Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_9.1052.287ON37137119500.0
YIL094C (LYS12)2.287ON37137118870.0
Skud_9.792.287ON37137118860.0
Smik_9.852.287ON37137118820.0
NCAS0B062502.287ON37337317280.0
NDAI0B035502.287ON37237217110.0
KNAG0A054202.287ON37237117100.0
TDEL0G021802.287ON36937116750.0
CAGL0G02585g2.287ON37237216450.0
ZYRO0A01914g2.287ON36837116250.0
KAFR0J013602.287ON37337215890.0
KLTH0G10384g2.287ON36737115880.0
SAKL0E07656g2.287ON36837115790.0
Kwal_27.115282.287ON36735315730.0
KLLA0E08339g2.287ON36937115620.0
Kpol_1003.392.287ON37037115510.0
TBLA0B059402.287ON36937215250.0
TPHA0C034102.287ON37137115220.0
Ecym_33262.287ON36635014300.0
ADL214C2.287ON36737113730.0
TPHA0D015602.278ON3603524821e-56
ADL223W2.278ON3623834812e-56
NDAI0C014105.473ON3693904761e-55
NCAS0B062902.278ON3593514724e-55
KLLA0F04103g2.278ON3613504724e-55
KLLA0E03125g5.473ON3683904682e-54
YNL037C (IDH1)2.278ON3603724663e-54
Smik_14.2902.278ON3603724663e-54
Ecym_33162.278ON3623504655e-54
Skud_14.2932.278ON3613724648e-54
SAKL0E07876g2.278ON3613824578e-53
Smik_15.3165.473ON3693604579e-53
NCAS0H022505.473ON4223904601e-52
Suva_8.1885.473ON3693534552e-52
Kpol_1039.352.278ON3593834542e-52
KNAG0B040705.473ON3733604552e-52
Kwal_23.50122.278ON3613704532e-52
AFR137C5.473ON3673664517e-52
KLTH0F15048g5.473ON3683904501e-51
TDEL0C038402.278ON3613794491e-51
NDAI0B035902.278ON3593514482e-51
Skud_15.3005.473ON3693904482e-51
CAGL0I07227g5.473ON3683664472e-51
Kpol_543.85.473ON3683604473e-51
Ecym_23135.473ON3703534463e-51
YOR136W (IDH2)5.473ON3693604455e-51
TPHA0J027705.473ON3763754457e-51
TBLA0B022405.473ON3733984431e-50
TBLA0B069102.278ON3653524412e-50
SAKL0G03520g5.473ON3693604412e-50
Kwal_55.212735.473ON3683534402e-50
CAGL0G02673g2.278ON3583824384e-50
KLTH0G10186g2.278ON3603504377e-50
ZYRO0D02838g2.278ON3613834369e-50
TDEL0A033705.473ON3713964361e-49
KAFR0B063705.473ON3783574361e-49
ZYRO0D11220g5.473ON3683524333e-49
Kpol_440.125.473ON3683604254e-48
KAFR0J014102.278ON3503514167e-47
TBLA0C015001.402ON3653723974e-44
KNAG0A052802.278ON3613503922e-43
TPHA0E014805.473ON3773603932e-43
Ecym_12961.402ON3633663774e-41
TDEL0B060001.402ON3623673741e-40
Kpol_1048.631.402ON3643653661e-39
KLLA0D04906g1.402ON3623673662e-39
NDAI0G042301.402ON3633683643e-39
AAL012C1.402ON3723703635e-39
Smik_3.661.402ON3643663601e-38
YCL018W (LEU2)1.402ON3643663601e-38
Skud_3.431.402ON3643663582e-38
KLTH0H12188g1.402ON3643643573e-38
Suva_14.3022.278ON3002933524e-38
KNAG0I012801.402ON4473703581e-37
CAGL0H03795g1.402ON3653663522e-37
ZYRO0E04796g1.402ON3623673503e-37
Suva_3.31.402ON3643643485e-37
Kwal_0.2251.402ON3643683452e-36
KAFR0I022001.402ON3653603409e-36
NCAS0C048701.402ON3653693251e-33
SAKL0D08690g1.402ON3643693215e-33
TPHA0B037301.402ON3653722996e-30
Kwal_23.42104.254ON4222971497e-10
Kpol_1055.784.254ON4272091443e-09
KAFR0H031601.396ON4211271433e-09
SAKL0D08426g1.396ON4112181434e-09
CAGL0H03663g1.396ON4182181417e-09
Smik_12.2351.396ON4122181409e-09
CAGL0D00770g4.254ON4231971391e-08
AAL022W1.396ON4151261391e-08
Ecym_13061.396ON4151921382e-08
ZYRO0E05016g1.396ON4111271382e-08
TPHA0B022104.254ON4331731382e-08
YNL009W (IDP3)1.396ON4202201372e-08
KNAG0I013201.396ON4121901363e-08
KLTH0H12012g1.396ON4131411363e-08
YLR174W (IDP2)1.396ON4122181363e-08
NCAS0A087201.396ON4131261353e-08
TBLA0C012901.396ON4181261354e-08
CAGL0B04917g1.396ON4112221344e-08
YDL066W (IDP1)4.254ON4281061345e-08
Skud_12.2391.396ON4122181345e-08
KNAG0H016701.396ON4241261336e-08
SAKL0H02860g4.254ON4212061336e-08
TDEL0B061001.396ON4141271337e-08
NDAI0D043604.254ON4241951328e-08
KLLA0B03355g4.254ON4292041329e-08
KAFR0I021301.396ON4081261311e-07
KAFR0G032604.254ON4212181301e-07
NCAS0A025104.254ON4262381302e-07
Suva_10.2711.396ON4122181302e-07
Skud_4.1894.254ON4291061302e-07
NDAI0G008501.396ON4191261292e-07
Kwal_0.1911.396ON4111271292e-07
NCAS0G036201.396ON4181961282e-07
Smik_14.3191.396ON4181261282e-07
Kpol_1048.701.396ON4191061283e-07
KNAG0D044104.254ON4281861273e-07
Suva_4.1844.254ON4291061273e-07
AER061C4.254ON4252511265e-07
Skud_14.3181.396ON4202191256e-07
Smik_4.1694.254ON4281061256e-07
TDEL0E011604.254ON4231971248e-07
ZYRO0B12496g4.254ON4222581248e-07
KLLA0F12342g1.396ON4151981248e-07
TPHA0B036601.396ON4221261231e-06
Suva_14.3391.396ON4171261221e-06
KLTH0D14476g4.254ON4202721221e-06
TBLA0A080104.254ON4281061177e-06
Ecym_32654.254ON4241341123e-05
Suva_14.303singletonON5350984e-05
NDAI0G051601.396ON4201221061e-04
TPHA0B018404.303ON20283721.3
KNAG0A037508.531ON83085722.3
NDAI0D046904.303ON20081692.8
KNAG0E012905.18ON119663713.0
KLLA0D02684g4.303ON20087693.1
KNAG0E038404.303ON20082683.8
KAFR0A053703.455ON120169704.6
ZYRO0G06798g8.188ON87742694.6
NCAS0A027604.303ON20082674.8
SAKL0G16786g4.303ON20082675.1
Smik_11.284.303ON20076666.7
Skud_15.4448.740ON26696677.0
TPHA0F009204.158ON30869677.4
ZYRO0A08162g2.379ON27259668.3
Suva_11.274.303ON20081659.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_9.105
         (371 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   755   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   731   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   731   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   729   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   670   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   663   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              663   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   649   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   638   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   630   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   616   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   616   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   612   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   610   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   606   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   602   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   592   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   590   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   555   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   533   0.0  
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   190   1e-56
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   189   2e-56
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   187   1e-55
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   186   4e-55
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   186   4e-55
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   184   2e-54
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   184   3e-54
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   184   3e-54
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   183   5e-54
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   183   8e-54
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   180   8e-53
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   180   9e-53
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    181   1e-52
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   179   2e-52
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   179   2e-52
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   179   2e-52
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   179   2e-52
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   178   7e-52
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   177   1e-51
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   177   1e-51
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   177   2e-51
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   177   2e-51
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   176   2e-51
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   176   3e-51
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   176   3e-51
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   176   5e-51
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   176   7e-51
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   175   1e-50
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            174   2e-50
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   174   2e-50
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   174   2e-50
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   173   4e-50
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   172   7e-50
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   172   9e-50
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   172   1e-49
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   172   1e-49
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   171   3e-49
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   168   4e-48
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   164   7e-47
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   157   4e-44
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              155   2e-43
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   155   2e-43
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   149   4e-41
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   148   1e-40
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   145   1e-39
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   145   2e-39
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   144   3e-39
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   144   5e-39
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   143   1e-38
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   143   1e-38
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   142   2e-38
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   142   3e-38
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   140   4e-38
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   142   1e-37
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             140   2e-37
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   139   3e-37
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      138   5e-37
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   137   2e-36
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   135   9e-36
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   129   1e-33
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   128   5e-33
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   119   6e-30
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    62   7e-10
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    60   3e-09
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    60   3e-09
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    60   4e-09
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    59   7e-09
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    59   9e-09
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    58   1e-08
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    58   1e-08
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    58   2e-08
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    58   2e-08
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    58   2e-08
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    57   2e-08
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    57   3e-08
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    57   3e-08
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    57   3e-08
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    57   3e-08
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    57   4e-08
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    56   4e-08
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    56   5e-08
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    56   5e-08
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    56   6e-08
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    56   6e-08
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    56   7e-08
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    55   8e-08
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    55   9e-08
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    55   1e-07
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    55   1e-07
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    55   2e-07
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    55   2e-07
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    55   2e-07
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     54   2e-07
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    54   2e-07
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    54   2e-07
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    54   2e-07
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    54   3e-07
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    54   3e-07
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    54   3e-07
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    53   5e-07
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    53   6e-07
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    53   6e-07
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    52   8e-07
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    52   8e-07
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    52   8e-07
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    52   1e-06
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    52   1e-06
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    52   1e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    50   7e-06
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    48   3e-05
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    42   4e-05
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    45   1e-04
TPHA0B01840 Chr2 complement(412955..413563) [609 bp, 202 aa] {ON...    32   1.3  
KNAG0A03750 Chr1 (487451..489943) [2493 bp, 830 aa] {ON} Anc_8.5...    32   2.3  
NDAI0D04690 Chr4 (1101865..1102467) [603 bp, 200 aa] {ON} Anc_4....    31   2.8  
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    32   3.0  
KLLA0D02684g Chr4 complement(228564..229166) [603 bp, 200 aa] {O...    31   3.1  
KNAG0E03840 Chr5 (760749..761351) [603 bp, 200 aa] {ON} Anc_4.30...    31   3.8  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...    32   4.6  
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    31   4.6  
NCAS0A02760 Chr1 (527535..528137) [603 bp, 200 aa] {ON} Anc_4.30...    30   4.8  
SAKL0G16786g Chr7 (1450325..1450927) [603 bp, 200 aa] {ON} highl...    30   5.1  
Smik_11.28 Chr11 complement(59718..60320) [603 bp, 200 aa] {ON} ...    30   6.7  
Skud_15.444 Chr15 complement(783770..784570) [801 bp, 266 aa] {O...    30   7.0  
TPHA0F00920 Chr6 (211280..212206) [927 bp, 308 aa] {ON} Anc_4.15...    30   7.4  
ZYRO0A08162g Chr1 (654330..655148) [819 bp, 272 aa] {ON} similar...    30   8.3  
Suva_11.27 Chr11 complement(60006..60608) [603 bp, 200 aa] {ON} ...    30   9.8  

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/371 (100%), Positives = 371/371 (100%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI
Sbjct: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY
Sbjct: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR
Sbjct: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ
Sbjct: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 361 QQVVDDVLSRL 371
           QQVVDDVLSRL
Sbjct: 361 QQVVDDVLSRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/371 (95%), Positives = 366/371 (98%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           MFRSVATR+SACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQ+LENLNSKHGLSFNFI
Sbjct: 1   MFRSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DLYAGFQTFQETGKALPDET+KVLK+QCQGALFGAVQSPTTKVEGYSSPIVALRREMGL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           ANVRPVKSVEG K KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADA KRISE+ATRR
Sbjct: 121 ANVRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IA IALDIAL+RLQTRG+ATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYGQIKYNEQ
Sbjct: 181 IATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDIAGKGIANPIATIRSTALMLEFLGHN+AAQDIYKAVDANLREG+I TPDLGGKAST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAST 360

Query: 361 QQVVDDVLSRL 371
           QQVVDDVLSRL
Sbjct: 361 QQVVDDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/371 (95%), Positives = 366/371 (98%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           MFRSVATR+SACRGLA+NAARKSLTIGLIPGDGIGKEVIPAGKQ+LENLNSKHGLSFNFI
Sbjct: 1   MFRSVATRVSACRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DLYAGFQTFQETGKALPDET+ VLK QCQGALFGAVQSPTTKVEGYSSPIVALRREMGL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           ANVRPVKSVEG+++KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADA KRISE+ATRR
Sbjct: 121 ANVRPVKSVEGSRNKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IA IALDIAL+RLQTRGEATLTVTHKSNVLSQ+DGLFREICK+VYESNKDKYGQIKYNEQ
Sbjct: 181 IATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDIAGKGIANPIATIRSTALMLEFLGHN AAQDIYKAVDANLREGAITTPDLGGKAST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 361 QQVVDDVLSRL 371
           QQVVDDVLSRL
Sbjct: 361 QQVVDDVLSRL 371

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/371 (94%), Positives = 365/371 (98%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           M RSVATR+S CRGLA+NAARKSLTIGLIPGDGIGKEVIPAGKQ+LENLNSKHGLSFNFI
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DLYAGFQTFQETGKALPDET+KVLK+QCQGALFGAVQSPTTKVEGYSSPIVALRREMGL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           ANVRPVKSVEG KDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADA KRISE+ATRR
Sbjct: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IA IA+DIAL+RLQTRGEATLTVTHKSNVLSQSDGLFREICK+VYESNKDKYGQIKYNEQ
Sbjct: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDIAGKGIANPIATIRSTALMLEFLGHN+AAQDIYKAVDANLREGAI TPDLGGKAST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360

Query: 361 QQVVDDVLSRL 371
           QQVV+DVLSRL
Sbjct: 361 QQVVEDVLSRL 371

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/373 (86%), Positives = 348/373 (93%), Gaps = 2/373 (0%)

Query: 1   MFRSVATRI--SACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFN 58
           M R+ A+R   S CR  A+NA RK+LTIGLIPGDGIGKEVIPAGKQ+LENLNSKHGL F+
Sbjct: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60

Query: 59  FIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMG 118
           FIDL AGFQTF +TGKALPDET++VLK QCQGALFGAVQSPTTKVEGYSSPIVALR+EMG
Sbjct: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120

Query: 119 LYANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVAT 178
           L+ANVRPVKSV GTKD+P+DMVIVRENTEDLYIKIEKTYIDKATGTRVA+A KRISE+AT
Sbjct: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180

Query: 179 RRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYN 238
           RRIA IALDIALQRL+  G+ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG I YN
Sbjct: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240

Query: 239 EQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPC 298
           EQIVDSMVYR+FREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPC
Sbjct: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300

Query: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKA 358
           HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDI++AV+AN+RE  I TPDLGG +
Sbjct: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360

Query: 359 STQQVVDDVLSRL 371
           +TQQV +DVL+RL
Sbjct: 361 TTQQVTEDVLARL 373

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/372 (84%), Positives = 352/372 (94%), Gaps = 1/372 (0%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           M R+ A+R++ CRG A+NA RK+LTIGLIPGDGIGKEVIPAGKQ+L+NLNSKHGL+F+FI
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DL AGFQTF +TGKALPDETI+VLK+QCQGALFGAVQSPTTKVEGYSSPIVALR+EMGLY
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTED-LYIKIEKTYIDKATGTRVADAIKRISEVATR 179
           ANVRPVKSVEGT DKP+DMVIVRENT   + IK+E+TYID+ATGTRVA+A KRISE+ATR
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 180 RIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNE 239
           RIA IALDIALQRL+T G+ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQI YNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCH 299
           QIVDSMVYR+FREPQCFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAS 359
           GSAPDIAGKGI+NPIATIRSTALMLEFLGHN+AAQDI++AV+ANL+E  + TPDLGGK++
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 360 TQQVVDDVLSRL 371
           TQ+V +DVL+RL
Sbjct: 361 TQEVTEDVLARL 372

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/371 (83%), Positives = 351/371 (94%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           M RS A +++ CRGLA+NAARKSLTIGLIPGDGIGKEVIPAGKQ+L++LN KHGL+F+FI
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DL AGFQTFQ+TGKALPDET+++LK++CQGALFGAVQSPTTKVEGYSSPIVALR+ MGLY
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           AN+RPVKSVEG+ ++P+DM+IVRENTEDLYIKIEKTYIDKATGTRVA+A KRISE+AT+R
Sbjct: 122 ANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQR 181

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IA IALDIALQRLQ  G+ATLTVTHKSNVLSQSDGLFRE+C+++YE+NKDKY  I YNEQ
Sbjct: 182 IATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQ 241

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           IVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCHG
Sbjct: 242 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 301

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDIAGKGIANPIATIRSTALMLEFLGHN+AAQDI+KAVDANLR+G + T DLGG A+T
Sbjct: 302 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNATT 361

Query: 361 QQVVDDVLSRL 371
           Q VVDD+L+RL
Sbjct: 362 QNVVDDILARL 372

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/371 (83%), Positives = 344/371 (92%), Gaps = 2/371 (0%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           M RS   R++  R  AS  A KS+ IGLIPGDGIGKEVIPAGKQ+LENL+ KHGL+F+FI
Sbjct: 1   MLRSAIGRLATRRAYAS--APKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DL AG+ TFQETGKALP++T++VLK+QCQGALFGAVQSPTTKVEGYSSPIVALR+E+GLY
Sbjct: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           ANVRPVKSVEGTKD+P+DMVIVRENTEDLYIK+EKTY+DKATGTRVA+A KRISEVATRR
Sbjct: 119 ANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRR 178

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IA IALDIALQRL+T G ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ+ YNEQ
Sbjct: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQ 238

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCHG
Sbjct: 239 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 298

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDIAGKGI+NPIATIRST LMLEFLGHN  AQDIY+AVDANLRE  + TPDLGG ++T
Sbjct: 299 SAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTT 358

Query: 361 QQVVDDVLSRL 371
           QQVV+D+LS+L
Sbjct: 359 QQVVEDILSKL 369

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/372 (82%), Positives = 342/372 (91%), Gaps = 1/372 (0%)

Query: 1   MFRSVATRISACRGLASN-AARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNF 59
           M R  ATR++A RG +S   A+K+LTIGLIPGDGIGKEVIPAGKQILE +  K  L F F
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60

Query: 60  IDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119
           IDL+AG++TFQ TGKALPDET++VL+  CQGALFGAVQSPTTKVEGYSSPIVALR+ MGL
Sbjct: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 120 YANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATR 179
           +ANVRPVK+VEGT D+P+DMVIVRENTEDLYIKIEKTY D ATGTRVA+A KRISEVATR
Sbjct: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180

Query: 180 RIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNE 239
           RIA IALDIALQRLQ+RG ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG+I+YNE
Sbjct: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240

Query: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCH 299
           QIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAS 359
           GSAPDIAG+GIANPIATIRSTALMLEFLG+ +AAQ IYKAVD+N+RE  I TPDLGGK++
Sbjct: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360

Query: 360 TQQVVDDVLSRL 371
           TQQVVDD+LS++
Sbjct: 361 TQQVVDDILSKI 372

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/371 (81%), Positives = 340/371 (91%), Gaps = 3/371 (0%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           MFRS   +++A R  +   A KS+ IGLIPGDGIGKEVIPAGKQ+LE L SKHGL F+FI
Sbjct: 1   MFRSSVAKVAARRAYS---APKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFI 57

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DL AG++ FQ+ GKALPD+T+KVLK+QCQGALFGAVQSPTTKV GYSSPIVALR+E+GLY
Sbjct: 58  DLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLY 117

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           ANVRPVKSVE   D+ +DM+IVRENTEDLYIK EKTY+D+ATGTRVA+AIKRISEVATR+
Sbjct: 118 ANVRPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRK 177

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IA IALDI+LQRL++RG ATLTVTHKSNVLSQSDGLFREICKDVYE NKDKYG++KYNEQ
Sbjct: 178 IATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQ 237

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCHG
Sbjct: 238 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 297

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDIAGKGI+NPIATIRSTALMLEFLGH + AQDIYKAVDANL +G + TPDLGGKA+T
Sbjct: 298 SAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATT 357

Query: 361 QQVVDDVLSRL 371
           QQVVDD+LS++
Sbjct: 358 QQVVDDILSKI 368

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/372 (79%), Positives = 335/372 (90%), Gaps = 2/372 (0%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           M RSV T+ +  R L++    KSLTIGLIPGDGIGKEVIPAGKQ+L+NL+S+HGL+FNFI
Sbjct: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DL AGFQTF +TGKALPDET+KVLK+QCQG LFGAVQSPTT+V+ YSSPIVALR+E+ LY
Sbjct: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120

Query: 121 ANVRPVKSVEGTKD-KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATR 179
           AN+RPVKSV G    KP+DMVIVRENTEDLYIKIEK+Y D+  G RVA+A KRI+EVATR
Sbjct: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179

Query: 180 RIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNE 239
           +IAKIALD+ALQRL+T G+ATLTVTHKSNVLSQSDGLFREICKDVY++NKDKY  I YNE
Sbjct: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239

Query: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCH 299
           QI+DSMVYR+FREP+ FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIV+GEPCH
Sbjct: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAS 359
           GSAPDIAGKGIANPIATIRSTALMLEFLGH +AAQDI+KAV++N+RE  I TPDLGG +S
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359

Query: 360 TQQVVDDVLSRL 371
           TQ VVDDVL +L
Sbjct: 360 TQNVVDDVLEKL 371

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/371 (80%), Positives = 339/371 (91%), Gaps = 4/371 (1%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           M R+  T++ A R  AS  A KSLTIGLIPGDGIGKEVIPAG+Q+LENL+SKHGL F+FI
Sbjct: 1   MLRASFTQL-ARRSYAS--ASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DL AG+QTFQETGKALPDETI +L++QCQGALFGAVQSPT KVEGYSSPIVALR+++GLY
Sbjct: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           ANVRPVKSV   +++P+DM+IVRENTEDLYIK EKTYID+ TGTRVA+AIKRISE AT+ 
Sbjct: 118 ANVRPVKSVL-PQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKN 176

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IA IAL+IALQR +  GEATLTVTHKSNVLSQSDGLFRE+C+ VYESNKDK+G IKYNEQ
Sbjct: 177 IANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQ 236

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           IVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG D V+GEPCHG
Sbjct: 237 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDIAGKGI+NP+ATIRSTALMLEF+GH +AAQDI+KAVDANLR+ +I TPDLGGK++T
Sbjct: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTT 356

Query: 361 QQVVDDVLSRL 371
           QQVV+DVLSR+
Sbjct: 357 QQVVEDVLSRM 367

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/371 (79%), Positives = 334/371 (90%), Gaps = 3/371 (0%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           M RS  ++  A R  AS  A K LTIGLIPGDGIGKEVIPAGK +LENL+SKH L FNFI
Sbjct: 1   MLRSTVSQF-ARRSYAS--AAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DL AG+QTF +TGKALPDETI++LK  CQGALFGAVQSPT KVEGYSSPIVALR+++GLY
Sbjct: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           ANVRPVKSV+GT D+P+DM+IVRENTEDLYIK EKTYID+ TGTRVA+AIKRISE AT  
Sbjct: 118 ANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTD 177

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IAKIAL+I+LQRL+  G+ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK++YG I YNEQ
Sbjct: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQ 237

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           IVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG D ++GEPCHG
Sbjct: 238 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHG 297

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDIAGKGI+NPIATIRSTALMLEF+G+ +AAQDI+KAVD N+RE  I TPDLGGK++T
Sbjct: 298 SAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357

Query: 361 QQVVDDVLSRL 371
           QQVVDD+LS++
Sbjct: 358 QQVVDDILSKM 368

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/353 (83%), Positives = 327/353 (92%), Gaps = 1/353 (0%)

Query: 19  AARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPD 78
           +A KSLTIGLIPGDGIG+EVIPAGK +LENL+SKHGL FNFIDL AG+QTF +TGKALPD
Sbjct: 16  SATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPD 75

Query: 79  ETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDKPID 138
           ETI +LK++CQGALFGAVQSPT KVEGYSSPIVALR+++GLYANVRPVKSV  +++KPID
Sbjct: 76  ETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVL-SQEKPID 134

Query: 139 MVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGE 198
           MVIVRENTEDLYIK EKTYID+ TGTRVA+AIKRISEVATR IA IAL+IALQR +  G 
Sbjct: 135 MVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGS 194

Query: 199 ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDV 258
           ATLTVTHKSNVLSQSDGLFREIC+ VYESN+DK+G I YNEQIVDSMVYRLFREP+CFDV
Sbjct: 195 ATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDV 254

Query: 259 IVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIR 318
           IVAPNLYGDILSDGAAALVGSLGVVPSANVG D V+GEPCHGSAPDIAGKGI+NP+ATIR
Sbjct: 255 IVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIR 314

Query: 319 STALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371
           STALMLEF+GH +AAQDI+KAVDANLR+  + TPDLGGK++TQQVVDDVLSR+
Sbjct: 315 STALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/371 (78%), Positives = 338/371 (91%), Gaps = 3/371 (0%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           M R+   ++S  R  ASNA  K+LTIGLIPGDGIGKEVIPAGK+ILE+LN K+GLSF FI
Sbjct: 1   MMRTRFIQLSR-RAYASNA--KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFI 57

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DL AG++TFQ TGKALPDETI +LK+QC+GALFGAVQSPTTKVEGYSSPIVALR+ +GL+
Sbjct: 58  DLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLF 117

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           ANVRPVKSV+GTKD+ +D+VIVRENTEDLYIK+EK+YID+ATGTRVADA KRI+E+AT+ 
Sbjct: 118 ANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKN 177

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IA IAL IA QRL+  G ATLTVTHKSNVLSQSDGLFRE+C++ YE+NKDKYG ++YNEQ
Sbjct: 178 IATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQ 237

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCHG
Sbjct: 238 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHG 297

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDIAGKGI+NPIATIRSTALMLEFLG+ + A+DI+KAVDAN+REG   TPDLGG ++T
Sbjct: 298 SAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTT 357

Query: 361 QQVVDDVLSRL 371
           QQV++DVLS+L
Sbjct: 358 QQVLEDVLSKL 368

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/371 (76%), Positives = 330/371 (88%), Gaps = 1/371 (0%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           M R+   R  A R +  N AR +LTIGLIPGDGIGKEVIPAGK++LE +  K+ + F FI
Sbjct: 1   MLRNGVYRACARRTVV-NGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DL+AG+QTF +TGKALPDET+ +LK QCQGALFGAVQSPTTKVEGYSSPIVALR+++GLY
Sbjct: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           AN+RPVKSV GT D+P+DMVIVRENTEDLYIK E+TYID+ATGT+VA+A KRISEVATR+
Sbjct: 120 ANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRK 179

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IAKIALDIALQRL+  G+ATLTVTHKSNVLSQSDGLFRE+C+DVYE NKD YG + YNEQ
Sbjct: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQ 239

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPDI+IGEPCHG
Sbjct: 240 IVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHG 299

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDI+G+GI+NP+ATIRS ALML+FLG+N+AA+DI  AVD N+R G I TPDLGG +ST
Sbjct: 300 SAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSST 359

Query: 361 QQVVDDVLSRL 371
            +V DD+LS+L
Sbjct: 360 TEVTDDILSKL 370

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/372 (76%), Positives = 328/372 (88%), Gaps = 4/372 (1%)

Query: 1   MFRSVATRISACRGLASNAAR-KSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNF 59
           M R+   + S     A NA+  K+LTIGLIPGDGIGKEVIPAGKQ+L+NLN KHGL+F F
Sbjct: 1   MLRTSVRQFSVS---ARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEF 57

Query: 60  IDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119
           IDL AG+QTF +TG ALP +T+ +LK++CQGALFGAVQSPTTKVEGYSSPIV LR+E+GL
Sbjct: 58  IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGL 117

Query: 120 YANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATR 179
           +ANVRPVK+VEGT  KPID+VIVRENTEDLYIKIEKTY D   G+R+A+A KRI+E AT+
Sbjct: 118 FANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATK 177

Query: 180 RIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNE 239
           RIAK ALDIALQRL+T+G ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK  Y  + YNE
Sbjct: 178 RIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNE 237

Query: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCH 299
           QIVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP+IVIGEPCH
Sbjct: 238 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCH 297

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAS 359
           GSAPDIAGKGIANPIATIRSTA MLE+LG+++ AQDIYKAVDAN+R+  I T DLGG ++
Sbjct: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357

Query: 360 TQQVVDDVLSRL 371
           TQQV+DD+L +L
Sbjct: 358 TQQVIDDILGKL 369

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/371 (77%), Positives = 324/371 (87%), Gaps = 1/371 (0%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           + RSV  R    R + + + + +LTIGLIPGDGIGKEVIP+G+Q+LE +  KHGL+FNFI
Sbjct: 2   LRRSVYNR-QFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           DL AG+QTF +TGKALP ET+K L++ C GALFGAVQSPTTKVEGYSSPIVALR+E+GLY
Sbjct: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           AN+RPVKSV+   +K +DMVIVRENTEDLYIK+EKTYID+ TGTRVADA KRISEVATRR
Sbjct: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IAKIALDIALQRL+  G   LTVTHKSNVLSQSDGLFRE+CK+V+ESNK  Y  I+YNEQ
Sbjct: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           I+DSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDIAGKGI+NPIATIRSTALMLEFLGH+ AAQDI  AVD+NLRE  I TPDLGGK ST
Sbjct: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360

Query: 361 QQVVDDVLSRL 371
             VV+DV+ RL
Sbjct: 361 SDVVNDVIRRL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/350 (75%), Positives = 309/350 (88%), Gaps = 1/350 (0%)

Query: 22  KSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETI 81
           KS TIGLIPGDGIGKEVIP G+++LE +  K+G+ F +IDL AG+QTF +TGKALPD+T+
Sbjct: 18  KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTV 77

Query: 82  KVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDKPIDMVI 141
           + L++ CQGALFGAVQSPTTKV+GYSSPIVALR+ +GLYAN+RPVKSV+GT D+P+D+VI
Sbjct: 78  EQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVI 137

Query: 142 VRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATL 201
            RENTEDLYIK E+TYIDK TG RVA+AIKRISE ATR IA IAL+IALQRL+ +G ATL
Sbjct: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197

Query: 202 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261
           TVTHKSNVLSQSDGLFREICK VY+SNK K+  ++YNEQIVDSMVYRLF+EPQCFDVIVA
Sbjct: 198 TVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVDSMVYRLFKEPQCFDVIVA 256

Query: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTA 321
           PNLYGDILSDGAAALVGSLGVVPS NVGP+IVIGEPCHGSAPDI G+GIANPIATIRS A
Sbjct: 257 PNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRSAA 316

Query: 322 LMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371
           L+LEFLG  +AA+ I K VD N+RE  I TPDLGG ++ +QV +D+LSR+
Sbjct: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/371 (68%), Positives = 314/371 (84%), Gaps = 4/371 (1%)

Query: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60
           M RS AT +      A+ A  K+LTIGLIPGDGIGKEVIPAG+++LE +  KH + F++ 
Sbjct: 1   MHRSSATSLIHK---ATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYE 57

Query: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
            L AG+QTF ETG ALP  T++ L+++CQGALFGAVQSPTTKVEGYSSPIVALRR++GLY
Sbjct: 58  HLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLY 117

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           AN+RPVKSV GT  +P+D+VIVRENTEDLY++ E+TY+D ATG RVA+AIKRISE AT R
Sbjct: 118 ANIRPVKSVSGT-GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATER 176

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IA+I+L +ALQR +  G   LTVTHKSNVLSQ+DGLF+E+C++VYE+NK  YG I+YNEQ
Sbjct: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQ 236

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300
           IVDSMVYRLF+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG +I+IGEPCHG
Sbjct: 237 IVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHG 296

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           SAPDIAG+GIANPIATIRS +LML+FLG  +AA DI +AV  NL++  + +PDLGGK +T
Sbjct: 297 SAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTT 356

Query: 361 QQVVDDVLSRL 371
           Q+V+DD+L+R+
Sbjct: 357 QEVLDDILARI 367

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  190 bits (482), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 131/352 (37%), Positives = 193/352 (54%), Gaps = 29/352 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNF--IDLYAGFQTFQETGKALPDETIK 82
           T+ LIPGDGIGKEV  +  +I     +  GL  ++  ID+  G     E  KA+  E++K
Sbjct: 30  TVTLIPGDGIGKEVTDSVVKIF----ASQGLPIDWERIDV-PGMSNENEVKKAV--ESLK 82

Query: 83  VLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDK--PIDMV 140
             K   +G     +   +    GY S  VALR+++ ++ANV   KS++G K K   +D+V
Sbjct: 83  RNKIGLKG-----IWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLV 137

Query: 141 IVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEAT 200
           ++RENTE  Y  +E   +       V +++K I++  T RIA+ A D AL+       +T
Sbjct: 138 VIRENTEGEYSGLEHESVPG-----VVESLKIITKPKTERIARFAFDFALEN----NRST 188

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIV 260
           +T  HK+N++  SDGLF+    +V E    +Y  IK N  IVD+   +   +P  FDV+V
Sbjct: 189 VTAVHKANIMKLSDGLFKNTVAEVGEK---EYPDIKVNTIIVDNASMQAVAKPHQFDVMV 245

Query: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CHGSAPDIAGKGIANPIATIRS 319
            P++YG IL +  AAL+G  G++P AN G +  + EP       DI  + IANP A I S
Sbjct: 246 TPSMYGTILGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMILS 305

Query: 320 TALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371
             LML  LG  + ++ I  AV A + EG  TT D+GG AST +  D V+ +L
Sbjct: 306 ATLMLNQLGLREESKRISNAVYAVIEEGKTTTKDIGGNASTTEFTDAVIDKL 357

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  189 bits (481), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 135/383 (35%), Positives = 203/383 (53%), Gaps = 36/383 (9%)

Query: 1   MFRSVATRISACRGLASNAARKSL---------TIGLIPGDGIGKEVIPAGKQILENLNS 51
           MFR+  + I+  RG A  A R+ L         T+ LIPGDGIGKEV  +  QI E  N 
Sbjct: 1   MFRNTLSHITK-RGYA--AGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENV 57

Query: 52  KHGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIV 111
              + +  ++L A  +  +   KA+  E++K    + +  L G   +P  +  G+ S  V
Sbjct: 58  P--VDWESVELSALEENHEGVQKAV--ESLK----RNKVGLKGIWHTPADQT-GHGSLNV 108

Query: 112 ALRREMGLYANVRPVKSVEGTKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADA 169
           A R+++ ++ANV   KS  G K K   +D+VI+RENTE  Y  +E   +       V ++
Sbjct: 109 AFRKQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPG-----VVES 163

Query: 170 IKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNK 229
           +K +++  + RIA+ A D AL+         +   HK+N++   DGLFR     V E   
Sbjct: 164 LKIMTKAKSERIARFAFDFALKN----NRKAVCAVHKANIMKLGDGLFRNT---VSEIGA 216

Query: 230 DKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG 289
            +Y ++  +  IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G
Sbjct: 217 KEYPEVNVSSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFG 276

Query: 290 PDIVIGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGA 348
            +  + EP C     DI G+ +ANP A I S+ LML  LG N+ A  I +A    + EG 
Sbjct: 277 REYAVFEPGCRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGK 336

Query: 349 ITTPDLGGKASTQQVVDDVLSRL 371
            TT D+GG A+T +  + V+ +L
Sbjct: 337 RTTKDIGGTATTTEFTNAVIDKL 359

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  187 bits (476), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 137/390 (35%), Positives = 203/390 (52%), Gaps = 40/390 (10%)

Query: 1   MFRSVATRISACRGLA-------------SNAARKSLTIGLIPGDGIGKEVIPAGKQILE 47
           MFR++  R +  R L+              N +    T+  I GDGIG E+  + KQI +
Sbjct: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60

Query: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYS 107
              +K  + +   D+   F     T   +P+  ++ +      AL G + +P  K  G+ 
Sbjct: 61  A--AKVPIDWEPCDVSPLFINGLTT---IPEPAVQSINKNLV-ALKGPLATPIGK--GHR 112

Query: 108 SPIVALRREMGLYANVRPVKSVEGTKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165
           S  + LR+  GL+ANVRP KS+EG K     +D+VI+RENTE  Y  IE           
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG----- 167

Query: 166 VADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY 225
           V  +IK I+  A+ R+ + A + A    +  G   + V HKS +   +DGLF ++ K++ 
Sbjct: 168 VVQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELS 223

Query: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGV 282
           +    +Y  I+   +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 224 Q----EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 283 VPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDA 342
            PSAN+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G N+ A  I KAV +
Sbjct: 280 TPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLS 339

Query: 343 NLREGAI-TTPDLGGKASTQQVVDDVLSRL 371
            +  G    T DL GKA+T    D V+ RL
Sbjct: 340 TIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  186 bits (472), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 189/351 (53%), Gaps = 26/351 (7%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKV 83
           +T+ L+PGDG+GKE+  +   I +  N    + +  +D+    Q   E G     E++K 
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQAENVP--IDWETVDIS---QLDHEDGVNAAVESLKR 83

Query: 84  LKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDK--PIDMVI 141
            K   +G     +   +    G+ S  VA R+++ +YANV   KS+ G K K   +D+VI
Sbjct: 84  NKIGLKG-----IWHTSADQVGHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLVI 138

Query: 142 VRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATL 201
           +RENTE  Y  +E   +       V +++K +++V + RIAK A D A++         +
Sbjct: 139 IRENTEGEYSGLEHESVPG-----VVESLKIVTKVNSERIAKFAFDFAMRH----DRKMV 189

Query: 202 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261
           T  HK+N++  SDGLFR     V E+    Y QIK +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDVMVT 245

Query: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CHGSAPDIAGKGIANPIATIRST 320
           P++YG IL +  AAL+G  G+VP  N G +  + EP       DI G+ +ANP A I S+
Sbjct: 246 PSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSS 305

Query: 321 ALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371
            L+L+ LG ND A  I KAV   ++EG  TT D+GG AST +    V+ +L
Sbjct: 306 TLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  186 bits (472), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 191/350 (54%), Gaps = 25/350 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           T+ LIPGDG+GKEV  +  +I EN N    + +  ID+ +G +  +   +A+  E++K  
Sbjct: 31  TVTLIPGDGVGKEVTDSVVKIFENENIP--IDWETIDI-SGLENTENVQRAV--ESLK-- 83

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDK--PIDMVIV 142
             + +  L G   +P  +  G+ S  VALR+++ ++ANV   KS+ G K +   IDMVI+
Sbjct: 84  --RNKVGLKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVII 140

Query: 143 RENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLT 202
           RENTE  Y  +E   +       V +++K ++   + RIA+ A D AL+        ++ 
Sbjct: 141 RENTEGEYSGLEHESVPG-----VVESLKIMTRAKSERIARFAFDFALKN----NRKSVC 191

Query: 203 VTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAP 262
             HK+N++   DGLFR    ++     ++Y ++     IVD+   +   +P  FDV+V P
Sbjct: 192 AVHKANIMKLGDGLFRNTVNEI---GANEYPELDVKNIIVDNASMQAVAKPHQFDVLVTP 248

Query: 263 NLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 321
           NLYG IL +  +AL+G  G+VP AN G +  + EP       DI G+ +ANP A I S+ 
Sbjct: 249 NLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSST 308

Query: 322 LMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371
           LML  LG N  A  I KA    + EG  TT D+GG AST +  + V+ +L
Sbjct: 309 LMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKL 358

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  184 bits (468), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 138/390 (35%), Positives = 202/390 (51%), Gaps = 41/390 (10%)

Query: 1   MFRSVATRISACRGLAS-------------NAARKSLTIGLIPGDGIGKEVIPAGKQILE 47
           MFR    + S CR LA+             N      T+  I GDG+G E+  + K I  
Sbjct: 1   MFRQSIVKQS-CRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59

Query: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYS 107
              +K  + +   D+   F     T   +PD  +  +      AL G + +P  K  G+ 
Sbjct: 60  A--AKVPIEWESCDVSPIFVNGLTT---IPDPAVASINKNLI-ALKGPLATPIGK--GHR 111

Query: 108 SPIVALRREMGLYANVRPVKSVEGTKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165
           S  + LR+  GL+ANVRP KS+EG K   + +++V++RENTE  Y  IE      A G  
Sbjct: 112 SLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVV---APG-- 166

Query: 166 VADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY 225
           V  +IK I++ A+ R+ + A + A    +    + + V HKS +   +DGLF ++ K + 
Sbjct: 167 VVQSIKLITQDASERVIRYAFEYA----RAVDRSKVLVVHKSTIQRLADGLFVDVAKKL- 221

Query: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGV 282
                +Y  I+   +++D+ V +  + P+ +D  V+V PNLYGDILSD  + L  GSLG+
Sbjct: 222 ---SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGL 278

Query: 283 VPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDA 342
            PSAN+G  + I E  HGSAPDIAG+  ANP A + S+ +ML  +G  + A  I KAV  
Sbjct: 279 TPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLT 338

Query: 343 NLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
            +   A   T DLGG AST    D V+ RL
Sbjct: 339 TIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  184 bits (466), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 200/372 (53%), Gaps = 26/372 (6%)

Query: 3   RSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDL 62
           R++AT   A R L      +  T+ LIPGDG+GKE+  + + I E  N    + +  I++
Sbjct: 9   RTLATAAQAERTLPKKYGGR-FTVTLIPGDGVGKEITDSVRTIFEAENIP--IDWETINI 65

Query: 63  YAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYAN 122
               QT  + G     E ++ LK    G L G   +P  +  G+ S  VALR+++ +YAN
Sbjct: 66  K---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYAN 117

Query: 123 VRPVKSVEGTKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           V   KS++G K +   ID++++RENTE  +  +E   +       V +++K ++   T R
Sbjct: 118 VALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPG-----VVESLKVMTRPKTER 172

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IA+ A D A    +     ++T  HK+N++   DGLFR I  ++    + +Y  I  +  
Sbjct: 173 IARFAFDFA----KKYNRKSVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSI 225

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CH 299
           IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D  + EP   
Sbjct: 226 IVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSR 285

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAS 359
               DI G+ +ANP A I S+ LML  LG N+ A  I KAV   + EG  TT D+GG +S
Sbjct: 286 HVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSS 345

Query: 360 TQQVVDDVLSRL 371
           T    ++++++L
Sbjct: 346 TTDFTNEIINKL 357

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  184 bits (466), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 199/372 (53%), Gaps = 26/372 (6%)

Query: 3   RSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDL 62
           R++AT   A R L      +  T+ LIPGDG+GKE+  + K I E    K  + +  +++
Sbjct: 9   RTLATAAQAERALPKKYGGR-FTVTLIPGDGVGKEITDSVKTIFEA--EKIPVDWETVNI 65

Query: 63  YAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYAN 122
               QT  + G     E ++ LK    G L G   +P  +  G+ S  VALR+++ +YAN
Sbjct: 66  K---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYAN 117

Query: 123 VRPVKSVEGTKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           V   KS++G K +   ID++++RENTE  +  +E   +       V +++K ++   T R
Sbjct: 118 VALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPG-----VVESLKIMTRPKTER 172

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IA+ A D A    +      +T  HK+N++   DGLFR I  ++    + +Y  I  +  
Sbjct: 173 IARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSI 225

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CH 299
           IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D  + EP   
Sbjct: 226 IVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSR 285

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAS 359
               DI G+ +ANP A I S+ LML  LG N+ A  I KAV   + EG  TT D+GG +S
Sbjct: 286 HVGLDIKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEGKHTTKDIGGSSS 345

Query: 360 TQQVVDDVLSRL 371
           T    ++++++L
Sbjct: 346 TTDFTNEIINKL 357

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  183 bits (465), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 186/350 (53%), Gaps = 24/350 (6%)

Query: 25  TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           T+ LIPGDG+GKEV  +   I E  N    + +  ++L    +  +   KA+  E++K  
Sbjct: 31  TVTLIPGDGVGKEVTDSVVNIFEAENVP--IDWESVELSGLEENMEGVQKAV--ESLKRN 86

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEG--TKDKPIDMVIV 142
           K   +G     + S      G+ S  VA R+++ ++ANV   KS  G  TK K +D+VI+
Sbjct: 87  KVGLKG-----IWSTPADQTGHGSLNVAFRKQLDIFANVALFKSFPGVKTKLKDVDLVII 141

Query: 143 RENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLT 202
           RENTE  Y  +E   +       V +++K +++  + RIA+ A D AL+        ++ 
Sbjct: 142 RENTEGEYSGLEHESVPG-----VVESLKIMTKAKSERIARFAFDFALKN----NRRSVC 192

Query: 203 VTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAP 262
             HK+N++   DGLFR    ++      +Y +++    IVD+   +   +P  FDV+V P
Sbjct: 193 AVHKANIMKLGDGLFRNTVNEI---GAKEYPELEVKSIIVDNASMQAVAKPHQFDVLVTP 249

Query: 263 NLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 321
           NLYG IL +  AAL+GS G+VP AN G +  + EP       DI G+ +ANP A I S+ 
Sbjct: 250 NLYGSILGNVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDIKGQDVANPTAMILSST 309

Query: 322 LMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371
           LML  LG ND A  I KA    + EG  TT D+GG AST Q    ++ +L
Sbjct: 310 LMLRHLGLNDYADRISKATYEVIAEGKHTTKDIGGHASTTQFTKAIVDKL 359

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  183 bits (464), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 201/372 (54%), Gaps = 26/372 (6%)

Query: 3   RSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDL 62
           R++AT   A R L      +  T+ LIPGDG+GKE+  + + I E    +  + +  I++
Sbjct: 9   RTLATAAQAERTLPKKYGGR-FTVTLIPGDGVGKEITDSVRTIFEA--ERIPVDWETINI 65

Query: 63  YAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYAN 122
               QT  + G     E ++ LK    G L G   +P  +  G+ S  VALR+++ +YAN
Sbjct: 66  K---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYAN 117

Query: 123 VRPVKSVEGTKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           V   KS++G K +   ID++++RENTE  +  +E   +       V +++K +++  T R
Sbjct: 118 VALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPG-----VVESLKVMTKPKTER 172

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           IA+ A D A    +      +T  HK+N++   DGLFR I  ++ ++   +Y  I  +  
Sbjct: 173 IARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQT---EYPDIDVSSI 225

Query: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CH 299
           IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D  + EP   
Sbjct: 226 IVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSR 285

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAS 359
               DI G+ +ANP A I S+ LML  LG N+ A  I KAV   + EG  TT D+GG +S
Sbjct: 286 HVGLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEGKHTTRDIGGSSS 345

Query: 360 TQQVVDDVLSRL 371
           T    ++V+++L
Sbjct: 346 TTDFTNEVINKL 357

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  180 bits (457), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 135/382 (35%), Positives = 200/382 (52%), Gaps = 35/382 (9%)

Query: 1   MFRSVATRISACRGLASNAARKSL--------TIGLIPGDGIGKEVIPAGKQILENLNSK 52
           MFR+  T   + R LA+ A  + L        T+ LIPGDG+GKEV  +   I E  N  
Sbjct: 1   MFRN--TFAVSKRSLATVATEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEAENVP 58

Query: 53  HGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVA 112
             + +  I++  G  + +   KA+  E++K    + +  L G   +P  +  G+ S  VA
Sbjct: 59  --IDWETINI-TGVDSEEGVQKAV--ESLK----RNKIGLKGIWHTPADQT-GHGSLNVA 108

Query: 113 LRREMGLYANVRPVKSVEGTKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAI 170
            R+++ ++ANV   K+V G K K   ID+V++RENTE  Y  +E   +       V +++
Sbjct: 109 FRKQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEYSGLEHESVPG-----VVESL 163

Query: 171 KRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKD 230
           K I++  + RIA+ A D AL+        ++   HK+N++   DGLFR    +V  S   
Sbjct: 164 KIITKAKSERIARFAFDFALKN----NRKSVCAVHKANIMKLGDGLFRNTVNEVGAS--- 216

Query: 231 KYGQIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
           +Y +I     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G 
Sbjct: 217 EYPEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGR 276

Query: 291 DIVIGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAI 349
           +  + EP       DI GK +ANP A I S+ LML  LG N  A  I KA    + EG  
Sbjct: 277 EYAVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEGKH 336

Query: 350 TTPDLGGKASTQQVVDDVLSRL 371
           TT D+GG +ST +    V+ +L
Sbjct: 337 TTKDIGGSSSTTEFTKSVIDKL 358

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  180 bits (457), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 129/360 (35%), Positives = 187/360 (51%), Gaps = 27/360 (7%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77
           N +    T+  I GDGIG E+  + K+I    N    + + F D+   F     T   +P
Sbjct: 31  NPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVP--IEWEFCDVNPIFVNGLTT---IP 85

Query: 78  DETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--K 135
           D  ++ +      AL G + +P  K  G+ S  + LR+  GL+ANVRP KSVEG K   +
Sbjct: 86  DPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYE 142

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195
            +D+V++RENTE  Y  IE           V  +IK I+  A+ R+ + A + A    + 
Sbjct: 143 NVDLVLIRENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RA 193

Query: 196 RGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255
            G   + V HKS +   +DGLF  + K++      +Y  I    +++D+ V ++   P  
Sbjct: 194 IGRPRVIVVHKSTIQRLADGLFVNVAKEL----SKEYPDITLETELIDNSVLKVVTNPSA 249

Query: 256 FD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIAN 312
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  I I E  HGSAPDIAG+  AN
Sbjct: 250 YTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKAN 309

Query: 313 PIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
           P A + S+ +ML  +G  + A  I  AV + +  G    T DL G A+T    + V+ RL
Sbjct: 310 PTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  181 bits (460), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 133/390 (34%), Positives = 198/390 (50%), Gaps = 40/390 (10%)

Query: 1   MFRSVATRISACRGLA-------------SNAARKSLTIGLIPGDGIGKEVIPAGKQILE 47
           MFRS   R +  R L+              N +    T+  I GDGIG E+  + KQI  
Sbjct: 54  MFRSSILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS 113

Query: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYS 107
              +K  + +   D+      F +    +P+  ++ +      AL G + +P  K  G+ 
Sbjct: 114 A--AKVPIEWETCDVTP---LFIDGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHR 165

Query: 108 SPIVALRREMGLYANVRPVKSVEGTKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTR 165
           S  + LR+  GL+ANVRP +SV+G K     +D+V++RENTE  Y  IE           
Sbjct: 166 SLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPG----- 220

Query: 166 VADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY 225
           V  +IK I+  A+ R+ + A +      +  G   L V HKS +   SDGLF  + K++ 
Sbjct: 221 VVQSIKLITREASERVIRYAFEYC----RAIGRPRLVVVHKSTIQRLSDGLFVNVAKEL- 275

Query: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGV 282
                +Y  I++  +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 276 ---SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGL 332

Query: 283 VPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDA 342
            PS N+G +I I E  HGSAPDIAGK +ANP A + S+ +ML  +G +  A  I  AV +
Sbjct: 333 TPSGNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLS 392

Query: 343 NLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
            +  G  + T DL G A+T    D V+ +L
Sbjct: 393 TIASGPESRTGDLAGTATTSTFTDAVIKKL 422

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  179 bits (455), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/353 (35%), Positives = 185/353 (52%), Gaps = 27/353 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           T+  I GDGIG E+  + K+I    +    +++ F D+   F     T   +PD  ++ +
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFSAADVP--INWEFCDVNPIFVNGLTT---IPDPAVQSI 92

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--KPIDMVIV 142
                 AL G + +P  K  G+ S  + LR+  GL+ANVRP KS+EG K   + +D+V++
Sbjct: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149

Query: 143 RENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLT 202
           RENTE  Y  IE           V  +IK I+  A+ R+ + A + A    +  G   + 
Sbjct: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITREASERVIRYAFEYA----RAIGRPRII 200

Query: 203 VTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIV 260
           V HKS +   +DGLF  + K++      +Y  I +  +++D+ V  +   P  +   V V
Sbjct: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256

Query: 261 APNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRS 319
            PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAGK  ANP A + S
Sbjct: 257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLS 316

Query: 320 TALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
           + +ML  +G    A  I  AV + +  G    T DL G A+T    + V+ RL
Sbjct: 317 SVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  179 bits (454), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 128/383 (33%), Positives = 207/383 (54%), Gaps = 39/383 (10%)

Query: 1   MFRSVATRISACRGLASNAARKSL---------TIGLIPGDGIGKEVIPAGKQILENLNS 51
           MFR++ ++    R   S A+R+++         T+ L+PGDG+G+E+  +   I E  N 
Sbjct: 1   MFRNLISK----RAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENL 56

Query: 52  KHGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIV 111
              + +  ++L +G +  ++   A+  E++K  K   +G     +   +   +G++S  V
Sbjct: 57  P--IDWERVEL-SGLEQ-EDVHTAV--ESLKRNKIGLKG-----IWHTSADHDGHTSWNV 105

Query: 112 ALRREMGLYANVRPVKSVEG--TKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADA 169
           ALR+E+ +YANV   KS +G  T+   +D+VI+RENTE  Y  +E   +       V ++
Sbjct: 106 ALRKELDIYANVAIFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPG-----VVES 160

Query: 170 IKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNK 229
           +K ++   T RIA+ A D A++        ++T  HK+N++   DGLFR +   V E   
Sbjct: 161 LKIMTAQKTERIARFAFDYAMKY----NRKSVTAVHKANIMKLGDGLFRNL---VTEIGA 213

Query: 230 DKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG 289
            +Y ++  +  IVD+   +   +P  FDV+VAP++YG IL +  AAL+G  G+VP AN G
Sbjct: 214 KEYPEVGVSSIIVDNASMQAVAKPHQFDVMVAPSMYGTILGNIGAALIGGPGLVPGANYG 273

Query: 290 PDIVIGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGA 348
            D  + EP       DI  + IANP A I S  LML  LG  + A  I KAV   + EG 
Sbjct: 274 RDYAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEGK 333

Query: 349 ITTPDLGGKASTQQVVDDVLSRL 371
            TT D+GG A+T +  + V+++L
Sbjct: 334 TTTRDIGGSATTTEFTNAVIAKL 356

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  179 bits (455), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 130/360 (36%), Positives = 190/360 (52%), Gaps = 27/360 (7%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77
           N A     +  I GDGIG E+  + K I +   ++  +++ F D+   F     T   +P
Sbjct: 35  NPATGKFDVSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVTPIFVNGLTT---IP 89

Query: 78  DETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--K 135
           D  +  +      AL G + +P  K  G+ S  + LR+   L+ANVRP KS+EG K    
Sbjct: 90  DPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYS 146

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195
            +D+V++RENTE  Y  IE      A G  V  +IK I+  A+ R+ + A + A    + 
Sbjct: 147 DVDLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITRDASERVIRYAFEYA----KA 197

Query: 196 RGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255
            G   + V HKS +   +DGLF  + K++ +    +Y +IK   +++D+ V  +   P  
Sbjct: 198 IGRPRVVVVHKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAG 253

Query: 256 FD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIAN 312
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  AN
Sbjct: 254 YTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQNKAN 313

Query: 313 PIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
           P A + S+ +ML  +G  D A  I +AV   +   +   T DLGG A+T    D V+  L
Sbjct: 314 PTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  179 bits (453), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/370 (34%), Positives = 198/370 (53%), Gaps = 33/370 (8%)

Query: 13  RGLASNAARKSL--------TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYA 64
           R LA+ AA + L        T+ LIPGDG+GKEV  +   I E+ N    + +  +++ +
Sbjct: 11  RSLATMAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIP--IDWETVEI-S 67

Query: 65  GFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVR 124
           G    +   KA+  E++K    + +  L G   +P+ +  G+ S  VALR+++ ++ANV 
Sbjct: 68  GLDNQEGVQKAV--ESLK----RNKVGLKGIWHTPSDQT-GHGSLNVALRKQLDIFANVA 120

Query: 125 PVKSVEG--TKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIA 182
             KSV G  ++   +DMV++RENTE  Y  +E   +       V +++K +++  + RI 
Sbjct: 121 LFKSVPGVPSRHSNVDMVVIRENTEGEYSGLEHESVPG-----VVESLKIMTKAKSERIG 175

Query: 183 KIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIV 242
           + A D A++        ++   HK+N++   DGLFR    +V      +Y +I     IV
Sbjct: 176 RFAFDFAVKN----NRKSVCAVHKANIMKLGDGLFRNCINEV---GAKEYPEIDVKNIIV 228

Query: 243 DSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CHGS 301
           D+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G +  + EP     
Sbjct: 229 DNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHV 288

Query: 302 APDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQ 361
             DI G+ +ANP A I S++LML  LG N  A  I KA    + E   TT D+GG AST 
Sbjct: 289 GLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAEAKTTTQDIGGSASTT 348

Query: 362 QVVDDVLSRL 371
           +  + ++S+L
Sbjct: 349 EFTEAIISKL 358

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  178 bits (451), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 131/366 (35%), Positives = 193/366 (52%), Gaps = 40/366 (10%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFID----LYAGFQTFQETG 73
           NAA K  T+  I GDG+G E+  + K I    +    + + + D    L  G  T  E  
Sbjct: 30  NAAGK-YTVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLLVNGLTTIPEPA 86

Query: 74  KALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTK 133
            A  ++ +  LK        G + +P  K  G+ S  + LR+  GL+ANVRP KS+EG K
Sbjct: 87  VASINKNLVALK--------GPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYK 136

Query: 134 D--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQ 191
                +D+V++RENTE  Y  IE           V  +IK I+  A+ R+ + A + A  
Sbjct: 137 TTYSDVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITREASERVIRYAFEYA-- 189

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
             +T G   + V HKS +   +DGLF  + +++      +Y  I+   +++D+ V  +  
Sbjct: 190 --RTVGRPKVVVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVT 243

Query: 252 EPQCFDVIVA--PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGK 308
           +P+ +  +VA  PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+
Sbjct: 244 KPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPDIAGQ 303

Query: 309 GIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANL---REGAITTPDLGGKASTQQVVD 365
             ANP A + S+ +ML  +G ++ A  I KAV + +   RE    T DL G AST    +
Sbjct: 304 NRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTASTSSFTN 361

Query: 366 DVLSRL 371
            V+ RL
Sbjct: 362 AVIERL 367

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  177 bits (450), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 139/390 (35%), Positives = 202/390 (51%), Gaps = 41/390 (10%)

Query: 1   MFRSVATRISACRGLAS-------------NAARKSLTIGLIPGDGIGKEVIPAGKQILE 47
           MF+S   R SA R LA+             + A    T+  I GDG+G E+  A K I  
Sbjct: 1   MFKSSFVRNSA-RFLATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59

Query: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYS 107
              +K  + +   D+   F     T      ++I    ++   AL G + +P  K  G+ 
Sbjct: 60  A--AKAPIQWESCDVSPLFINGLTTIPQPAQDSI----NKNLIALKGPLATPIGK--GHR 111

Query: 108 SPIVALRREMGLYANVRPVKSVEGTKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTR 165
           S  + LR+  GL+ANVRP KSV+G K     +D+V++RENTE  Y  IE           
Sbjct: 112 SLNLTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHV-----VSPG 166

Query: 166 VADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY 225
           V  +IK I++ A+ R+ + A + A  R   R +  + V HKS +   +DGLF  + + + 
Sbjct: 167 VVQSIKLITQDASERVIRYAFEYA--RAVERPK--VVVVHKSTIQRLADGLFVSVAEQLS 222

Query: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGV 282
           +    +Y  I+   +++D+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG+
Sbjct: 223 K----EYPDIELQTELIDNTVLHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGL 278

Query: 283 VPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDA 342
            PSAN+G  + I E  HGSAPDIAG+  ANP A + S+ +ML  +G  + A  I KAV  
Sbjct: 279 TPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFT 338

Query: 343 NLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
            +  G  + T DLGG AST    + V+SRL
Sbjct: 339 TIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  177 bits (449), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 133/379 (35%), Positives = 192/379 (50%), Gaps = 29/379 (7%)

Query: 1   MFRS-VATRISACRGLASNAARKS----LTIGLIPGDGIGKEVIPAGKQILENLNSKHGL 55
           M RS V  R+ A    A     K       + LIPGDG+GKEV  +   I E  N    +
Sbjct: 1   MLRSAVGKRMFASVAAAEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENLP--I 58

Query: 56  SFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRR 115
            ++ +D+ +G     E G     +++K    + +  L G   +      G  S  VALR+
Sbjct: 59  DWDRVDI-SGLD--HEEGVQAAVDSLK----RNKIGLKGIWHTSAADQAGKGSLNVALRK 111

Query: 116 EMGLYANVRPVKSVEGTKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRI 173
           E+ +YANV   KSV G K K   +D+V++RENTE  Y  +E   +       V +++K +
Sbjct: 112 ELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPG-----VVESLKIM 166

Query: 174 SEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYG 233
           +E  T RIA+ A D A    +      +T  HK+N++   DGLFR +   V E    +Y 
Sbjct: 167 TEDKTERIARFAFDFA----KKYNRHAVTAVHKANIMKLGDGLFRNVVTRVGEQ---EYP 219

Query: 234 QIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIV 293
            +K    IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +  
Sbjct: 220 DVKVGSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGREYA 279

Query: 294 IGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTP 352
           + EP       DI  K IANP A I S +LML+ LG + +A  I  AV   + EG  TTP
Sbjct: 280 VFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEGKSTTP 339

Query: 353 DLGGKASTQQVVDDVLSRL 371
           D+GG AST +    V+ +L
Sbjct: 340 DIGGSASTTEFTQAVIEKL 358

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 122/351 (34%), Positives = 189/351 (53%), Gaps = 25/351 (7%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKV 83
            T+ L+PGDG+GKE+  +   I ++ N    + +  +D+     T  E  KA  D     
Sbjct: 28  FTVTLLPGDGVGKEITDSVVSIFKSENVP--IDWETVDISGLDHT--EGVKAAVDS---- 79

Query: 84  LKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDK--PIDMVI 141
           LK    G L G   +P  +V G+ S  VA R+++ +YANV   KS+EG K K   +D+V+
Sbjct: 80  LKRNKIG-LKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 142 VRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATL 201
           +RENTE  Y  +E   +       V +++K I++  + RIA+ A D A    +     ++
Sbjct: 138 IRENTEGEYSGLEHESVPG-----VVESLKIITKSKSERIARFAFDFA----KRNNRKSV 188

Query: 202 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261
           T  HK+N++  SDGLFR     + E   ++Y +I+ +  IVD+   +   +P  FDV+V 
Sbjct: 189 TAVHKANIMKLSDGLFRNTVSKIGE---EEYPEIQTSSIIVDNASMQAVAKPHQFDVMVT 245

Query: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CHGSAPDIAGKGIANPIATIRST 320
           P++YG I+ +  AAL+G  G+VP  N G D  + EP       DI G+ +ANP A + S 
Sbjct: 246 PSMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSA 305

Query: 321 ALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371
            L+L+ LG   +A  I  AV   + EG  TT D+GG AST +    V+++L
Sbjct: 306 TLLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 135/390 (34%), Positives = 198/390 (50%), Gaps = 40/390 (10%)

Query: 1   MFRSVATRISACRGLAS-------------NAARKSLTIGLIPGDGIGKEVIPAGKQILE 47
           M RS   R ++ R LA+             N +    T+  I GDGIG E+  + K+I  
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60

Query: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYS 107
             N    + +   D+   F     T   +PD  ++ + +    AL G + +P  K  G+ 
Sbjct: 61  AANVP--IEWESCDVNPIFVNGLTT---IPDAAVQSITNNLI-ALKGPLATPIGK--GHR 112

Query: 108 SPIVALRREMGLYANVRPVKSVEGTKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165
           S  + LR+  GL+ANVRP KSVEG K   + +D+V++RENTE  Y  IE           
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167

Query: 166 VADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY 225
           V  +IK I+  A+ R+ + A + A    +  G   + V HKS +   +DGLF  + K++ 
Sbjct: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELS 223

Query: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGV 282
           +    +Y  I    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 224 K----EYPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 283 VPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDA 342
            PSAN+G  I I E  HGSAPDIAG+  ANP A + S+ +ML  +G  + A  I  AV +
Sbjct: 280 TPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLS 339

Query: 343 NLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
            +  G    T DL G A+T    + V+ RL
Sbjct: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  176 bits (447), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 127/366 (34%), Positives = 186/366 (50%), Gaps = 39/366 (10%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQT------FQE 71
           N +    T+  I GDGIG E+  + K+I           F   D+   ++T      F  
Sbjct: 30  NPSTGKFTVSFIEGDGIGPEISSSVKRI-----------FQAADVPVEWETCDVTPIFVN 78

Query: 72  TGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEG 131
               +PD  ++ +      AL G + +P  K  G+ S  + LR+   L+ANVRP KS+EG
Sbjct: 79  GLTTIPDPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEG 135

Query: 132 TKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIA 189
            K   + +D+V++RENTE  Y  IE           V  +IK I+  A+ R+ + A + A
Sbjct: 136 FKTTYENVDLVLIRENTEGEYSGIEHL-----VSPGVVQSIKLITRDASERVIRYAYEYA 190

Query: 190 LQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRL 249
               +  G   L V HKS +   +DGLF  + K++      +Y  I+   +++D+    +
Sbjct: 191 ----RAIGRPRLIVVHKSTIQRLADGLFVNVAKEL----AAEYPDIQLETELIDNTCLNV 242

Query: 250 FREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIA 306
              P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIA
Sbjct: 243 VSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIA 302

Query: 307 GKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGA-ITTPDLGGKASTQQVVD 365
           G+  ANP A + S+ +ML  +G  + A  I KAV   +  G+   T DLGG AST    D
Sbjct: 303 GQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTD 362

Query: 366 DVLSRL 371
            ++ +L
Sbjct: 363 AIIKKL 368

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  176 bits (447), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 190/360 (52%), Gaps = 27/360 (7%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77
           + A    T+  I GDG+G E+  + K+I     +K  + +   D+   F   Q T   +P
Sbjct: 30  DPATGKFTVPFIEGDGVGPEISESVKKIFSA--AKVPIEWVPCDVGPIFVNGQTT---IP 84

Query: 78  DETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--K 135
           +  ++++      AL G + +P  K  G+ S  + LR+   L+ANVRP +S+   K   +
Sbjct: 85  EPAVELINKHLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKSTYE 141

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195
            +D+V++RENTE  Y  IE           V  +IK I+  AT R+ + A +      Q 
Sbjct: 142 NVDLVLIRENTEGEYSGIEHVITPG-----VIQSIKLITREATERVVRYAFEYT----QA 192

Query: 196 RGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255
            G   L V HKS +   +DGLF ++ +++      +Y  IK   +I+D  +  +  +P+ 
Sbjct: 193 IGRPRLLVIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEIIDKSILNVVSKPEL 248

Query: 256 FD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIAN 312
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  AN
Sbjct: 249 YSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKAN 308

Query: 313 PIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
           P A + S+ +ML+ +G ++ A  I  AV   +  G+   T DL G AST    ++V+ RL
Sbjct: 309 PTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  176 bits (446), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 187/353 (52%), Gaps = 27/353 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           T+  I GDGIG E+  + K I     +K  + + + D+   F     T   +PD  ++ +
Sbjct: 39  TVSFIEGDGIGPEISQSVKDIFSA--AKVPVEWEYCDVTPIFINGLTT---IPDPAVQSI 93

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--KPIDMVIV 142
                 AL G + +P  K  G+ S  + LR+  GL+ANVRP KS+EG K   + +D+V++
Sbjct: 94  NKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 150

Query: 143 RENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLT 202
           RENTE  Y  IE           V  +IK I+  A+ R+ + A + A    +  G   + 
Sbjct: 151 RENTEGEYSGIEHV-----VSPGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVV 201

Query: 203 VTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIV 260
           V HKS +   +DGLF  + ++V      +Y  I+   +++D+ V  +  +P+ +   V V
Sbjct: 202 VVHKSTIQRLADGLFVNVAQEV----GKEYPDIELQPELIDNTVLNVVSKPEKYSDSVAV 257

Query: 261 APNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRS 319
            PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 258 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLS 317

Query: 320 TALMLEFLGHNDAAQDIYKAVDANL-REGAITTPDLGGKASTQQVVDDVLSRL 371
           + +ML  +G ++ A  I  AV A +  +    T DL G A+T      V+ RL
Sbjct: 318 SVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  176 bits (445), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 126/360 (35%), Positives = 186/360 (51%), Gaps = 27/360 (7%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77
           N +    T+  I GDGIG E+  + K+I    N    + +   D+   F     T   +P
Sbjct: 31  NPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVP--IEWESCDVSPIFVNGLTT---IP 85

Query: 78  DETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--K 135
           D  ++ +      AL G + +P  K  G+ S  + LR+  GL+ANVRP KS+EG K   +
Sbjct: 86  DPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195
            +D+V++RENTE  Y  IE           V  +IK I+  A+ R+ + A + A    + 
Sbjct: 143 NVDLVLIRENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERVIRYAFEYA----RA 193

Query: 196 RGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255
            G   + V HKS +   +DGLF  + K++      +Y  +    +++D+ V ++   P  
Sbjct: 194 IGRPRVIVVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSA 249

Query: 256 FD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIAN 312
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  I I E  HGSAPDIAG+  AN
Sbjct: 250 YTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKAN 309

Query: 313 PIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
           P A + S+ +ML  +G  + A  I  AV + +  G    T DL G A+T    + V+ RL
Sbjct: 310 PTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  176 bits (445), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 193/375 (51%), Gaps = 27/375 (7%)

Query: 3   RSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDL 62
           RS++ + +  R      +  + T+  I GDG+G E+  + K I    N    + +   D+
Sbjct: 23  RSISNQPTIGRFTGKTNSSGTYTVPFIEGDGVGPEISKSVKDIFSAANVP--IQWQPCDV 80

Query: 63  YAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYAN 122
              F     T   +P+  +K +K+    AL G + +P  K  G+ S  + LR+   L+AN
Sbjct: 81  GPIFVNGLTT---IPEPAVKAIKESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFAN 134

Query: 123 VRPVKSVEGTKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           VRP KSV   K   + +D+V++RENTE  Y  IE           V  +IK I+  A+ +
Sbjct: 135 VRPAKSVPNYKSTYENVDLVLIRENTEGEYSGIEHIVTPG-----VVQSIKLITREASEK 189

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240
           + + A + A+      G   L V HKS +    DGLF +I  ++    + +Y  IK   Q
Sbjct: 190 VIRYAYEYAI----AVGRPRLIVVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQ 241

Query: 241 IVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEP 297
           I+D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E 
Sbjct: 242 ILDNTVLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEA 301

Query: 298 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGG 356
            HGSAPDIAG+  ANP A + S+ +ML  +G  + A  I  AV + +  G  + T DLGG
Sbjct: 302 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGG 361

Query: 357 KASTQQVVDDVLSRL 371
            A+T    + V+ +L
Sbjct: 362 SATTSSFTECVIKKL 376

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  175 bits (443), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 131/398 (32%), Positives = 205/398 (51%), Gaps = 52/398 (13%)

Query: 1   MFRSVATRISACRGLAS-----------------NAARKSLTIGLIPGDGIGKEVIPAGK 43
           M R++A + SA R  ++                 N +    T+  I GDG+G E+  + K
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 44  QILENLNSKHGLSFNFID----LYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSP 99
            I +   ++  + + + D    L  G  T       +P+  ++ + ++ + AL G + +P
Sbjct: 61  DIFKA--AQVPVDWEYCDVSPLLINGLTT-------IPEPAVQQI-NKHKIALKGPLATP 110

Query: 100 TTKVEGYSSPIVALRREMGLYANVRPVKSVEG--TKDKPIDMVIVRENTEDLYIKIEKTY 157
             K  G+ S  + LR+  GL+ANVRP +S+ G  T  K +D+V++RENTE  Y  IE   
Sbjct: 111 IGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV 168

Query: 158 IDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLF 217
              A G  V  +IK I+  A+ R+ + A + A    +  G   L V HKS +   +DGLF
Sbjct: 169 ---APG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLF 219

Query: 218 REICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAA 275
             I K++      ++  IK   +++D+ V  + R+P  +   V V PNLYGDILSD  + 
Sbjct: 220 VNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSG 275

Query: 276 L-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQ 334
           L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML ++G    + 
Sbjct: 276 LSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSN 335

Query: 335 DIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
            I  A+   +  G+   T DL G A+T    + V+  L
Sbjct: 336 KIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  174 bits (441), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/352 (34%), Positives = 191/352 (54%), Gaps = 29/352 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQIL--ENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIK 82
           T+ LIPGDG+GKEV  +   I   ENL     + +  +D+ +G     E G      ++K
Sbjct: 35  TVTLIPGDGVGKEVTDSVVSIFNAENLP----IDWERVDI-SGLD--HEEGVEAAVNSLK 87

Query: 83  VLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDK--PIDMV 140
             K   +G     +   +     + S  VALR+++ +YANV   K++ G K +   +D+V
Sbjct: 88  RNKIGLKG-----IWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLV 142

Query: 141 IVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEAT 200
           I+RENTE  Y  +E   +       V +++K I++  + RIA+ A D A +R   +    
Sbjct: 143 IIRENTEGEYSGLEHESVPG-----VVESLKIITKEKSERIARFAFDFA-KRFDRK---L 193

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIV 260
           +T  HK+N++   DGLFR     + E+   +Y  IK +  IVD+   +   +P  FDV+V
Sbjct: 194 VTAVHKANIMKLGDGLFRNSVTSIGET---EYPDIKVSSIIVDNASMQSVAKPHQFDVLV 250

Query: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CHGSAPDIAGKGIANPIATIRS 319
            P++YG IL +  AAL+G  G+VP AN G +  + EP       DI G+ +ANP A I S
Sbjct: 251 TPSMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILS 310

Query: 320 TALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371
           + L+L+ LG N+ A+ I  AV   + EG +TT D+GG AST +  ++++ +L
Sbjct: 311 STLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  174 bits (441), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 127/360 (35%), Positives = 186/360 (51%), Gaps = 27/360 (7%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77
           N +    T+  I GDG+G E+  + K I     ++  + +   D+   F     T   +P
Sbjct: 31  NPSTGKYTVSFIEGDGVGPEISKSVKDIFA--AAEVPVEWESCDVTPLFINGLTT---IP 85

Query: 78  DETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--K 135
              +  +      AL G + +P  K  G+ S  + LR+  GL+ANVRP KSVEG K   +
Sbjct: 86  QPAVDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYE 142

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195
            +D+V++RENTE  Y  IE           V  +IK I+  A+ R+ + A + A    + 
Sbjct: 143 NVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITRDASERVIRYAFEYA----RA 193

Query: 196 RGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255
            G   + V HKS +   +DGLF ++ K++      +Y  I+   Q++D+ V  +   P  
Sbjct: 194 VGRPKVMVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGA 249

Query: 256 F--DVIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIAN 312
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  AN
Sbjct: 250 YADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKAN 309

Query: 313 PIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
           P A + S+ +ML  +G  + A  I KAV + +  G    T DL G AST    + V+ RL
Sbjct: 310 PTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  174 bits (440), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 191/353 (54%), Gaps = 27/353 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           T+  I GDG+G E+  A K I     +K  + +   D+   F     T      ++I   
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWETCDVTPLFINGLTTIPQPAQDSI--- 91

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDK--PIDMVIV 142
            ++   AL G + +P  K  G+ S  + LR+  GL+ANVRP KS++G K     +D+V++
Sbjct: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLI 148

Query: 143 RENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLT 202
           RENTE  Y  IE      A G  V  +IK I++ A+ R+ + A + A  R   R +  + 
Sbjct: 149 RENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYA--RAVERPK--VL 199

Query: 203 VTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIV 260
           V HKS +   +DGLF  + + + +    +Y  I+   +++D+ V    R+P  +   V+V
Sbjct: 200 VVHKSTIQRLADGLFVSVAEKLAK----EYPDIELQTELIDNTVLHTVRDPLKYSDVVVV 255

Query: 261 APNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRS 319
            PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 320 TALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
           + +ML  +G  + A  I KAV + +  G    T DL G AST    + V+SRL
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  173 bits (438), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 125/382 (32%), Positives = 200/382 (52%), Gaps = 38/382 (9%)

Query: 1   MFRSVATRISACRGLASNAARKSL--------TIGLIPGDGIGKEVIPAGKQILENLNSK 52
           MFR+V  R     G+AS A    L        T+ LIPGDG+GKE+  +   I E  N  
Sbjct: 1   MFRTVQRR-----GMASMAKELVLPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIP 55

Query: 53  HGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVA 112
             + +  +D+       Q+  +A+  E++K  K   +G     +   +  +  + S  VA
Sbjct: 56  --VDWERVDISTS-DNIQDVSQAV--ESLKRNKIGLKG-----IWHTSADIADHGSFNVA 105

Query: 113 LRREMGLYANVRPVKSVEGTKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAI 170
           LR+++ ++A+V   KSV G K K   +D+V++RENTE  Y  +E   +       V +++
Sbjct: 106 LRKQLDMFAHVAFFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPG-----VVESL 160

Query: 171 KRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKD 230
           K I++  + RIA+ A D A    +     ++   HK+N++   DGLFR     V E   +
Sbjct: 161 KIITKAKSERIARFAFDFA----KKYNRKSVCAVHKANIMKMGDGLFRNT---VTEIGAN 213

Query: 231 KYGQIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
           +Y  I+ +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  A+ G 
Sbjct: 214 EYPDIQTSSIIVDNASMQAVAKPHQFDVMVTPSMYGTIIGNIGAALIGGPGLVAGAHYGR 273

Query: 291 DIVIGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAI 349
           +  + EP       DI GK +ANP A I S+ LML+ LG  ++A+ I KA    +  G +
Sbjct: 274 EHAVFEPGSQHVGLDIKGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLGQV 333

Query: 350 TTPDLGGKASTQQVVDDVLSRL 371
           TT D+GG AST +  + ++ RL
Sbjct: 334 TTKDIGGSASTTEFTEAIIKRL 355

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  172 bits (437), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 121/350 (34%), Positives = 186/350 (53%), Gaps = 25/350 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           T+ LIPGDG+GKEV  +   I E+ N    + +  +++ +G    +   KA     +  L
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFESENVP--IDWETVEI-SGLDNEEGVQKA-----VDSL 81

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEG--TKDKPIDMVIV 142
           K    G L G   +P+ +  G+ S  VALR+++ ++ANV   K+V G  ++   +D+V++
Sbjct: 82  KRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDLVVI 139

Query: 143 RENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLT 202
           RENTE  Y  +E   +       V +++K +++  + RI + A D AL+        ++ 
Sbjct: 140 RENTEGEYSGLEHESVPG-----VVESLKIMTKAKSDRIGRFAFDFALKN----NRKSVC 190

Query: 203 VTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAP 262
             HK+N++   DGLFR  C  + E    +Y +I+    IVD+   +   +P  FDV+V P
Sbjct: 191 AVHKANIMKLGDGLFRN-C--INEIGAKEYPEIEVKNIIVDNASMQAVAKPHQFDVLVTP 247

Query: 263 NLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 321
           NLYG IL +  AAL+G  G+VP AN G +  + EP       DI G+ +ANP A I S+A
Sbjct: 248 NLYGSILGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSA 307

Query: 322 LMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371
           LML  LG N  A  I KA    + E   TT D+GG AST      ++ +L
Sbjct: 308 LMLRHLGLNSYADRISKATYDVIAEAKNTTKDIGGSASTTDFTQAIIEKL 357

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  172 bits (436), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 125/383 (32%), Positives = 202/383 (52%), Gaps = 37/383 (9%)

Query: 1   MFRSVATRISACRGLASNAARKSL---------TIGLIPGDGIGKEVIPAGKQILENLNS 51
           MFR   T+    R LA+ A  + +         T+ LIPGDG+GKEV  +   I +  N 
Sbjct: 1   MFRHSLTK----RTLATVATTEKMLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKAENV 56

Query: 52  KHGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIV 111
              + ++ +D+ +G    ++   A+  E++K    + +  L G   +      G+ S  V
Sbjct: 57  P--VDWDRVDI-SGVDRAEDVKSAV--ESLK----RNRIGLKGIWHTSPADQAGHGSLNV 107

Query: 112 ALRREMGLYANVRPVKSVEGTKDK--PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADA 169
           ALR+E+ +YANV   KS+ G + K   +D+V++RENTE  +  +E   +       V ++
Sbjct: 108 ALRKELDIYANVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPG-----VVES 162

Query: 170 IKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNK 229
           +K +++    RIA+ A D A    +      +   HK+N++   DGLF+ + ++V E   
Sbjct: 163 LKIMTQDNIERIARFAFDYA----KKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGEK-- 216

Query: 230 DKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG 289
            +Y +++    IVD+   +    P  FDV+V P++YG IL +  AAL+G  G+V  AN G
Sbjct: 217 -EYPELQVGNIIVDNASMQTVANPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYG 275

Query: 290 PDIVIGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGA 348
            D+ + EP       DI G+ +ANP A I S+ L+L  LG N +A  I KAV A + EG 
Sbjct: 276 RDVALFEPGSRHVGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEGK 335

Query: 349 ITTPDLGGKASTQQVVDDVLSRL 371
             T D+GG AST +  + V+++L
Sbjct: 336 SVTRDIGGTASTTEFTEAVINKL 358

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  172 bits (436), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 134/396 (33%), Positives = 194/396 (48%), Gaps = 50/396 (12%)

Query: 1   MFRSVATRISACRGLASNAARK---------------SLTIGLIPGDGIGKEVIPAGKQI 45
           M RS   R +  R LAS   ++                 T+  I GDG+G E+  + K I
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60

Query: 46  LENLNSKHGLSFNFID----LYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTT 101
                +K  + +        L  G  T  E  +   +  +  LK        G + +P  
Sbjct: 61  FA--AAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALK--------GPLATPIG 110

Query: 102 KVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--KPIDMVIVRENTEDLYIKIEKTYID 159
           K  G+ S  + LR+  GL+ANVRP KSVEG K   + +D+V++RENTE  Y  IE   + 
Sbjct: 111 K--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVP 168

Query: 160 KATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFRE 219
                 V  +IK I+  A+ R+ + A + A    +  G   L V HKS +   +DGLF  
Sbjct: 169 G-----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRLADGLFVT 219

Query: 220 ICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAAL- 276
           + K++      ++  I+   +++D+ V  +   P  +   V V PNLYGDILSD  + L 
Sbjct: 220 VAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLS 275

Query: 277 VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDI 336
            GSLG+ PS N+G  + I E  HGSAPDIAG+  ANP A + S+ +ML  +G  + A  I
Sbjct: 276 AGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKI 335

Query: 337 YKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
            KAV   +  G  + T DL G AST    + V+SRL
Sbjct: 336 EKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  172 bits (436), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 126/357 (35%), Positives = 184/357 (51%), Gaps = 33/357 (9%)

Query: 25  TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFID----LYAGFQTFQETGKALPDET 80
           T+  I GDGIG E+  + K I +  +    +++   D    L  G  T       +PDE 
Sbjct: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSPILVDGLTT-------IPDEA 95

Query: 81  IKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDK--PID 138
           +K +     G L G + +P  K  G+ S  + LR+   L+ANVRP KSV G K     +D
Sbjct: 96  VKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVD 152

Query: 139 MVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGE 198
           +V++RENTE  Y  IE           V  +IK I+  A+ R+ + A + A    +  G 
Sbjct: 153 LVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERVIRYAFEYA----KAIGR 203

Query: 199 ATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD- 257
             + V HKS +   SDGLF  + K++ +  +  +  I+ + +++D+ V  +   P  +  
Sbjct: 204 PKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSD 261

Query: 258 -VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIA 315
            V V PNLYGDILSD  + L  GSLG+ PSAN+G  I I E  HGSAPDIAG+  ANP A
Sbjct: 262 AVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANPTA 321

Query: 316 TIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
            + S+ +ML  +G N+    I  AV   +   +   T DLGG A+T    + V+  L
Sbjct: 322 LLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  171 bits (433), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 125/352 (35%), Positives = 185/352 (52%), Gaps = 27/352 (7%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVLK 85
           +  I GDGIG E+  + K I     +K  + F  + +            ++P+E  K + 
Sbjct: 38  VSFIEGDGIGPEISKSVKDIFAA--AKVPVDFESVVVKP---ILVNGVTSIPEEAQKSIN 92

Query: 86  DQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--KPIDMVIVR 143
                AL G + +P  K  G+ S  + LR+  GL+AN+RP KSVEG K     +++V++R
Sbjct: 93  TNLV-ALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIR 149

Query: 144 ENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTV 203
           ENTE  Y  IE   +       V  +IK I+  A+ R+ + A + A    + R    L V
Sbjct: 150 ENTEGEYAGIEHAIVPG-----VVQSIKLITREASERVIRFAYEYARAAERPR----LIV 200

Query: 204 THKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVA 261
            HKS +   SDGLF ++ K++    + ++  IK   +++D+ V     +P  +   V V 
Sbjct: 201 VHKSTIQRLSDGLFVDVAKEL----QSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSVC 256

Query: 262 PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRST 320
           PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDIAGK  ANP A + S+
Sbjct: 257 PNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSS 316

Query: 321 ALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
            +ML  +G ++ A  I KAV   +  G  + T DL G AST    + V+ +L
Sbjct: 317 VMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  168 bits (425), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 186/360 (51%), Gaps = 27/360 (7%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77
           N      T+  I GDG+G E+  + K I     +K  + +   D+   F     T   +P
Sbjct: 30  NPVTGKYTVPFIEGDGVGPEISKSVKDIFAA--AKVPIEWEPCDVGPIFVNGLTT---IP 84

Query: 78  DETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--K 135
           D  ++ +      AL G + +P  K  G+ S  + LR+   L+ANVRP +SV   K   +
Sbjct: 85  DAAVQSINKHLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSVPNYKTTYQ 141

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195
            +D+V++RENTE  Y  IE           V  +IK I++ A+ R+ + A +      + 
Sbjct: 142 NVDLVLIRENTEGEYSGIEH-----VISPGVIQSIKLITKDASERVIRYAFEYT----RA 192

Query: 196 RGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255
            G   L V HKS +   +DGLF  + K++      +Y  I+   +++D+ +  +   P+ 
Sbjct: 193 IGRPRLVVVHKSTIQRMADGLFVNVAKEL----ASEYPDIELQTELIDNTILNVVTHPES 248

Query: 256 FD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIAN 312
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  AN
Sbjct: 249 YTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKAN 308

Query: 313 PIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371
           P A + S+ +ML  +G N+ A  I  A+ + +  G+   T DL G A+T    + V+++L
Sbjct: 309 PTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  164 bits (416), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 114/351 (32%), Positives = 183/351 (52%), Gaps = 30/351 (8%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKV 83
             I LIPG+GIGKEV  + + I +  N    + +  +++ +        G     ++IK 
Sbjct: 23  FQITLIPGNGIGKEVTDSVRSIFQAENLP--IDWEIVNIES-----HRDGIKTAVDSIKR 75

Query: 84  LKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEG--TKDKPIDMVI 141
            K   +G         +  ++G  S  VALR+++ ++ANV   KS +   T+   +D+V+
Sbjct: 76  NKIALKGIW------SSDPIDG--SLNVALRKQLDIFANVAIFKSFDNVNTRIPNVDLVV 127

Query: 142 VRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATL 201
           +RENTE  +  +E   +D      V +++K +++  T RIA+ A D A +  +      +
Sbjct: 128 IRENTEGEFSGLEHESVDG-----VVESLKIVTKPKTERIARFAFDFAKKHNRNH----V 178

Query: 202 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261
           T  HK+N++   DGLF+ I   +     ++Y +IK +  IVD+   +   +P  FDV+V+
Sbjct: 179 TAVHKANIMKLGDGLFKNIVAHI---GNNEYPEIKNSSIIVDNASMQAVAKPHQFDVLVS 235

Query: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CHGSAPDIAGKGIANPIATIRST 320
           P++YG IL +  AAL+G  G+VP AN G D  + EP       DI G+ +ANP A I S 
Sbjct: 236 PSMYGTILGNIGAALIGGPGLVPGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSA 295

Query: 321 ALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371
             ML  LG    A+ I  AV   + +G   T D+GG AST +  D V++ L
Sbjct: 296 TWMLRHLGLTSPAERITNAVKHVIAQGTTVTKDIGGTASTTEFTDAVINEL 346

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  157 bits (397), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 127/372 (34%), Positives = 191/372 (51%), Gaps = 44/372 (11%)

Query: 25  TIGLIPGDGIGKEVIPAGKQILENLNSK-HGLSFNFIDLYAGFQTFQETGKALPDETIKV 83
            I ++PGD +G+E++    ++L+ +  K HG+ FNF     G     +TG  LPDET++ 
Sbjct: 6   NIVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEA 65

Query: 84  LKDQCQGALFGAVQSP---TTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDKPI--- 137
            K Q    L GAV  P   T KV      ++ +R+E+GLY N+RP K +    DK I   
Sbjct: 66  AK-QSDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFI---SDKLIGLS 120

Query: 138 ----------DMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALD 187
                     D V+VRE    +Y   E+   D   G+ VA   ++ S    +RI K+A  
Sbjct: 121 PLKEEVCKGTDFVVVRELVGGIYFG-ERQEDD---GSGVAWDSEKYSIEEVKRITKMA-- 174

Query: 188 IALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVY 247
            A   LQ      +    K+NVL+ S      + +   +    ++  +K   Q++DS   
Sbjct: 175 -AFLSLQNDPPLPIWSLDKANVLASS-----RLWRAAVDETIAEFPNLKVQHQLIDSAAM 228

Query: 248 RLFREP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHG 300
            L + P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHG
Sbjct: 229 MLVKNPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHG 288

Query: 301 SAPDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKAS 359
           SAPD+A +G  NP+ATI S A+ML+  L      + I +AV   L  G I T DLGG ++
Sbjct: 289 SAPDLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVLDRG-IRTADLGGNST 346

Query: 360 TQQVVDDVLSRL 371
           T ++ D V   L
Sbjct: 347 TSELGDAVAQEL 358

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  155 bits (392), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 108/350 (30%), Positives = 180/350 (51%), Gaps = 24/350 (6%)

Query: 25  TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           T+ L+PGDG+GKE   +   +    N    + +  +++ +G     + G A   ++++  
Sbjct: 28  TVTLLPGDGVGKECTDSVVSVFNAENIP--IDWEIVNI-SGLD--HKEGVAAAVQSLR-- 80

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDK--PIDMVIV 142
             + +  L G   +      G+ S  VA R+++ +YANV   KS++G K     +D+V++
Sbjct: 81  --RNKIGLKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDLVVI 138

Query: 143 RENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLT 202
           RENTE  +  +E   ++      V +++K  +   T RIA+ A + A    Q  G   + 
Sbjct: 139 RENTEGEFSGLEHESVEG-----VVESLKVTTLPKTERIARFAFNYA----QKNGRKAVC 189

Query: 203 VTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAP 262
             HK+N++   DGLFR     + E    +Y  I+ +  IVD+   +   +P  FDV+V P
Sbjct: 190 AVHKANIMKLGDGLFRNTVTSIGEK---EYPDIETSSIIVDNASMQAVAKPHQFDVLVTP 246

Query: 263 NLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 321
           ++YG I+ +  AAL+G  G+V  AN G +  + EP       DI G+ IANP A + S+A
Sbjct: 247 SMYGTIIGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMLLSSA 306

Query: 322 LMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371
           LML  LG   + + I  AV   + EG + T D+GG A+T +    V+ +L
Sbjct: 307 LMLNHLGLTKSGKRISDAVREVIAEGDVRTKDIGGDATTTEFTQAVIEKL 356

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  155 bits (393), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 184/360 (51%), Gaps = 28/360 (7%)

Query: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALP 77
           N    + T+  I GDG+G E+  + + I +   +K  + +   D+       + T   +P
Sbjct: 39  NPETGNYTVPFIEGDGVGPEISKSVRTIFKA--AKVPIDWVNCDIGPLLINGETT---IP 93

Query: 78  DETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVE--GTKDK 135
              +  + +    AL G + +P    +G+ S  + LR+  GL+ANVRP KS+    +  +
Sbjct: 94  QTAVDQINNSLI-ALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYE 150

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195
            +D++++RENTE  Y  IE   +       V  +IK I+  A+ ++ K A +      ++
Sbjct: 151 NVDLIVIRENTEGEYSGIEHEIVPG-----VVQSIKLITRKASEKVIKYAFEYT----RS 201

Query: 196 RGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQC 255
            G + L V HK+ +  + DGLF +  +++     DKY  +    +++D+ V      P+ 
Sbjct: 202 IGRSNLIVVHKATIQRRGDGLFVQTAQEM----ADKYPDVNLKLELIDNTVLNCIMNPEK 257

Query: 256 F--DVIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIAN 312
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G + V+ E  HGSAPDIAG+  AN
Sbjct: 258 YADSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKAN 316

Query: 313 PIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGA-ITTPDLGGKASTQQVVDDVLSRL 371
           P A + S+ +ML  +G    A  I  AV   +  G    T DLGG A+T      V+  L
Sbjct: 317 PTALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  149 bits (377), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 129/366 (35%), Positives = 188/366 (51%), Gaps = 37/366 (10%)

Query: 28  LIPGDGIGKEVIPAGKQILENLN-SKHGLSFNFIDLYAGFQTFQETGKALPDETIKVLKD 86
           ++PGD IG+EVI    ++L  +  ++  ++F F     G      TG  L D+TI+  K 
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDKTIEAAK- 67

Query: 87  QCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRPV----KSVEGTKD-KP-- 136
                L GAV  P     G   P   ++A+R+E+GLYAN+RP     KS+ G    KP  
Sbjct: 68  AADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKPEI 126

Query: 137 ---IDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRL 193
               D VI+RE    +Y    K   D   G         +SEV   RI ++   +ALQ  
Sbjct: 127 AQGTDFVILRELVGGIYFGERKE--DDGDGVAWDSEKYTVSEV--ERITRMGAFLALQH- 181

Query: 194 QTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREP 253
                  L    K+NVL+ S  L+R   + V E+ K ++ Q+    Q++DS    + + P
Sbjct: 182 --DPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAAMIMIKNP 235

Query: 254 QCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSAPDIA 306
           + F+ +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+ 
Sbjct: 236 RKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPDLE 295

Query: 307 GKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVD 365
            KG ANPIA I S A+ML+  L   D  + I  AV   +  G I T DLGG  +T +V D
Sbjct: 296 -KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQVIESG-IRTGDLGGNNTTTEVGD 353

Query: 366 DVLSRL 371
            V   L
Sbjct: 354 AVTHAL 359

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  148 bits (374), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 124/367 (33%), Positives = 189/367 (51%), Gaps = 37/367 (10%)

Query: 23  SLTIGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETI 81
           S  I ++PGD +G+E+     ++L+ ++  +   +FNF     G      TG  LPDE +
Sbjct: 2   SKNIVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEAL 61

Query: 82  KVLKDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRP----------VKS 128
           +  K +    L GAV  P     G   P   ++ +R+E+ LYAN+RP          +  
Sbjct: 62  EASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSP 119

Query: 129 VEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDI 188
           ++    +  D V+VRE    +Y    K   D+  G         + EV  +RI ++A  +
Sbjct: 120 LKAQYAQGTDFVVVRELVGGIYFGERKE--DEGDGVAWDSEQYSVPEV--QRITRMAAFL 175

Query: 189 ALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYR 248
           ALQ         +    K+NVL+ S  L+R   K V ++ K+++  +  N Q++DS    
Sbjct: 176 ALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDSAAMI 228

Query: 249 LFREP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGS 301
           L + P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGS
Sbjct: 229 LVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGS 288

Query: 302 APDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           APD+A KG  NP+ATI S A+ML+  L   +    I KAV   L +G I T DLGG  ST
Sbjct: 289 APDLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVLDDG-IRTGDLGGSNST 346

Query: 361 QQVVDDV 367
            +V D V
Sbjct: 347 SEVGDAV 353

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  145 bits (366), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 128/365 (35%), Positives = 188/365 (51%), Gaps = 38/365 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENL--NSKHGLSFNFIDLYAGFQTFQETGKALPDETIKV 83
           I ++PGD +G+E++    ++LE +  +S  G+ F F     G  +   TG  LPDE +  
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 84  LKDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRPVKSVEGT-------K 133
            K+     L GAV  P     G   P   ++ +R+E+ LYAN+RP   V  +       K
Sbjct: 66  AKNS-DAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGLSPLK 123

Query: 134 D---KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIAL 190
           +   K  D  +VRE    +Y    K   D   G+        I EV  +RI ++A  +AL
Sbjct: 124 EEIAKGTDFTVVRELVGGIYFGDRKE--DDGDGSAWDCEKYTIPEV--QRITRMAAFLAL 179

Query: 191 QRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLF 250
           Q        +L    K+NVL+ S  L+R   K V E+ K+++  +K   Q++DS    L 
Sbjct: 180 QHDPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAAMILV 232

Query: 251 REPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSAP 303
           + P+  + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAP
Sbjct: 233 KSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 292

Query: 304 DIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQ 362
           D+  KG  NPIATI S A+ML+  L   D    I +AV   L  G I T DL G  ST +
Sbjct: 293 DLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAG-IRTADLKGSNSTSE 350

Query: 363 VVDDV 367
           V D V
Sbjct: 351 VGDAV 355

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  145 bits (366), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 121/367 (32%), Positives = 188/367 (51%), Gaps = 37/367 (10%)

Query: 23  SLTIGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETI 81
           S  I ++PGD +GKEV     ++L  +   +  + FNF     G      TG  LPDE +
Sbjct: 2   SKNIVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEAL 61

Query: 82  KVLKDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRP----------VKS 128
           +  K +    L GAV  P     G   P   ++ +R+E+GLYAN+RP          +  
Sbjct: 62  EASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSP 119

Query: 129 VEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDI 188
           ++    K  D V+VRE    +Y    K    +  G  VA   ++ S    +RI ++A  +
Sbjct: 120 LKPEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFL 175

Query: 189 ALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYR 248
           ALQ+        +    K+NVL+ S  L+R   K V E+ K ++ Q+    Q++DS    
Sbjct: 176 ALQQ---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMI 228

Query: 249 LFREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGS 301
           L + P   + V++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGS
Sbjct: 229 LVKSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGS 288

Query: 302 APDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           APD+    + NPIATI S A+ML+  L   +  + + +AV  N+ +  + T DLGG  ST
Sbjct: 289 APDLPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAVR-NVLDAGVRTGDLGGSNST 346

Query: 361 QQVVDDV 367
            +V D +
Sbjct: 347 TEVGDAI 353

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  144 bits (364), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 190/368 (51%), Gaps = 45/368 (12%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           I ++PGD +G+E+     ++L+ +    + ++F+F     G      TG  LPDE ++  
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEAS 65

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRPV----KSVEGTKD--- 134
           K+     L GAV  P     G   P   ++ +R+E+GLYAN+RP     +S+ G      
Sbjct: 66  KN-SDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 135 ---KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQ 191
              K  D ++VRE    +Y    K   D+  G         + EV  +RI ++A  +ALQ
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRKE--DEGDGVAWDSEQYSVPEV--QRITRMAAFLALQ 179

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
                    +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    L +
Sbjct: 180 H---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMILVK 232

Query: 252 EP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSAPD 304
            P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 233 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 292

Query: 305 IAGKGIANPIATIRSTALMLE----FLGHNDAAQD-IYKAVDANLREGAITTPDLGGKAS 359
           +  KG  NPIATI S A+ML+     +   DA ++ + K +DA +R G     DLGG  S
Sbjct: 293 LP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAGIRTG-----DLGGSNS 346

Query: 360 TQQVVDDV 367
           T +V D +
Sbjct: 347 TTEVGDAI 354

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  144 bits (363), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 125/370 (33%), Positives = 197/370 (53%), Gaps = 49/370 (13%)

Query: 26  IGLIPGDGIGKEVIPAGKQIL----ENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETI 81
           I ++PGD IG+EV+    ++L    ++L+  H   F+F     G      TG ALPDE +
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVH---FDFQYHLVGGAAIDATGSALPDEAL 63

Query: 82  KVLKDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRPVKS-----VEGTK 133
              K +    L GAV  P  +  G   P   ++ LR+E+G+YAN+RP        +E + 
Sbjct: 64  GAAK-EADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSP 121

Query: 134 DKP-----IDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDI 188
            +P      D+++VRE     Y    + + D+  G         + EV  +RIA++A  +
Sbjct: 122 LRPEIARDTDIMVVRELLGGSYFG--ERHEDEGDGVAWDTDKYTVKEV--QRIARMAGFL 177

Query: 189 ALQRLQTRGEATLTVTH--KSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMV 246
           ALQ      +  L V    K+NVL+ S  L+R+  ++ ++S   ++  ++   Q++DS  
Sbjct: 178 ALQH-----DPPLPVWSLDKANVLASSR-LWRKTVEETFQS---EFPNVQLQHQLIDSAA 228

Query: 247 YRLFREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCH 299
             L + P+ F+ V+V  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCH
Sbjct: 229 MILVKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCH 288

Query: 300 GSAPDI-AGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGK 357
           GSAPD+ AGK  ANPI  I S A+ML+  L    A + + +AV   L  G + T DL G 
Sbjct: 289 GSAPDLPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVLDSG-VRTGDLLGS 345

Query: 358 ASTQQVVDDV 367
           +ST +V D +
Sbjct: 346 SSTSEVGDAI 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  143 bits (360), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 123/366 (33%), Positives = 188/366 (51%), Gaps = 41/366 (11%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           I ++PGD +G+E+     ++L+ ++  +  ++F+F +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRP----------VKSVEG 131
           K +    L GAV  P     G   P   ++ +R+E+ LYAN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 132 TKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQ 191
              K  D V+VRE    +Y    K   D   G         + EV  +RI ++A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKE--DDGDGVAWDSEQYTVPEV--QRITRMAAFMALQ 180

Query: 192 RLQTRGEATLTVTH--KSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRL 249
                 E  L +    K+NVL+ S  L+R   K V E+ K+++  +K   Q++DS    L
Sbjct: 181 H-----EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMIL 231

Query: 250 FREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSA 302
            + P   + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSA
Sbjct: 232 VKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 291

Query: 303 PDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQ 361
           PD+  K   NPIATI S A+ML+  L   +  + I  AV   L  G I T DLGG  ST 
Sbjct: 292 PDLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG-IRTGDLGGSNSTT 349

Query: 362 QVVDDV 367
           +V D V
Sbjct: 350 EVGDAV 355

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  143 bits (360), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 123/366 (33%), Positives = 187/366 (51%), Gaps = 41/366 (11%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           I ++PGD +G+E+     ++L+ ++  +  + F+F +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRP----------VKSVEG 131
           K +    L GAV  P     G   P   ++ +R+E+ LYAN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 132 TKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQ 191
              K  D V+VRE    +Y    K   D   G         + EV  +RI ++A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKE--DDGDGVAWDSEQYTVPEV--QRITRMAAFMALQ 180

Query: 192 RLQTRGEATLTVTH--KSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRL 249
                 E  L +    K+NVL+ S  L+R   K V E+ K+++  +K   Q++DS    L
Sbjct: 181 H-----EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMIL 231

Query: 250 FREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSA 302
            + P   + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSA
Sbjct: 232 VKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 291

Query: 303 PDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQ 361
           PD+  K   NPIATI S A+ML+  L   +  + I  AV   L  G I T DLGG  ST 
Sbjct: 292 PDLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG-IRTGDLGGSNSTT 349

Query: 362 QVVDDV 367
           +V D V
Sbjct: 350 EVGDAV 355

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  142 bits (358), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 189/366 (51%), Gaps = 41/366 (11%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           I ++PGD +G+E+     ++L+ ++  +  + F+F +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRP----------VKSVEG 131
           K +    L GAV  P     G   P   ++ +R+E+ LYAN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 132 TKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQ 191
              K  D V+VRE    +Y    K    +  G  VA   ++ +    +RI ++A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGERK----EDDGDGVAWDCEQYTVPEVQRITRMAAFMALQ 180

Query: 192 RLQTRGEATLTVTH--KSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRL 249
                 E  L +    K+NVL+ S  L+R   K V E+ K+++  +K   Q++DS    L
Sbjct: 181 H-----EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMIL 231

Query: 250 FREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSA 302
            + P   + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSA
Sbjct: 232 VKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 291

Query: 303 PDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQ 361
           PD+  K   NP+ATI S A+ML+  L   +  + I  AV   L  G I T DLGG  ST 
Sbjct: 292 PDLP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAG-IRTGDLGGSNSTT 349

Query: 362 QVVDDV 367
           +V D V
Sbjct: 350 EVGDAV 355

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  142 bits (357), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 121/364 (33%), Positives = 187/364 (51%), Gaps = 37/364 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           I ++PGD +G+E+     ++L+ ++  +  + F F     G      TG+ LPD +++  
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRP----------VKSVEG 131
           K +    L GAV  P     G   P   ++ +R+E+ LYAN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 132 TKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQ 191
              +  D V+VRE    +Y    K    +  G  VA   ++ S    +RI ++A  +ALQ
Sbjct: 125 EHARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
                   +L    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    + +
Sbjct: 181 HNPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIMVK 233

Query: 252 EP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSAPD 304
            P Q   VI+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQV 363
           +  KG  NPIATI S A+MLE  L   +    + +AV   L  G I T DL G  STQ+V
Sbjct: 294 LE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVRRVLDSG-IRTGDLRGSNSTQEV 351

Query: 364 VDDV 367
            D V
Sbjct: 352 GDAV 355

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  140 bits (352), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 157/293 (53%), Gaps = 25/293 (8%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKV 83
            T+ LIPGDG+GKEV  + K I E  N    + +  I++    QT  + G    +E ++ 
Sbjct: 29  FTVTLIPGDGVGKEVTDSVKTIFEAENIP--IDWETINIK---QTDHKEGV---NEAVES 80

Query: 84  LKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDK--PIDMVI 141
           L+    G L G   +P  +  G+ S  VALR+++ +YANV   KS++G K +   ID+++
Sbjct: 81  LRRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 142 VRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATL 201
           +RENTE  +  +E   +       V +++K +++  T RIA+ A D A    +      +
Sbjct: 139 IRENTEGEFSGLEHESVPG-----VVESLKIMTKPKTERIARFAFDFA----KKYNRKAV 189

Query: 202 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261
           T  HK+N++   DGLFR I   + E  + +Y  I  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNI---ITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEP-CHGSAPDIAGKGIANP 313
           P++YG IL +  AAL+G  G+V  AN G D  + EP       DI G+ +ANP
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANP 299

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  142 bits (358), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 123/370 (33%), Positives = 192/370 (51%), Gaps = 37/370 (10%)

Query: 20  ARKSLTIGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPD 78
           A+ +  I ++PGD +G+E+     ++L  ++S +  ++F+F     G      TG  LPD
Sbjct: 84  AQTTKHIVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPD 143

Query: 79  ETIKVLKDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRPVKS-----VE 130
           E ++  K +    L GAV  P     G   P   ++ +R+E+ LYAN+RP        ++
Sbjct: 144 EALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLD 201

Query: 131 GTKDKP-----IDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIA 185
            +  KP      D+ IVRE    +Y    K   D+  G         +SEV  +RI ++A
Sbjct: 202 LSPLKPEIVKGTDICIVRELVGGIYFGERKE--DEGDGVAWDSEKYSVSEV--QRITRMA 257

Query: 186 LDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSM 245
             +ALQ        +L    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS 
Sbjct: 258 GFLALQHNPPLPVWSLD---KANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSA 310

Query: 246 VYRLFREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPC 298
              L + P   + V++A N++GDI+SD A+ + GSLG++PSA++   PD      + EPC
Sbjct: 311 AMILVKNPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPC 370

Query: 299 HGSAPDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGK 357
           HGSAPD+  KG  NP+ATI S A+ML+  L   +    + KAV   L  G + T DL G 
Sbjct: 371 HGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVLDSG-VRTADLRGS 428

Query: 358 ASTQQVVDDV 367
            ST +V D +
Sbjct: 429 NSTSEVGDAI 438

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  140 bits (352), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 185/366 (50%), Gaps = 38/366 (10%)

Query: 25  TIGLIPGDGIGKEVIPAGKQILENLNS--KHGLSFNFIDLYAGFQTFQETGKALPDETIK 82
           TI ++PGD +G+E+     ++L  +       ++F F     G      TG  LPDE ++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 83  VLKDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRPVKS-----VEGTKD 134
             K +    L GAV  P     G   P   ++ +R+E+ LYAN+RP        ++ +  
Sbjct: 66  ASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 135 KP-----IDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIA 189
           KP      D V+VRE    +Y    K    +  G  VA   ++ S    +RI ++A   A
Sbjct: 124 KPEIARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMA---A 176

Query: 190 LQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRL 249
              LQ      +    K+NVL+ S  L+R   K V E+ K+++ Q+    Q++DS    L
Sbjct: 177 FMALQHNPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMIL 232

Query: 250 FREPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSA 302
            + P   + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSA
Sbjct: 233 VKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 292

Query: 303 PDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQ 361
           PD+  KG  NP+ATI S A+ML+  L   +  + I +AV   L  G I T DL G  ST 
Sbjct: 293 PDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSG-IRTADLKGTNSTT 350

Query: 362 QVVDDV 367
           +V D V
Sbjct: 351 EVGDAV 356

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  139 bits (350), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 186/367 (50%), Gaps = 37/367 (10%)

Query: 23  SLTIGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETI 81
           S  I ++PGD  G+E+     ++LE ++       FNF     G      TG  LPD+ +
Sbjct: 2   SKNIVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPDDAL 61

Query: 82  KVLKDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRP----------VKS 128
              K      L GAV  P     G   P   ++ +R+E+ LYAN+RP          +  
Sbjct: 62  AAAKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSP 119

Query: 129 VEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDI 188
           ++    K  D V+VRE    +Y    K    +  G  VA   ++ ++   +R+ ++A  +
Sbjct: 120 LKPQHAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYTKPEVQRLTRMAAFL 175

Query: 189 ALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYR 248
           ALQ         +    K+NVL+ S  L+R   K V E+ K+++ Q+K N Q++DS    
Sbjct: 176 ALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAAMI 228

Query: 249 LFREP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGS 301
           L + P Q   +++  NL+GDI+SD A+ + GSLG++PSA++   PD      + EPCHGS
Sbjct: 229 LVKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHGS 288

Query: 302 APDIAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360
           APD+  KG  NPIA I S A+ML+  L  +   + + KAV   L  G + T DLGG  ST
Sbjct: 289 APDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVLDSG-VRTGDLGGSNST 346

Query: 361 QQVVDDV 367
            +V D +
Sbjct: 347 SEVGDAI 353

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  138 bits (348), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 124/364 (34%), Positives = 183/364 (50%), Gaps = 37/364 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           I ++PGD +G+E+     ++L+ ++  +  + F+F     G      TG  L DE ++  
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDEALEAS 66

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRPVKS-----VEGTKDKP 136
           K +    L GAV  P     G   P   ++ +R+E+ LYAN+RP        +E +  KP
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLELSPIKP 124

Query: 137 -----IDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQ 191
                 D V+VRE    +Y    K   D   G         + EV  +RI ++A   A  
Sbjct: 125 QFARGTDFVVVRELVGGIYFGKRKE--DDGDGVAWDSEQYTVPEV--QRITRMA---AFM 177

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
            LQ +    +    K+NVL+ S  L+R   K V E+ K+++  +K   Q++DS    L +
Sbjct: 178 ALQHQPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 252 EP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSAPD 304
            P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 234 NPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQV 363
           +  K   NPIATI S A+ML+  L      Q I  AV   L  G I T DLGG  ST +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVLDAG-IRTGDLGGSNSTIEV 351

Query: 364 VDDV 367
            D V
Sbjct: 352 GDAV 355

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  137 bits (345), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 123/368 (33%), Positives = 190/368 (51%), Gaps = 37/368 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           I ++PGD +G+E+     ++L+ ++  +    F F     G      TG+ LPD +++  
Sbjct: 7   IVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAA 66

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRPVK-SVEGTKD----KP 136
           K +    L GAV  P     G   P   ++ +R+E+ LYAN+RP   + E   D    KP
Sbjct: 67  K-KSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKP 124

Query: 137 -----IDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQ 191
                 D V+VRE    +Y    K    + TG  VA   ++ S    +RI ++A  +ALQ
Sbjct: 125 ECARGTDFVVVRELVGGIYFGERK----EDTGDGVAWDSEQYSVPEVQRITRMAAFLALQ 180

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
                   +L    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    L +
Sbjct: 181 HSPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 252 EP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSAPD 304
            P Q   VI+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQV 363
           +  KG  NPIATI S A+ML+  L   +    + +AV   L  G + T DL G ++T +V
Sbjct: 294 LP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVLDSG-VRTADLKGTSTTSEV 351

Query: 364 VDDVLSRL 371
            + V+  L
Sbjct: 352 GEAVVKAL 359

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  135 bits (340), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 182/360 (50%), Gaps = 37/360 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           I + PGD IG E++    ++L+ +      +SF +     G      TG+ L DE ++V 
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLTDEALQVA 66

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRPVKSVEGT--KDKPI-- 137
           K+     L GAV  P     G   P   ++ +R+E+G+YAN+RP + V  T     P+  
Sbjct: 67  KNS-DAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLSPLKR 124

Query: 138 ------DMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQ 191
                 D VIVRE    +Y    +   D      VA   +  S    +RI ++A  +ALQ
Sbjct: 125 EIVQGTDFVIVRELVGGIYFGERQEAGDDG----VAWDKESYSVPEIQRITRMAAFLALQ 180

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
                   +L    K+NVL+ S  L+R   K V E+ K+++  +  N  ++DS    L +
Sbjct: 181 HNPPLPVWSL---DKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLIDSAAMTLVQ 233

Query: 252 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSAPD 304
            P   + V++  N++GDI+SD A+ + GSLG++PSA++   PD    + + EPCHGSAPD
Sbjct: 234 NPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLEF-LGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQV 363
           +     ANPIATI S A+M +  L        I +AV   +  G I T DLGGK +T +V
Sbjct: 294 LPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTIDAG-IKTGDLGGKNTTTEV 351

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  129 bits (325), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 182/369 (49%), Gaps = 46/369 (12%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENLNSKHG--LSFNFIDLYAGFQTFQETGKALPDETIKV 83
           I ++PGD +G E+     ++L+ +       + F+F     G       G  L DE ++ 
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALEA 66

Query: 84  LKDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRP----------VKSVE 130
            K +    L GAV  P     G   P   ++ +R+E+GLYAN+RP          +  + 
Sbjct: 67  SK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPLLGLSPLR 124

Query: 131 GTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIAL 190
               K  D ++VRE    +Y    K    +  G  VA   ++ S     RI ++A  +AL
Sbjct: 125 PEIAKGTDFMVVRELVGGIYFGERK----EDDGDGVAWDSEKYSVPEVERITRMAAFLAL 180

Query: 191 QRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLF 250
           Q         +    K+NVL+ S  L+R   K V  + K+++  +    Q++DS    L 
Sbjct: 181 QH---NPPLPIWSLDKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLIDSAAMILV 233

Query: 251 REP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSAP 303
           + P Q   +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAP
Sbjct: 234 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAP 293

Query: 304 DIAGKGIANPIATIRSTALMLEF----LGHNDAAQD-IYKAVDANLREGAITTPDLGGKA 358
           D+  K   NP+ATI S A+ML+     +   +A ++ + + +DA +R G     DLGG  
Sbjct: 294 DLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVLDAGVRTG-----DLGGSN 347

Query: 359 STQQVVDDV 367
           STQ+V D +
Sbjct: 348 STQEVGDAI 356

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  128 bits (321), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 186/369 (50%), Gaps = 45/369 (12%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENLNS-KHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84
           I ++PGD +G+E+     ++L+ ++  +  + F++     G      TG  LPDE +   
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEALDAA 66

Query: 85  KDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRP----------VKSVEG 131
           K      L GAV  P     G   P   ++ +R+E+ LYAN+RP          +  ++ 
Sbjct: 67  KKADA-VLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 124

Query: 132 TKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQ 191
              K  D V+VRE    +Y    K    +  G  VA   ++ S    +RI ++A  +ALQ
Sbjct: 125 EYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFR 251
           +        +    K+NVL+ S  L+R   K V E+ K+++  +    Q++DS    L +
Sbjct: 181 Q---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 252 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVIGEPCHGSAPD 304
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 234 SPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGIANPIATIRSTALMLEFLGH-----NDAAQDIYKAVDANLREGAITTPDLGGKAS 359
           +  K   NPIATI S A+ML+   +     N   + + + +DA +R     T DL G+ S
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRRVLDAGIR-----TADLRGENS 347

Query: 360 TQQVVDDVL 368
           T +V D V+
Sbjct: 348 TSEVGDAVV 356

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  119 bits (299), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 115/372 (30%), Positives = 178/372 (47%), Gaps = 50/372 (13%)

Query: 25  TIGLIPGDGIGKEVIPAGKQILENLNS--KHGLSFNFIDLYAGFQTFQETGKALPDETIK 82
            I ++PGD +G EV     +IL+ +     + + FNF     G      TG  LPDE+++
Sbjct: 6   NIVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLE 65

Query: 83  VLKDQCQGALFGAVQSPTTKVEGYSSP---IVALRREMGLYANVRP----------VKSV 129
             K +    L GAV  P     G   P   ++ +R+E+ LYAN+RP          +  +
Sbjct: 66  ASK-RADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 130 EGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIA 189
           +    K  D  +VRE    +Y    K    +  G  VA   ++ S    +RI ++A  +A
Sbjct: 124 KEKYAKGTDFTVVRELVGGIYFGKRK----EDDGDGVAWDSEQYSVPEVQRITRMAAFLA 179

Query: 190 LQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRL 249
           +Q         +    K+NVL+ S  L+R   K V E+ ++++  +K + Q++DS    L
Sbjct: 180 MQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIQNEFPSLKVSHQLIDSAAMIL 232

Query: 250 FREP-QCFDVIVAPNLYGDILSDGAAALVG--------SLGVVPSANVGPDIVIGEPCHG 300
            + P Q   +I+  N++GDI+SD A+ + G        SL  +P  N      + EPCHG
Sbjct: 233 VKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSA--FGLYEPCHG 290

Query: 301 SAPDIAGKGIANPIATIRSTALMLEF---LGHNDAA--QDIYKAVDANLREGAITTPDLG 355
           SAPD+  KG  NPI TI S A+ML+    L     A  + + + +D N+R     T DLG
Sbjct: 291 SAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRRVLDNNIR-----TADLG 344

Query: 356 GKASTQQVVDDV 367
           G  ST  + D V
Sbjct: 345 GSNSTSDIGDAV 356

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 131/297 (44%), Gaps = 40/297 (13%)

Query: 103 VEGYSSPIVALRREMGLYANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKAT 162
           V G+  PI+     +G +A+    ++ +   +K   + +V    +    KI + +  K T
Sbjct: 129 VPGWQKPII-----IGRHAHGDQYRATDAIIEKAGKLELVHRPADGSEPKILQVHEFKGT 183

Query: 163 GTR-VADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREIC 221
           G R VA A+    E + R  A  +  +AL +        L ++ K+ +L Q DG F++I 
Sbjct: 184 GARGVALAMYNTDE-SIRGFAHASFKLALSK-----RLNLFMSTKNTILKQYDGRFKDIF 237

Query: 222 KDVYESNKDKYGQ---IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVG 278
           ++VY        +   I Y  +++D MV ++ +    F V+   N  GD+LSD  A   G
Sbjct: 238 QEVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGFG 296

Query: 279 SLGVVPSANVGPD--IVIGEPCHGSAP-----DIAGKGIA-NPIATIRSTALMLEFLGHN 330
           SLG++ S  V PD      E  HG+          GK  + N IA+I + +  L   G  
Sbjct: 297 SLGLMTSMLVTPDGKTFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWSRGLGKRGEL 356

Query: 331 DAAQDIYK-------AVDANLREGAITTPDLG---GKA------STQQVVDDVLSRL 371
           D   D+ +       A    +++  I T DL    G A      +T + +D V +RL
Sbjct: 357 DGTPDVVEFARKLEAATIETVQQHGIMTKDLALACGNANRDAYVTTNEFLDAVEARL 413

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 98/209 (46%), Gaps = 32/209 (15%)

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKYNEQIVDSMVYR 248
           +L    +  L ++ K+ +L + DG F++I +++YES+ K ++    I Y  +++D MV +
Sbjct: 209 KLAINKKLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISYEHRLIDDMVAQ 268

Query: 249 LFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIGEPCHGSAP--- 303
           + +    F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+     
Sbjct: 269 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHY 327

Query: 304 ---DIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGA---------ITT 351
              +   +   N IA+I + +  L   G  D+  D+ K   ANL E A         I T
Sbjct: 328 RQYEQGKETSTNSIASIFAWSRGLAKRGELDSTPDVIKF--ANLLESATLNTVQQDGIMT 385

Query: 352 PDLG---GKA------STQQVVDDVLSRL 371
            DL    GK       +T + +D V +RL
Sbjct: 386 KDLALACGKTERSAYVTTDEFLDAVATRL 414

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 68/127 (53%), Gaps = 13/127 (10%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNK----DKYGQIK 236
            A+ + ++AL+R     +  L  T K+ VL + DG F++I +++YES+     D+ G I 
Sbjct: 195 FARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQFDEIG-IL 248

Query: 237 YNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVI 294
           Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V PD     
Sbjct: 249 YEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAPDGKTFE 307

Query: 295 GEPCHGS 301
            E  HG+
Sbjct: 308 SEAAHGT 314

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 101/218 (46%), Gaps = 33/218 (15%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYG--QIKY 237
            AK + ++AL+R     +  L  T K+ +L + DG F++I + +Y S+ +DK+    I Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKRYDGKFKDIFESMYASDYQDKFEVIGIWY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMSSVLVTPDGKTFES 305

Query: 296 EPCHGSAP-----DIAGKGIA-NPIATIRSTALMLEFLGHNDAAQDIYK-------AVDA 342
           E  HG+          GK  + N IA+I + +  +   G  D   ++ K       A   
Sbjct: 306 EAAHGTVTRHYRQHQQGKETSTNSIASIFAWSRGIIQRGKIDETPEVVKFGQLLEDATTN 365

Query: 343 NLREGAITTPDL---------GGKASTQQVVDDVLSRL 371
            ++E  I T DL         G   +T++ +D V  RL
Sbjct: 366 TVQEDGIMTKDLALILGKTDRGSYVTTEEFIDAVEKRL 403

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 102/218 (46%), Gaps = 33/218 (15%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--IKY 237
            A+ + ++A++R     +  L  T K+ +L + DG F++I + +Y E  K K+ +  I Y
Sbjct: 193 FARASFELAIKR-----KLPLFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKFKELGISY 247

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + PD  I   
Sbjct: 248 EHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTPDGKIFES 306

Query: 296 EPCHGSAPDI-----AGKGIA-NPIATIRSTALMLEFLGHNDAAQDIY-------KAVDA 342
           E  HG+          GK  + N IATI + +  +   G  D   D+        ++   
Sbjct: 307 EAAHGTVTRHYRQYQKGKETSTNSIATIFAWSQGIIHRGKVDQTPDVRLFGEILERSTID 366

Query: 343 NLREGAITTPDLG---GK------ASTQQVVDDVLSRL 371
            ++   I T DL    GK      AST++ +D V  RL
Sbjct: 367 TVQIDGIMTKDLALILGKTERKDYASTEEFIDAVARRL 404

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 102/218 (46%), Gaps = 33/218 (15%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--IKY 237
            AK + ++A++R     +  L  T K+ +L + DG F+++ + +Y ES K+K+    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 296 EPCHGSAP-----DIAGKGIA-NPIATIRSTALMLEFLGHNDAAQDIYK-------AVDA 342
           E  HG+          GK  + N IA+I +    +   G  D   D+ K       A   
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVN 365

Query: 343 NLREGAITTPDLG---GKA------STQQVVDDVLSRL 371
            ++E  I T DL    GK       +T++ +D V SRL
Sbjct: 366 TVQEDGIMTKDLALILGKTERSAYVTTEEFIDAVESRL 403

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 93/197 (47%), Gaps = 20/197 (10%)

Query: 163 GTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICK 222
           G  VA A+    E + R  A  +  +ALQ+     +  L ++ K+ +L + DG F++I +
Sbjct: 187 GPGVALAMYNTDE-SIRGFAHSSFKLALQK-----KLNLFLSTKNTILKKYDGRFKDIFQ 240

Query: 223 DVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGS 279
           +VY+S  K K+ +  I Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 241 EVYDSEYKQKFAELNITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 299

Query: 280 LGVVPSANVGPD--IVIGEPCHGSAPDIAGKG------IANPIATIRSTALMLEFLGHND 331
           LG++ S  + PD      E  HG+      K         N IA+I +    L   G  D
Sbjct: 300 LGLMTSILITPDGKTFESEAAHGTVTRHYRKHQQGEETSTNSIASIFAWTRGLAKRGELD 359

Query: 332 AAQDIYKAVDANLREGA 348
              D+ +   AN+ E A
Sbjct: 360 GTPDVVRF--ANILESA 374

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKY--GQIKY 237
            AK + ++ALQR     +  L  T K+ +L + DG F++I + +Y +  K+K+    I Y
Sbjct: 194 FAKSSFELALQR-----KMPLYSTTKNTILKKYDGKFKDIFEGMYAAEYKEKFEAAGIWY 248

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 308 EAAHGT 313

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 89/192 (46%), Gaps = 24/192 (12%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKY 237
            AK + ++AL+R     +  L  T K+ +L + DG F++I + +YE   K K+    I Y
Sbjct: 194 FAKSSFELALER-----KMPLYSTTKNTILKKYDGQFKDIFEGMYEREYKQKFEAVGIWY 248

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 296 EPCHGSAP-----DIAGKGIA-NPIATIRSTALMLEFLGHNDAAQDIYK-------AVDA 342
           E  HG+          GK  + N IA+I + +  +   G  D   D+ K       A   
Sbjct: 308 EAAHGTVTRHYRLHQQGKETSTNSIASIFAWSRGIIQRGKLDGTPDVVKFGQLLESATLD 367

Query: 343 NLREGAITTPDL 354
            ++E  I T DL
Sbjct: 368 TVQEDGIMTKDL 379

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 66/127 (51%), Gaps = 13/127 (10%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYE----SNKDKYGQIK 236
            AK + ++AL+R Q      L  T K+ +L + DG F++I + +YE    S  +K G I 
Sbjct: 193 FAKASFELALERKQP-----LYSTTKNTILKKYDGKFKDIFEAMYEKEYRSQFEKLG-IW 246

Query: 237 YNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVI 294
           Y  +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  V PD     
Sbjct: 247 YEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFE 305

Query: 295 GEPCHGS 301
            E  HG+
Sbjct: 306 SEAAHGT 312

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 85/173 (49%), Gaps = 19/173 (10%)

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYG--QIKYNEQIVDSMVYRLFREPQCFD 257
           L ++ K+ +L + DG F+++ ++V++S  KDK+    IKY  +++D MV ++ +    + 
Sbjct: 229 LFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQMIKSKGGY- 287

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIGEPCHGSAP-----DIAGKGI 310
           ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+          GK  
Sbjct: 288 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRQHQQGKQT 347

Query: 311 A-NPIATIRSTALMLEFLGHNDA-------AQDIYKAVDANLREGAITTPDLG 355
           + N IA+I + +  L   G  D        AQ + KA    ++E  I T DL 
Sbjct: 348 STNSIASIFAWSRGLAKRGELDNTPDVMKFAQTLEKATLDTVQEDGIMTKDLA 400

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 98/220 (44%), Gaps = 37/220 (16%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQIK--Y 237
            AK + ++AL+R     +  L  T K+ +L   D  F++I  ++++   K+K+  +K  Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQALKITY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 296 EPCHGSAPDIAGKG------IANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGA- 348
           E  HG+      K         N IA+I +    +   G  D   D+ K    NL E A 
Sbjct: 306 EAAHGTVTRHFRKHQRGEETSTNSIASIFAWTRAIIQRGKLDNTDDVIKF--GNLLEKAT 363

Query: 349 ITTPDLGGK-----------------ASTQQVVDDVLSRL 371
           + T  +GGK                  +T++ +D+V  RL
Sbjct: 364 LDTVQVGGKMTKDLALMLGKTNRSSYVTTEEFIDEVAKRL 403

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 91/190 (47%), Gaps = 18/190 (9%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKY 237
            AK +  +A++R     +  L  T K+ +L + DG+F++I + +YE   K+K+ +  I Y
Sbjct: 195 FAKASFQLAVER-----KMPLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWY 249

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 250 EHRLIDDMVAQMLKSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFES 308

Query: 296 EPCHGSAP-----DIAGKGIA-NPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAI 349
           E  HG+          GK  + N IA+I +    +   G  D   D+ K  +A +    I
Sbjct: 309 EAAHGTVTRHYRQQQQGKETSTNSIASIFAWTRGIIQRGKVDGTPDVVKFGEA-VERATI 367

Query: 350 TTPDLGGKAS 359
            T D+  K +
Sbjct: 368 DTVDIDNKMT 377

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 75/141 (53%), Gaps = 12/141 (8%)

Query: 166 VADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY 225
           VA A+   +E + R  A+ + ++ALQR     +  L  T K+ +L + DG F++  + +Y
Sbjct: 180 VALAMYNTTE-SIRGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEFEAMY 233

Query: 226 ESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGV 282
           E+  ++++ +  I Y  +++D MV ++ +    F VI   N  GD+ SD  A   GSLG+
Sbjct: 234 EAEYRERFERAGIWYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGL 292

Query: 283 VPSANVGPD--IVIGEPCHGS 301
           + S  V PD      E  HG+
Sbjct: 293 MTSVLVTPDGRAFESEAAHGT 313

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 102/218 (46%), Gaps = 33/218 (15%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--IKY 237
            AK + ++A++R     +  L  T K+ +L + DG F+++ + +Y  S K+K+    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 296 EPCHGSAP-----DIAGKGIA-NPIATIRSTALMLEFLGHNDAAQDIYK-------AVDA 342
           E  HG+          GK  + N IA+I +    +   G  D   D+ K       A   
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVN 365

Query: 343 NLREGAITTPDLG---GKA------STQQVVDDVLSRL 371
            ++E  I T DL    GK+      +T++ +D V SRL
Sbjct: 366 TVQEDGIMTKDLALILGKSERSAYVTTEEFIDAVESRL 403

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---IKY 237
            A+ +  +AL+R     +  L  T K+ +L + DG F+ + +D+YE    +  +   I Y
Sbjct: 194 FARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDLGIWY 248

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGKTFES 307

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 308 EAAHGT 313

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYG--QIKY 237
            AK + + AL+R     +  L  T K+ +L Q DG F++I +++Y +  +DK+    I Y
Sbjct: 198 FAKASFEFALER-----KIPLYSTTKNTILKQYDGKFKDIFEEMYAKEYEDKFKVLNIWY 252

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 253 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSLGLMTSVLLTPDGSSFES 311

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 312 EAAHGT 317

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 102/222 (45%), Gaps = 33/222 (14%)

Query: 177 ATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ- 234
           + R  A+ + ++AL+      E  L  T K+ +L + DG F++  + +YE+  K+++   
Sbjct: 188 SIRGFARASFNMALEH-----EMPLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAK 242

Query: 235 -IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD-- 291
            I Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + PD  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGK 301

Query: 292 IVIGEPCHGSAP-----DIAGKGIA-NPIATIRSTALMLEFLGHNDAAQDIYK------- 338
               E  HG+          GK  + N IA+I +    +   G  D   D+ K       
Sbjct: 302 TFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGIIQRGKLDETADVVKFGELLER 361

Query: 339 AVDANLREGAITTPDLG---GKA------STQQVVDDVLSRL 371
           A    ++E  I T DL    GK       +T++ +D V +R+
Sbjct: 362 ATVDTVQEDGIMTKDLALILGKTDRSAYVTTEEFIDAVENRI 403

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L ++ K+ +L + DG F++I ++VYE+  K K+ Q  I Y  +++D MV ++ +    F 
Sbjct: 224 LFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGF- 282

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIGEPCHGS 301
           ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 100/218 (45%), Gaps = 33/218 (15%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKY 237
            AK + ++A++R     +  L  T K+ +L + DG F+++ + +Y  N K+K+    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFES 305

Query: 296 EPCHGSAP-----DIAGKGIA-NPIATIRSTALMLEFLGHNDAAQDIYK-------AVDA 342
           E  HG+          GK  + N IA+I +    +   G  D   D+ K       A   
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGEILESATVN 365

Query: 343 NLREGAITTPDLG---GKA------STQQVVDDVLSRL 371
            ++E  I T DL    GK       +T+  +D V SRL
Sbjct: 366 TVQEDGIMTKDLALILGKTERSAYVTTEDFIDAVESRL 403

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 68/126 (53%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKY 237
            AK + ++AL+R     +  L    K+ +L + DGLF++I + +Y+ + K K+ +  I +
Sbjct: 195 FAKSSFELALKR-----KLPLFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEELGITF 249

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V PD  +   
Sbjct: 250 EHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSVFES 308

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 309 EAAHGT 314

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 99/206 (48%), Gaps = 24/206 (11%)

Query: 103 VEGYSSPIVALRREMGLYANVRPVKSVEGTKDKP--IDMVIVRENTEDLYIKIEKTYIDK 160
           V G+  PI+     +G +A+    K+ +     P  +++V   EN  +   K+ + Y  K
Sbjct: 133 VPGWEKPII-----IGRHAHGDQYKATDAVIPGPGKLELVYKPENGPE---KVMEVYDYK 184

Query: 161 ATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREI 220
             G  VA A+    E + R  A  +  +AL +     +  L ++ K+ +L + DG F++I
Sbjct: 185 GPG--VALAMYNTEE-SIRGFAHASFKLALTK-----KLNLYLSTKNTILKKYDGRFKDI 236

Query: 221 CKDVYESNKDKYGQ---IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALV 277
            +++Y++   K  +   I Y  +++D MV ++ +    F ++   N  GD+ SD  A   
Sbjct: 237 FQELYDAEYKKQFEAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGF 295

Query: 278 GSLGVVPSANVGPD--IVIGEPCHGS 301
           GSLG++ S  V PD      E  HG+
Sbjct: 296 GSLGLMTSVLVTPDGKTFESEAAHGT 321

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 66/127 (51%), Gaps = 13/127 (10%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICK----DVYESNKDKYGQIK 236
            AK + ++AL+R     +  L  T K+ +L + DG F+++ +    D Y+S  ++ G I 
Sbjct: 191 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEQMYADQYQSRFEELG-IW 244

Query: 237 YNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVI 294
           Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V PD     
Sbjct: 245 YEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGKTFE 303

Query: 295 GEPCHGS 301
            E  HG+
Sbjct: 304 SEAAHGT 310

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 89/195 (45%), Gaps = 23/195 (11%)

Query: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKYNEQIVDSMVYR 248
           +L    +  L ++ K+ +L + DG F++I + +YE++ K K+ Q  I Y  +++D MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQ 274

Query: 249 LFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIGEPCHGSAPDIA 306
           + +    F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+     
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHF 333

Query: 307 GK------GIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGA---------ITT 351
            K         N IA+I + +  L   G  D    + K   ANL E A         I T
Sbjct: 334 RKFQKGEETSTNSIASIFAWSRGLLKRGELDKNDQLCKF--ANLLEAATLNTVQQDGIMT 391

Query: 352 PDLGGKASTQQVVDD 366
            DL   + +Q V  D
Sbjct: 392 KDLALASGSQYVNTD 406

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 99/204 (48%), Gaps = 19/204 (9%)

Query: 103 VEGYSSPIVALRREMGLYANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKAT 162
           V G+  PIV     +G +A+    K+ +     P  + +V + T+    K  + Y  K  
Sbjct: 140 VPGWEKPIV-----IGRHAHGDQYKATDLVVPGPGKLELVYKPTDGSETKTLEVYDYKGP 194

Query: 163 GTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICK 222
           G  +A A+    E + R  A  +  +A+ +     +  L ++ K+ +L + DG F++I +
Sbjct: 195 G--IALAMYNTDE-SIRGFAHASFKLAITK-----KLNLYLSTKNTILKKYDGRFKDIFQ 246

Query: 223 DVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGS 279
           ++Y+S  K ++ +  I Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 247 EIYDSEYKSEFEKLGIWYEHRLIDDMVAQMIKSKGGF-ILAFKNYDGDVQSDIVAQGFGS 305

Query: 280 LGVVPSANVGPD--IVIGEPCHGS 301
           LG++ S  V PD      E  HG+
Sbjct: 306 LGLMTSVLVTPDGKAFESEAAHGT 329

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKY 237
            A+ +  +A++R     +  L  T K+ +L Q DG F++I K VYE+  K+ + +  I Y
Sbjct: 190 FARASFTMAIER-----KLPLYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWY 244

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 245 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFES 303

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 304 EAAHGT 309

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 97/218 (44%), Gaps = 33/218 (15%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKY 237
            A  +  +AL +     +  L +  K+ +L + DG F++I + +Y    K K+ Q  I Y
Sbjct: 204 FAHSSFQVALNK-----KLNLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKFEQLGITY 258

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 259 EHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSPDGKTFES 317

Query: 296 EPCHGSAP------DIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDA------- 342
           E  HG+         +  +   N IA+I + +  L   G  D  +D+    +        
Sbjct: 318 EAAHGTVTRHFRRHQMGEETSTNSIASIFAWSRGLAKRGELDGTKDVIAFANKLEAATLD 377

Query: 343 NLREGAITTPDLG---GK------ASTQQVVDDVLSRL 371
           +++E  I T DL    GK       +T + +D V +RL
Sbjct: 378 SVQEDGIMTKDLALASGKNNRSDYVNTDEFIDAVEARL 415

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 106/238 (44%), Gaps = 38/238 (15%)

Query: 163 GTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICK 222
           G+ VA A+    E + R  A  +  +AL +     +  L ++ K+ +L + DG F++I +
Sbjct: 190 GSGVALAMYNTDE-SIRGFAHSSFKLALTK-----KLNLFLSTKNTILKKYDGRFKDIFQ 243

Query: 223 DVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGS 279
           ++++   K K+    I Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 244 EIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 302

Query: 280 LGVVPSANVGPD--IVIGEPCHGSAPDIAGK------GIANPIATIRSTALMLEFLGHND 331
           LG++ S  V PD      E  HG+      K         N IA+I + +  L   G  D
Sbjct: 303 LGLMTSILVTPDGKTFESEAAHGTVTRHYRKFQKGEETSTNSIASIFAWSRGLAKRGELD 362

Query: 332 AAQDIYKAVDANLREGA---------ITTPDLG---GKA------STQQVVDDVLSRL 371
              D+ +   ANL E A         I T DL    GK       +T + +D V  RL
Sbjct: 363 GTPDVVRF--ANLLEAATLNTVQQDGIMTKDLALAQGKTDRSSYVTTDEFIDAVEKRL 418

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 100/218 (45%), Gaps = 33/218 (15%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--IKY 237
            AK + ++AL+R     +  L  T K+ +L + DG F+++ + +Y E  K+K+    I Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEALGIWY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGKTFES 305

Query: 296 EPCHGSAP------DIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYK-------AVDA 342
           E  HG+         +  +   N IA+I +    +   G  D   D+ K       +   
Sbjct: 306 EAAHGTVTRHFRQHQLGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESSTVN 365

Query: 343 NLREGAITTPDLG---GKA------STQQVVDDVLSRL 371
            +++  I T DL    GK       +T++ +D V SRL
Sbjct: 366 TVQKDGIMTKDLALILGKTERSAYVTTEEFIDAVESRL 403

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L ++ K+ +L + DG F++I ++VYE+  K K+ +  I Y  +++D MV ++ +    F 
Sbjct: 225 LFLSTKNTILKKYDGRFKDIFQEVYEAEYKSKFEKLGIHYEHRLIDDMVAQMIKSKGGF- 283

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIGEPCHGS 301
           ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 284 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQI--KY 237
            AK +  +AL+R     +  L +  K+ +L + DG F+ I  D+Y++  K+K+ ++   Y
Sbjct: 195 FAKASFIMALKR-----KLPLFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKLGLTY 249

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 250 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGKTFQS 308

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 309 EAAHGT 314

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY----ESNKDKYGQIK 236
            A+ + ++ALQR        L  T K+ +L + DG F+++ + +Y    +S  ++ G I 
Sbjct: 192 FARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMYAAEYQSRFEELG-IW 245

Query: 237 YNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVI 294
           Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V PD     
Sbjct: 246 YEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFE 304

Query: 295 GEPCHGS 301
            E  HG+
Sbjct: 305 SEAAHGT 311

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 92/196 (46%), Gaps = 27/196 (13%)

Query: 201 LTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L  T K+ +L + DG F++I  ++Y    KD++ +  I Y  +++D MV ++ +    F 
Sbjct: 211 LYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFYEHRLIDDMVAQMLKSKGGF- 269

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIGEPCHGSAP-----DIAGKGI 310
           +I   N  GD+ SD  A   GSLG++ S  + PD      E  HG+         AGK  
Sbjct: 270 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQSEAAHGTVTRHYRLHQAGKPT 329

Query: 311 A-NPIATIRSTALMLEFLGHNDAAQDIYK--------AVDANLREGAITTPDL------G 355
           + N IA+I + +  L   G  D   D+ K         +D    +G I T DL      G
Sbjct: 330 STNSIASIFAWSRGLIQRGKLDNNPDLVKFGELLEQSTLDTVQIDG-IMTKDLALLIGQG 388

Query: 356 GKASTQQVVDDVLSRL 371
             A+T+  +D V +R+
Sbjct: 389 KYATTEGFIDAVTNRM 404

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYGQ--IKY 237
            AK + ++AL+R     +  L  T K+ +L   D  F++I   ++ E  ++K+    IKY
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQALGIKY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L  T K+ +L + DG +++I  D+YE + KDK+    I Y  +++D MV ++ +    F 
Sbjct: 212 LYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF- 270

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIGEPCHGS 301
           VI   N  GD+ SD  A   GSLG++ S  +  D      E  HG+
Sbjct: 271 VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 90/186 (48%), Gaps = 19/186 (10%)

Query: 174 SEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKY 232
           ++ + R  A  +  +AL +     +  L ++ K+ +L + DG F+++ ++++++  K ++
Sbjct: 202 TDESIRGFAHASFKLALSK-----KLDLFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQF 256

Query: 233 GQ--IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
            +  I+Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 257 EESGIQYQHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 315

Query: 291 D--IVIGEPCHGSAPDIAGK------GIANPIATIRSTALMLEFLGHNDAAQDIYKAVDA 342
           D      E  HG+      K         NPIA+I +    +   G  D   D+ +   A
Sbjct: 316 DGKTFESEAAHGTVTRHYRKYQRGEETSTNPIASIFAWTRGIAKRGELDGTPDVVRF--A 373

Query: 343 NLREGA 348
           N+ E A
Sbjct: 374 NILESA 379

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L ++ K+ +L + DG F++I +++YE+  K K+ +  I Y  +++D MV ++ +    F 
Sbjct: 225 LFLSTKNTILKKYDGRFKDIFQNIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKGGF- 283

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIGEPCHGS 301
           ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 284 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 112/251 (44%), Gaps = 37/251 (14%)

Query: 103 VEGYSSPIVALRREMGLYANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKI------EKT 156
           V G+  PI+     +G +A+        G + K  D V+    T DL  +          
Sbjct: 139 VPGWEKPII-----IGRHAH--------GDQYKATDAVVPGAGTLDLVFRPADGSAPTSL 185

Query: 157 YIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGL 216
           ++    G  VA A+    E + R  A  +  +AL +     +  L ++ K+ +L Q DG 
Sbjct: 186 HVYDFAGPGVALAMYNTEE-SIRGFAHASFRLALAK-----QLNLFLSTKNTILKQYDGR 239

Query: 217 FREICKDVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGA 273
           F+++ +++Y++  K ++ +  I Y  +++D MV ++ +    F ++   N  GD+ SD  
Sbjct: 240 FKDVFEELYQAQYKAEFERLGIYYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIV 298

Query: 274 AALVGSLGVVPSANVGPD--IVIGEPCHGSAP-----DIAGKGIA-NPIATIRSTALMLE 325
           A   GSLG++ S  V PD      E  HG+         AGK  + N IA+I +    L 
Sbjct: 299 AQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHFRQHQAGKETSTNSIASIFAWTRGLA 358

Query: 326 FLGHNDAAQDI 336
             G  D   D+
Sbjct: 359 KRGELDNTPDV 369

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 97/219 (44%), Gaps = 35/219 (15%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKY 237
            AK + ++AL+R        L  T K+ +L   D  F+EI   ++++  K+K+    I Y
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 296 EPCHGSAP------DIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYK--------AVD 341
           E  HG+            +   N IA+I +    +   G  D   D+ K         +D
Sbjct: 306 EAAHGTVTRHFRQHQRGEETSTNSIASIFAWTRAIIQRGKMDGTGDVVKFGTLLEKATLD 365

Query: 342 ANLREGAITTPDLG---GKA------STQQVVDDVLSRL 371
           A  ++G + T DL    GK       +T++ +D V  RL
Sbjct: 366 AVQKDGKM-TKDLALMLGKTNRSSYLTTEEFIDAVSKRL 403

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFD 257
           L ++ K+ +L + DG F++I + VYE+  K K+    I Y  +++D MV ++ +    F 
Sbjct: 224 LFLSTKNTILKKYDGRFKDIFQKVYEAQYKSKFEALGIHYEHRLIDDMVAQMIKSKGGF- 282

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIGEPCHGS 301
           ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 93/197 (47%), Gaps = 20/197 (10%)

Query: 163 GTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICK 222
           G  VA A+    E + R  A  +  +AL +     +  L ++ K+ +L + DG F++I +
Sbjct: 187 GAGVALAMYNTDE-SIRGFAHASFKLALNK-----KLNLFLSTKNTILKKYDGRFKDIFQ 240

Query: 223 DVYESN-KDKY--GQIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGS 279
           +++++  K ++    I Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 241 EIFDAEYKTQFEAANISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 299

Query: 280 LGVVPSANVGPD--IVIGEPCHGSAPDI-----AGKGIA-NPIATIRSTALMLEFLGHND 331
           LG++ S  V PD      E  HG+          GK  + N IA+I +    L   G  D
Sbjct: 300 LGLMTSVLVTPDGKTFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKRGELD 359

Query: 332 AAQDIYKAVDANLREGA 348
              ++ K   ANL E A
Sbjct: 360 GTPEVTKF--ANLLESA 374

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 66/258 (25%), Positives = 117/258 (45%), Gaps = 29/258 (11%)

Query: 103 VEGYSSPIVALRREMGLYANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKAT 162
           V G+  PI+     +G +A+    K+ +    KP  + +V    +       + Y  K  
Sbjct: 133 VPGWEKPII-----IGRHAHADQYKATDTLVAKPGKLELVHRPEDGSEPTTLEVYDYKGP 187

Query: 163 GTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICK 222
           G  VA A+    E + R     +  +AL +     +  L ++ K+ +L + DG F++I +
Sbjct: 188 G--VALAMYNTDE-SIRGFGHASFKLALDK-----KLNLYLSTKNTILKKYDGRFKDIFQ 239

Query: 223 DVYESNK----DKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVG 278
           ++Y++      +K G I Y  +++D MV ++ +    F ++   N  GD+ SD  A   G
Sbjct: 240 ELYDTQYKAEFEKAG-IFYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFG 297

Query: 279 SLGVVPSANVGPD--IVIGEPCHGSAP-----DIAGKGIA-NPIATIRSTALMLEFLGHN 330
           SLG++ S  + PD      E  HG+          G+  + N IA+I + +  L   G  
Sbjct: 298 SLGLMTSVLITPDGKTFESEAAHGTVTRHYRQHQQGRETSTNSIASIFAWSRGLAKRGEL 357

Query: 331 DAAQDIYKAVDANLREGA 348
           D+  ++ K   ANL E A
Sbjct: 358 DSTPEVTKF--ANLLESA 373

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 89/198 (44%), Gaps = 28/198 (14%)

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---IKYNEQIVDSMVYRLFREPQCFD 257
           L  T K+ +L + DG F+++ + +YES      +   I Y  +++D MV ++ +    + 
Sbjct: 210 LYSTTKNTILKKYDGKFKDVFESLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY- 268

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIGEPCHGSAP-----DIAGKGI 310
           +I   N  GD+ SD  A   GSLG++ S  + PD      E  HG+          GK  
Sbjct: 269 IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKET 328

Query: 311 A-NPIATIRSTALMLEFLGHNDAAQDIYK-------AVDANLREGAITTPDLG---GKA- 358
           + N IA+I +    L   G  D+  D+ K       A    ++E  I T DL    GK  
Sbjct: 329 STNSIASIFAWTRGLIQRGKLDSTPDVVKFAELVESATVNTVQEDEIMTKDLALILGKTD 388

Query: 359 -----STQQVVDDVLSRL 371
                +T++ ++ V  RL
Sbjct: 389 RSSYVTTEEFIEAVHKRL 406

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY-ESNKDKYG--QIKY 237
            A+ + + AL+R     +  L  T K+ +L + DG F++I + +Y E  ++K+    I Y
Sbjct: 203 FARSSFEFALER-----KLPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWY 257

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 258 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFES 316

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 317 EAAHGT 322

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---IKY 237
            AK + ++AL+R     +  L  T K+ +L   D  F++I   ++++   +  Q   I Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQFQALGITY 246

Query: 238 NEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIG 295
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 116/272 (42%), Gaps = 32/272 (11%)

Query: 103 VEGYSSPIVALRREMGLYANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKAT 162
           V G+  PI+     +G +A+    ++ +     P  + +V              ++    
Sbjct: 129 VPGWQQPII-----IGRHAHGDQYRATDTLVPGPGKLELVFRPAGRGAAAARTLHVHDFE 183

Query: 163 GTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICK 222
           G  VA A+    E + R  A  +  +AL +     +  L +  K+ +L Q DG F+++ +
Sbjct: 184 GAGVALAMYNTDE-SIRGFAHASFRLALSK-----QLNLFLATKNTILKQYDGRFKDLFQ 237

Query: 223 DVYESN-KDKYGQ--IKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGS 279
            +Y++  ++ + +  I Y  +++D MV ++ +    F V+   N  GD+ SD  A   GS
Sbjct: 238 QLYDAEYREAFERAGISYEHRLIDDMVAQMIKSRGGF-VLALKNYDGDVQSDIVAQGFGS 296

Query: 280 LGVVPSANVGPD--IVIGEPCHGS----------APDIAGKGIANPIATIRSTALMLEFL 327
           LG++ S  + PD      E  HG+            + +   IA+  A  R  A   +  
Sbjct: 297 LGLMSSVLITPDGNAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLARRADLD 356

Query: 328 GHNDAAQDIYKAVD-ANLR---EGAITTPDLG 355
           G   A  D   A++ A LR   + AI T DL 
Sbjct: 357 G-TPAVADFAHALEGATLRTVQDDAIMTKDLA 387

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---IKYNEQIVDSMVYRLFREPQCFD 257
           L +  K+ +L + DG F++I +++YE+   K  +   I Y  +++D MV ++ +    + 
Sbjct: 222 LFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQMIKSKGGY- 280

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIGEPCHGS 301
           ++   N  GD+ SD  A   GSLG++ S    PD      E  HG+
Sbjct: 281 IMALKNYDGDVQSDIVAQGFGSLGLMTSILASPDGKTFESEAAHGT 326

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 67/134 (50%), Gaps = 13/134 (9%)

Query: 174 SEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNK---- 229
           ++ + R  A  +  +AL +     +  L ++ K+ +L   DG F++I +++Y++      
Sbjct: 198 TDESIRGFAHASFKLALTK-----KLNLFLSTKNTILKTYDGRFKDIFQELYDTQYKTEF 252

Query: 230 DKYGQIKYNEQIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG 289
           + +G I Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLG++ S    
Sbjct: 253 ENHG-IYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILAT 310

Query: 290 PD--IVIGEPCHGS 301
           PD      E  HG+
Sbjct: 311 PDGKTFESEAAHGT 324

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 322 LMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371
           LML  LG N++A  I KAV   + EG  TT D+GG +ST    ++++++L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 61/122 (50%), Gaps = 11/122 (9%)

Query: 185 ALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQ---IKYNEQI 241
           +  +AL+R     +  L  T K+ +L + DG F++I +++YE    +  +   I Y  ++
Sbjct: 204 SFKLALER-----KMPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWYEHRL 258

Query: 242 VDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVIGEPCH 299
           +D MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +  D      E  H
Sbjct: 259 IDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFESEAAH 317

Query: 300 GS 301
           G+
Sbjct: 318 GT 319

>TPHA0B01840 Chr2 complement(412955..413563) [609 bp, 202 aa] {ON}
           Anc_4.303 YKL196C
          Length = 202

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 135 KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQ 194
           +P +   + E  E+L  K  + YI+K      ADAI ++ +       KI L   ++ + 
Sbjct: 108 QPSEWENITETNENLKFKELEIYINKYQDPSQADAIMKVQQELDE--TKIVLHKTIENVL 165

Query: 195 TRGEATLTVTHKSNVLSQSDGLF 217
            RGE    +  KS  L+ S  +F
Sbjct: 166 QRGEKLDNLVDKSESLTASSKMF 188

>KNAG0A03750 Chr1 (487451..489943) [2493 bp, 830 aa] {ON} Anc_8.531
           YBR202W
          Length = 830

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 1/85 (1%)

Query: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180
           A +R V  VE  +D    + +VR + E LY    KT  D+   TR+ + IKR+S+     
Sbjct: 703 AKLRLVNRVE-VEDVEEALRLVRVSKESLYQDNTKTREDQNPTTRIYNLIKRMSQDTLEN 761

Query: 181 IAKIALDIALQRLQTRGEATLTVTH 205
              ++ D  ++ +++RG   L + +
Sbjct: 762 RGTLSYDTIVKTVRSRGFTMLQLNN 786

>NDAI0D04690 Chr4 (1101865..1102467) [603 bp, 200 aa] {ON} Anc_4.303
           YKL196C
          Length = 200

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 142 VRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATL 201
           V E  E L +K   TYI K      ADAI ++ +       KI L   ++ +  RGE   
Sbjct: 113 VTETNESLKMKELDTYITKYQDPSQADAIMKVQQELDE--TKIVLHKTIENVLQRGEKLD 170

Query: 202 TVTHKSNVLSQSDGLFREICK 222
            +  KS  L+ S  +F +  K
Sbjct: 171 NLVDKSESLTASSKMFYKQAK 191

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 4/63 (6%)

Query: 14   GLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETG 73
            GLAS     SL+ G +  + +GK V+    Q  ++L ++HG+SF F +L  G + F ET 
Sbjct: 1061 GLASPDQDASLSSGSLQSNQVGKLVVVT--QFFKDLENRHGISFLF-NLVPG-EHFPETK 1116

Query: 74   KAL 76
            + L
Sbjct: 1117 ERL 1119

>KLLA0D02684g Chr4 complement(228564..229166) [603 bp, 200 aa] {ON}
           highly similar to uniprot|P36015 Saccharomyces
           cerevisiae YKL196C YKT6 v-SNARE (synaptobrevin)
           essential for endoplasmic reticulum-Golgi transport
          Length = 200

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 2/87 (2%)

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195
           PI    V E+ + L +K    YI K      ADAI R+ +       KI L   ++ +  
Sbjct: 107 PIQWKDVTESDDSLKLKELDIYIAKYQDPSQADAIMRVQQELDE--TKITLHKTIENVLQ 164

Query: 196 RGEATLTVTHKSNVLSQSDGLFREICK 222
           RGE    +  KS  LS +  +F +  K
Sbjct: 165 RGEKLDNLVDKSESLSAASRMFYKQAK 191

>KNAG0E03840 Chr5 (760749..761351) [603 bp, 200 aa] {ON} Anc_4.303
           YKL196C
          Length = 200

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 2/82 (2%)

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195
           P D   + E  + L +   +TYI K      ADAI ++ +       KI L   ++ +  
Sbjct: 107 PADWENITETNDSLKMSELQTYISKYQDPSQADAIMKVQQELDD--TKIVLHKTIENVLQ 164

Query: 196 RGEATLTVTHKSNVLSQSDGLF 217
           RGE    +  KS  L+ S  +F
Sbjct: 165 RGEKLDNLVDKSESLTASSKMF 186

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON}
           Anc_3.455 YPR122W
          Length = 1201

 Score = 31.6 bits (70), Expect = 4.6,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 205 HKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFR-EPQCFDVIVAPN 263
           ++ N++ Q   L+R + KD  E   D  G ++ N Q++D  +  LF+  P    +    N
Sbjct: 421 NEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLD--IKYLFKGSPSITQLYSGKN 478

Query: 264 LYGDILSDG 272
            Y + ++DG
Sbjct: 479 QYSESMTDG 487

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 11/42 (26%), Positives = 24/42 (57%)

Query: 219 EICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIV 260
           ++C D  E+ KD+Y ++K N+++    +Y ++     +  IV
Sbjct: 39  QVCLDTLEAYKDEYKKLKRNDEVSQEQIYHIYESAYVYYKIV 80

>NCAS0A02760 Chr1 (527535..528137) [603 bp, 200 aa] {ON} Anc_4.303
           YKL196C
          Length = 200

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 2/82 (2%)

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195
           P +   V E  + L +K   TYI K      ADAI ++ +       KI L   ++ +  
Sbjct: 107 PQEWENVTETNDSLKMKELDTYISKYQDPSQADAIMKVQQELDE--TKIVLHKTIENVLQ 164

Query: 196 RGEATLTVTHKSNVLSQSDGLF 217
           RGE    +  KS  L+ S  +F
Sbjct: 165 RGEKLDNLVDKSESLTASSKMF 186

>SAKL0G16786g Chr7 (1450325..1450927) [603 bp, 200 aa] {ON} highly
           similar to uniprot|P36015 Saccharomyces cerevisiae
           YKL196C YKT6 v-SNARE (synaptobrevin) essential for
           endoplasmic reticulum-Golgi transport
          Length = 200

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 2/82 (2%)

Query: 136 PIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQT 195
           PI+   + E  ++L ++    YI K      AD+I ++ +       KI L   ++ +  
Sbjct: 107 PIEWKDISETNDNLKLRELDIYISKYQDPSQADSIMKVQQELDE--TKIVLHKTIESVLQ 164

Query: 196 RGEATLTVTHKSNVLSQSDGLF 217
           RGE    +  KS  LS S  +F
Sbjct: 165 RGEKLDNLVDKSESLSASSRMF 186

>Smik_11.28 Chr11 complement(59718..60320) [603 bp, 200 aa] {ON}
           YKL196C (REAL)
          Length = 200

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 2/76 (2%)

Query: 142 VRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATL 201
           V E  + L +K   TYI K      ADAI ++ +       KI L   ++ +  RGE   
Sbjct: 113 VTETNDSLKMKQLDTYISKYQDPSQADAIMKVQQELDE--TKIVLHKTIENVLQRGEKLD 170

Query: 202 TVTHKSNVLSQSDGLF 217
            +  KS  L+ S  +F
Sbjct: 171 NLVDKSESLTASSKMF 186

>Skud_15.444 Chr15 complement(783770..784570) [801 bp, 266 aa] {ON}
           YOR280C (REAL)
          Length = 266

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 18/96 (18%)

Query: 26  IGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVLK 85
           IG   G G+G  ++    +IL NL  K   +  F   ++GF+                L+
Sbjct: 114 IGFSQGAGLGGYLVTDFNKIL-NLTEKQQPALKFFISFSGFK----------------LE 156

Query: 86  DQC-QGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120
           D+  QG+   A++ P+  V G    +VA  R M LY
Sbjct: 157 DKAYQGSYDKAIEIPSLHVRGELDAVVAESRIMALY 192

>TPHA0F00920 Chr6 (211280..212206) [927 bp, 308 aa] {ON} Anc_4.158
           YGR021W
          Length = 308

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 81  IKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDKPIDMV 140
           I+ L D  +   FG V+S  TKV G  +P +    + G YA VR     E  +DK ++ V
Sbjct: 143 IEALTDN-RNRTFGFVRSAFTKVNGSMTPTLYFFDKKG-YAIVRAPIKYENDEDKILERV 200

Query: 141 IVRENTEDL 149
           +  +  EDL
Sbjct: 201 LDIKGVEDL 209

>ZYRO0A08162g Chr1 (654330..655148) [819 bp, 272 aa] {ON} similar to
           uniprot|Q07505 Saccharomyces cerevisiae YDL086W
          Length = 272

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 37  EVIPAGKQILENLNSKHGLSFNFIDLYAGFQTF--QETGKALPDETIKVLKDQCQGALF 93
            V P G+ ++ +   K G++F+F++++A    F   E+ K   D  I    D C G LF
Sbjct: 192 HVPPEGRDLIRDQLRKSGVAFSFLEVHAAQHAFIRDESSKGRYDAEI---TDSCLGFLF 247

>Suva_11.27 Chr11 complement(60006..60608) [603 bp, 200 aa] {ON}
           YKL196C (REAL)
          Length = 200

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 142 VRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATL 201
           + E  + L +K   TYI K      ADAI ++ +       KI L   ++ +  RGE   
Sbjct: 113 ITETNDSLKMKQLDTYISKYQDPSQADAIMKVQQELDE--TKIVLHKTIENVLQRGEKLD 170

Query: 202 TVTHKSNVLSQSDGLFREICK 222
            +  KS  L+ S  +F +  K
Sbjct: 171 NLVDKSESLTASSKMFYKQAK 191

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,023,293
Number of extensions: 1457167
Number of successful extensions: 4362
Number of sequences better than 10.0: 164
Number of HSP's gapped: 4137
Number of HSP's successfully gapped: 164
Length of query: 371
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 260
Effective length of database: 40,753,473
Effective search space: 10595902980
Effective search space used: 10595902980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)