ HP    I     L   G  +     +  V ++   E      ++A
Sbjct: 366 HSDHTNLVLAIDNSKHPDYATIAWDDTLKVSGTAKHQFKDQPRVAQVASGE-----GVVA 420

Query: 629 KDNDGRSNSVENPFLGNTLNETKLN 653
               G S  + N F G  + ETKL+
Sbjct: 421 VVTTGESLLIINSFTGEVIQETKLS 445

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,485,060
Number of extensions: 3307219
Number of successful extensions: 12158
Number of sequences better than 10.0: 177
Number of HSP's gapped: 12676
Number of HSP's successfully gapped: 187
Length of query: 657
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 541
Effective length of database: 40,180,143
Effective search space: 21737457363
Effective search space used: 21737457363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)