Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_8.582.530ON45245221460.0
Skud_8.492.530ON44745216910.0
YHR004C (NEM1)2.530ON44645215360.0
Smik_8.532.530ON44645215160.0
KAFR0A018302.530ON44246610091e-133
NDAI0H014202.530ON44836310091e-133
NCAS0F009302.530ON4224529741e-128
KNAG0C058502.530ON4434629551e-125
SAKL0A09416g2.530ON3854529421e-124
TDEL0A030502.530ON3553849261e-122
CAGL0K02959g2.530ON4643649231e-120
Kwal_26.80012.530ON4134238701e-113
TPHA0G035002.530ON3923468671e-112
KLTH0D06776g2.530ON4094098671e-112
Kpol_348.82.530ON4223928111e-104
TBLA0I014602.530ON3933667911e-101
ZYRO0B01958g2.530ON3363437672e-98
Ecym_72572.530ON3523557511e-95
AGL070W2.530ON3433537334e-93
KLLA0E18613g2.530ON3743636476e-80
YLR019W (PSR2)5.202ON3971701835e-14
NDAI0D018605.202ON5141741846e-14
Suva_10.995.202ON3851691826e-14
Skud_12.875.202ON3921691792e-13
TBLA0C060905.202ON4841691783e-13
Smik_12.825.202ON3921701764e-13
TPHA0E030705.202ON4941691757e-13
SAKL0G12870g5.202ON3991741747e-13
Smik_12.535.202ON4141811748e-13
Kpol_2002.1005.202ON4771601741e-12
KNAG0M017405.202ON4811741712e-12
KAFR0J009905.202ON4831691704e-12
NDAI0I021705.202ON3911741675e-12
Kpol_478.165.202ON3501691666e-12
TBLA0H019905.202ON6881581688e-12
CAGL0D03234g5.202ON4101741651e-11
NCAS0D027405.202ON3981711632e-11
KLLA0F15620g5.202ON4141741632e-11
KLTH0B03388g5.202ON4091691632e-11
YLL010C (PSR1)5.202ON4271861632e-11
Kwal_33.151405.202ON4101581632e-11
Skud_12.575.202ON4151701604e-11
CAGL0D05610g5.202ON4471611605e-11
ZYRO0B10428g5.202ON4821691605e-11
Ecym_71045.202ON4921761581e-10
TDEL0E042705.202ON4531741571e-10
Suva_10.655.202ON4151691562e-10
NCAS0A068005.202ON4731741525e-10
AAL158W5.202ON4781741525e-10
TPHA0N006705.202ON4521591454e-09
TDEL0B031908.527ON4771531204e-06
YPL063W (TIM50)8.527ON4761531196e-06
TBLA0A005408.527ON4851531161e-05
SAKL0H10296g8.527ON4781091142e-05
ZYRO0F09130g8.527ON4891091142e-05
Smik_16.1728.527ON4771091107e-05
Suva_16.2498.527ON4801581108e-05
NDAI0E029108.527ON4411091099e-05
NCAS0C022108.527ON4911581099e-05
Kpol_457.58.527ON4891091081e-04
Kwal_27.119908.527ON4741091071e-04
Skud_16.2188.527ON4801531071e-04
KLTH0E12254g8.527ON4761091053e-04
CAGL0H05159g8.527ON485681053e-04
KLLA0E23101g8.527ON480681000.001
TPHA0I020008.527ON478109990.001
Ecym_11778.527ON49068930.007
KNAG0A020608.527ON450117890.024
KAFR0E010208.527ON44868890.024
ADR045W8.527ON476108870.046
KLTH0C03894g8.839ON745103830.16
CAGL0M02959g8.839ON758103790.47
TPHA0I002408.839ON732109770.75
Kwal_27.102638.839ON743103770.84
YNL321W (VNX1)3.19ON90878760.90
ZYRO0C15862g3.338ON43784741.3
NCAS0E013303.19ON102780741.7
NCAS0E019707.177ON68443732.1
NCAS0C004208.839ON725106732.5
KAFR0B009107.336ON51252713.3
Suva_13.1215.585ON44169705.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_8.58
         (452 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   831   0.0  
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   655   0.0  
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   596   0.0  
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   588   0.0  
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   393   e-133
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    393   e-133
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   379   e-128
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   372   e-125
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   367   e-124
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   361   e-122
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   360   e-120
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   339   e-113
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   338   e-112
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   338   e-112
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   317   e-104
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   309   e-101
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   300   2e-98
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   293   1e-95
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   286   4e-93
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   253   6e-80
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    75   5e-14
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     75   6e-14
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    75   6e-14
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    74   2e-13
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    73   3e-13
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    72   4e-13
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    72   7e-13
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    72   7e-13
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    72   8e-13
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    72   1e-12
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    70   2e-12
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    70   4e-12
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     69   5e-12
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    69   6e-12
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    69   8e-12
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    68   1e-11
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    67   2e-11
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    67   2e-11
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    67   2e-11
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    67   2e-11
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    67   2e-11
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    66   4e-11
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    66   5e-11
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    66   5e-11
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    65   1e-10
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    65   1e-10
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    65   2e-10
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    63   5e-10
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    63   5e-10
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    60   4e-09
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    51   4e-06
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    50   6e-06
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    49   1e-05
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    49   2e-05
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    49   2e-05
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    47   7e-05
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    47   8e-05
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    47   9e-05
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     47   9e-05
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    46   1e-04
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    46   1e-04
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    46   1e-04
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    45   3e-04
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    45   3e-04
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    43   0.001
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    43   0.001
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    40   0.007
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    39   0.024
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    39   0.024
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    38   0.046
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...    37   0.16 
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...    35   0.47 
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...    34   0.75 
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...    34   0.84 
YNL321W Chr14 (34696..37422) [2727 bp, 908 aa] {ON}  VNX1Calcium...    34   0.90 
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    33   1.3  
NCAS0E01330 Chr5 (256495..259578) [3084 bp, 1027 aa] {ON} Anc_3....    33   1.7  
NCAS0E01970 Chr5 complement(378462..380516) [2055 bp, 684 aa] {O...    33   2.1  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...    33   2.5  
KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {O...    32   3.3  
Suva_13.121 Chr13 complement(192780..194105) [1326 bp, 441 aa] {...    32   5.0  

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/452 (90%), Positives = 408/452 (90%)

Query: 1   MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS 60
           MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS
Sbjct: 1   MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS 60

Query: 61  STEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVF 120
           STEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVF
Sbjct: 61  STEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVF 120

Query: 121 TFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDL 180
           TFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDL
Sbjct: 121 TFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDL 180

Query: 181 NASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXLTNHSTANTVFGTKRMGRFL 240
           NASDEIILQRDNVKGSLLQAADGVH               LTNHSTANTVFGTKRMGRFL
Sbjct: 181 NASDEIILQRDNVKGSLLQAADGVHSAKSKSRRYSKSEASLTNHSTANTVFGTKRMGRFL 240

Query: 241 FPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYF 300
           FPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYF
Sbjct: 241 FPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYF 300

Query: 301 IHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDG 360
           IHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDG
Sbjct: 301 IHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDG 360

Query: 361 VGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWISXXXXXXX 420
           VGYIKDLSILKSSEENGKG               PVSYAMNVDNAIQVEGWIS       
Sbjct: 361 VGYIKDLSILKSSEENGKGSSLSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDL 420

Query: 421 XXXXXXXEAMRYSTDVRNILALKHGEKAFNMN 452
                  EAMRYSTDVRNILALKHGEKAFNMN
Sbjct: 421 LNLLPFLEAMRYSTDVRNILALKHGEKAFNMN 452

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/452 (74%), Positives = 356/452 (78%), Gaps = 5/452 (1%)

Query: 1   MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS 60
           MNALKYFSNHLITT KPKKTINVE+TKSQD ++ASNET  TGA +TE D  +  NHQHN 
Sbjct: 1   MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTEND-IIGGNHQHNH 59

Query: 61  STEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVF 120
           ST+     KQ+E+   SV  K KAL SIL+ KI SILW ILLFLPYYLIIKPLMSLWFVF
Sbjct: 60  STDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVF 119

Query: 121 TFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDL 180
           TFPL+VIERRVKHTDKRHKE G+SG+  ST S +  D NEK  +KN NLNTI E V+DDL
Sbjct: 120 TFPLSVIERRVKHTDKRHKEPGNSGNVSSTSSGNGNDSNEKAGSKNGNLNTIPETVDDDL 179

Query: 181 NASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXLTNHSTANTVFGTKRMGRFL 240
           NASDEIILQRDNVKGSLL+A                    LTNHS  NTVFGTKRMGRFL
Sbjct: 180 NASDEIILQRDNVKGSLLKA----QSVKSRSRSYSKSDVSLTNHSNTNTVFGTKRMGRFL 235

Query: 241 FPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYF 300
           FPKKLIPKSILNTQKKKKLVIDLDETLIHSASR TTHSNSSQGHLVEVKFGISGI TLYF
Sbjct: 236 FPKKLIPKSILNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIPTLYF 295

Query: 301 IHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDG 360
           IHKRPYCD FLTK S+WYDLIIFTASMKEYADPVIDWLE SF A+FSKRYYRSDCVLRDG
Sbjct: 296 IHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDG 355

Query: 361 VGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWISXXXXXXX 420
           VGYIKDLSI+KSSEENGKG               PVSYAMNVDNAIQVEGWIS       
Sbjct: 356 VGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDL 415

Query: 421 XXXXXXXEAMRYSTDVRNILALKHGEKAFNMN 452
                  EAMRYSTDVRNILALKHGEKAFN+N
Sbjct: 416 LNLLPFLEAMRYSTDVRNILALKHGEKAFNIN 447

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/452 (70%), Positives = 347/452 (76%), Gaps = 6/452 (1%)

Query: 1   MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS 60
           MNALKYFSNHLITT K KK INVEVTK+QD L  S E  +   S++E D   + + Q++ 
Sbjct: 1   MNALKYFSNHLITTKKQKK-INVEVTKNQDLLGPSKEVSNKYTSHSENDCVSEVDQQYDH 59

Query: 61  STEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVF 120
           S+    E  Q++E   SV  K KAL SIL EKI SILWA+LLFLPYYLIIKPLMSLWFVF
Sbjct: 60  SSSHLKESDQNQERKNSVPKKPKALRSILIEKIASILWALLLFLPYYLIIKPLMSLWFVF 119

Query: 121 TFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDL 180
           TFPL+VIERRVKHTDKR++ S  S +E    SS+  D +EK + KN NLNTI E VEDDL
Sbjct: 120 TFPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPKNCNLNTIPEAVEDDL 179

Query: 181 NASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXLTNHSTANTVFGTKRMGRFL 240
           NASDEIILQRDNVKGSLL+A                    L+NHS++NTVFGTKRMGRFL
Sbjct: 180 NASDEIILQRDNVKGSLLRA----QSVKSRPRSYSKSELSLSNHSSSNTVFGTKRMGRFL 235

Query: 241 FPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYF 300
           FPKKLIPKS+LNTQKKKKLVIDLDETLIHSASR TTHSNSSQGHLVEVKFG+SGI TLYF
Sbjct: 236 FPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYF 295

Query: 301 IHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDG 360
           IHKRPYCDLFLTK SKWYDLIIFTASMKEYADPVIDWLE SF +SFSKRYYRSDCVLRDG
Sbjct: 296 IHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDG 355

Query: 361 VGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWISXXXXXXX 420
           VGYIKDLSI+K SEENGKG               PVSYAMNVDNAIQVEGWIS       
Sbjct: 356 VGYIKDLSIVKDSEENGKG-SSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDL 414

Query: 421 XXXXXXXEAMRYSTDVRNILALKHGEKAFNMN 452
                  EAMRYSTDVRNILALKHGEKAFN+N
Sbjct: 415 LNLLPFLEAMRYSTDVRNILALKHGEKAFNIN 446

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/452 (70%), Positives = 353/452 (78%), Gaps = 6/452 (1%)

Query: 1   MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS 60
           MNALKYFSNHLITT KP+K  +VEVT +QD L  SNE  +T A++ E + T++ N   + 
Sbjct: 1   MNALKYFSNHLITTKKPRKN-HVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDH 59

Query: 61  STEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVF 120
           S++   +  Q+EE    +S K K+L SILKEKI SILWA+LLFLPYYL+IKPLMSLW+VF
Sbjct: 60  SSDHLKDFNQNEERKLFISAKPKSLRSILKEKIGSILWALLLFLPYYLVIKPLMSLWYVF 119

Query: 121 TFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDL 180
           TFPL+VIERRVKHTDKR+KES D+ +   T SS +GD +EK ++KN NLNTI E VEDDL
Sbjct: 120 TFPLSVIERRVKHTDKRNKESSDNENGSPTSSSSAGDSSEKINSKNCNLNTISETVEDDL 179

Query: 181 NASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXLTNHSTANTVFGTKRMGRFL 240
           NASDEIILQRDNVKGSLL+A                    LTNHS+ NTVFGTKRMGRFL
Sbjct: 180 NASDEIILQRDNVKGSLLRA----QSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFL 235

Query: 241 FPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYF 300
           FPKKLIPKS+LNTQKKKKLVIDLDETLIHSASR TTHSNSSQGHLVEVKFGISGI TLYF
Sbjct: 236 FPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIRTLYF 295

Query: 301 IHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDG 360
           IHKRPYCDLFLTK SKWY+LIIFTASMKEYADPVIDWLE SF +SFS+RYYRSDCVLRDG
Sbjct: 296 IHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRYYRSDCVLRDG 355

Query: 361 VGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWISXXXXXXX 420
           VGYIKDLSI+K+SEEN KG               PVSYAMNVDNAIQVEGWIS       
Sbjct: 356 VGYIKDLSIIKNSEENEKG-SSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDL 414

Query: 421 XXXXXXXEAMRYSTDVRNILALKHGEKAFNMN 452
                  EAMRYSTDVRNILALKHGEKAFN+N
Sbjct: 415 LNLLPFLEAMRYSTDVRNILALKHGEKAFNIN 446

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  393 bits (1009), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 224/466 (48%), Positives = 287/466 (61%), Gaps = 44/466 (9%)

Query: 1   MNALKYFSNH-------LITTNKPKKTINVE-VTKSQDSLSASNETFDT----GASNTEK 48
           MNAL Y +NH       L   NK K  I  E +   +D  S SN+   T     AS  + 
Sbjct: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG 60

Query: 49  DPTVKENHQHNSSTEGPNEPKQDEECTYSVSTKRKALHSIL-KEKIVSILWAILLFLPYY 107
             +VK+   HN + EG    KQ       +  KR  + S+  K  + S+L  I+LF+P Y
Sbjct: 61  LSSVKD--AHNQNVEGAIHIKQ------QIPRKRITILSVFEKFNLFSLLANIILFVPRY 112

Query: 108 LIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNR 167
           L + PL+ +WF+ T PL ++ER +K  D++ K            +   G+F E  +    
Sbjct: 113 LFLNPLIYVWFILTLPLTLVERGIKLRDRKKK------------AELRGNFGESSELSP- 159

Query: 168 NLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXLTNHSTA 227
            L +I E+ E+DL+ SDE  LQRD +KGSLL+A+                     +H   
Sbjct: 160 -LRSISEVGEEDLSTSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQ-----DHEAM 213

Query: 228 NT-VFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLV 286
           NT +FGTK+MGRFLFPKKLIP+SIL  ++KK LV+DLDETLIHS SRGTTH NSSQGHLV
Sbjct: 214 NTNIFGTKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLV 273

Query: 287 EVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASF 346
           EVKF I+GISTLY++HKRP+CDLFL+K SKWY+++IFTASMKEYADPVIDWLEGSF  +F
Sbjct: 274 EVKFSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNF 333

Query: 347 SKRYYRSDCVLRDGVGYIKDLSILKS---SEENGKGXXXXXXXXXXXXXXXPVSYAMNVD 403
           +KR YR +C+LRDGVGYIKDLS+L +   +++N                  PVSYA+NVD
Sbjct: 334 AKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVD 393

Query: 404 NAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 449
           NAIQVEGWIS              EA+RY+TDVRN+LALK+GEK F
Sbjct: 394 NAIQVEGWISDPTDTDLLNLLPILEALRYTTDVRNVLALKNGEKMF 439

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  393 bits (1009), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 246/363 (67%), Gaps = 13/363 (3%)

Query: 90  KEKIVSILWAILLFLPYYLIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPS 149
           K  + SILW+ LLF P  LIIKP++ LW++ TFPL++IER  K+  +   +S DS  E  
Sbjct: 98  KNNVTSILWSFLLFFPKILIIKPILFLWYILTFPLSLIERGTKYRMRPFSQSKDSSPEKD 157

Query: 150 TDSSHSGDFNEKQDAKNRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHXXXX 209
               H+  F  ++ +K   L+ I+E+ EDDL + D I LQRDNVKGSLL+A+        
Sbjct: 158 ETLVHNNSFLPEEPSK---LDAINELTEDDLVSGDGIYLQRDNVKGSLLKAS-------- 206

Query: 210 XXXXXXXXXXXLTNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIH 269
                      +    + NT F +KRMG+FLFPKKLIPKSI  T+++KKLV+DLDETLIH
Sbjct: 207 -SVRQPSLSRSMKTMVSNNTSFSSKRMGKFLFPKKLIPKSITQTERRKKLVLDLDETLIH 265

Query: 270 SASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKE 329
           S SRGTTH+N SQGH+VEVKF  SG+S LY++HKRPYCD FL+K  KWYDLIIFTASMKE
Sbjct: 266 SISRGTTHTNVSQGHIVEVKFSSSGVSMLYYVHKRPYCDFFLSKVCKWYDLIIFTASMKE 325

Query: 330 YADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGXXXXXXXXXX 389
           YADPVIDWLE SF  +F++RYYR+DC+ RDGVGYIKDL+I+K  + N             
Sbjct: 326 YADPVIDWLEASFQGTFTERYYRTDCIRRDGVGYIKDLTIIK-DDSNVSVPQTSTLSEVI 384

Query: 390 XXXXXPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 449
                P+SYAMN DNAIQVEGWIS              EA+RY+TDVR+ILALK+GE+AF
Sbjct: 385 ILDNSPISYAMNADNAIQVEGWISDPTDTALLNLLPLLEALRYTTDVRSILALKNGERAF 444

Query: 450 NMN 452
             N
Sbjct: 445 YAN 447

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  379 bits (974), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 208/452 (46%), Positives = 269/452 (59%), Gaps = 36/452 (7%)

Query: 1   MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS 60
           MNAL Y S+HL +     K     +   +   + +NE   + +  T        N+  + 
Sbjct: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNNEKIKSHSKATT-------NNDEDY 53

Query: 61  STEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVF 120
           ST     P  D   + ++        S    +   + W  +LF P +LI+KPL+ LWF+ 
Sbjct: 54  ST-----PMADSSSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIV 108

Query: 121 TFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDL 180
           TFPL ++ER +KH      +  ++  + +          E+    +  L  I E  EDDL
Sbjct: 109 TFPLYLLERGMKHRTLLKNKLDENSQKNA----------ERVPTTSPELTVIDETTEDDL 158

Query: 181 NASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXLTNHSTANTVFGTKRMGRFL 240
              DEI LQRD +KGSLL+A                    + + S+ NT F +KRMG+FL
Sbjct: 159 AGGDEIYLQRDTIKGSLLKATSA---------KQLSSSKTVKSISSNNTSFSSKRMGKFL 209

Query: 241 FPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYF 300
           FPKKLIP+SI+ T ++KKLV+DLDETLIHS SRGTTHSNSSQGH+VEVKF +SG+STLY+
Sbjct: 210 FPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYY 269

Query: 301 IHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDG 360
           +HKRPYCD FL+K SKWYDLIIFTASMKEYADPVIDWLE S    FS+R YR+DC+LRDG
Sbjct: 270 VHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDG 329

Query: 361 VGYIKDLSILKSSEENGK---GXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWISXXXX 417
           VGYIKDLS++  SE +G                    P+SYAMNV+NAIQVEGWIS    
Sbjct: 330 VGYIKDLSVI--SEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTD 387

Query: 418 XXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 449
                     EA+R++TDVRN+LALK+GEKAF
Sbjct: 388 NALLNLLPLLEALRFTTDVRNVLALKNGEKAF 419

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  372 bits (955), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 213/462 (46%), Positives = 278/462 (60%), Gaps = 29/462 (6%)

Query: 1   MNALKYFSNHLITTNKPK-KTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHN 59
           MN + Y + HLI   +P+ K+++ EV   +  +       +   ++ +   T     Q N
Sbjct: 1   MNTISYITQHLIYPLRPRAKSLHNEVKSGEGKVDDGVGVTENDVADGKLKTTANVEKQEN 60

Query: 60  SSTEGPNEPKQDEECTYSVSTKRKAL---------HSILKEKIVSILWAILLFLPYYLII 110
           S+ +   E   D + + +    +  +          +IL +K+ ++L  ++ FLP YLI 
Sbjct: 61  STLK---EELLDRQGSDAEKASKPIIVINDGDILNENILHQKVWNVLVFVIFFLPTYLIY 117

Query: 111 KPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLN 170
           KPL+ LWF+ T PL ++ER +K  ++   ++        +D S  G  NE+         
Sbjct: 118 KPLLLLWFLVTLPLALVERGIKLRNRPKMKTEKVSELVLSDPSKLGSINEE--------- 168

Query: 171 TIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXLTNHSTANTV 230
                VE+DL A DE  LQRD VKGSLL+A    H                      +TV
Sbjct: 169 -----VEEDLAAGDEFYLQRDIVKGSLLKATTNKHHTPLKSKKNSAQNQHGNETHPNSTV 223

Query: 231 FGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKF 290
           FGTK+MGRFLFPKKLIPKSILN +KKK LV+DLDETLIHS SRGTTH NSSQGH+VEVKF
Sbjct: 224 FGTKKMGRFLFPKKLIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPNSSQGHIVEVKF 283

Query: 291 GISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRY 350
            ISG+STLY++ KRPYCDLFLTK SKWYD++IFTASMKEYADPVIDWLE SFA  FS+R 
Sbjct: 284 SISGVSTLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFSRRL 343

Query: 351 YRSDCVLRDGVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEG 410
           YR+DC+LRDGVGYIKDL ++  +  +  G               PVSYA+NVDNAIQVEG
Sbjct: 344 YRNDCILRDGVGYIKDLKMV--TRGSNLGTSPDRLEDVIIVDNSPVSYALNVDNAIQVEG 401

Query: 411 WISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFNMN 452
           WI+              EA+  +TDVRNIL+LK+GEKAFN++
Sbjct: 402 WINDPTDTDLLNLIPLLEALENTTDVRNILSLKNGEKAFNID 443

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  367 bits (942), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 214/452 (47%), Positives = 276/452 (61%), Gaps = 68/452 (15%)

Query: 1   MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS 60
           MNA+ Y +NH+     PK                    FD  A++ +KD    + H   S
Sbjct: 1   MNAISYITNHV---TPPK--------------------FDE-ANSIKKDQADAQAHGTVS 36

Query: 61  STEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVF 120
            +E  N P+ DE+   +    +KA         +S+LW+I+LFLP + IIKP++  W++ 
Sbjct: 37  KSE-QNAPEDDEDKNQT----KKATK-------LSLLWSIILFLPNFFIIKPVLFFWYII 84

Query: 121 TFPLNVIERR-VKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDD 179
           TFPLN+IE       D+R+ E G+S          +GD     + K  ++N I E  E+D
Sbjct: 85  TFPLNLIEHSPADDEDERNGEEGNS----------TGD-----EEKTPSINIIVEEDEED 129

Query: 180 LNASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXLTNHSTANTVFGTKRMGRF 239
           L A DEIILQ D VKGSL      +                + + ST  T  G++RMGRF
Sbjct: 130 L-AGDEIILQTDAVKGSL----STISESQQVKTIKASTRSSIRSGSTG-TALGSRRMGRF 183

Query: 240 LFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLY 299
           LFPKKLIP+S+LN +KKK LV+DLDETLIHS SRGT+ SNSSQGH+VEVKF +SGIS+LY
Sbjct: 184 LFPKKLIPQSVLNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFAVSGISSLY 243

Query: 300 FIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRD 359
           F+HKRPYCDLFL+K +KWY L++FTASMKEYADPVIDWLE SF+ SFS+R YR DC+LRD
Sbjct: 244 FVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRD 303

Query: 360 GVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWISXXXXXX 419
           GVGYIKDLS++     N                  P+SYAMNVDNAIQVEGWIS      
Sbjct: 304 GVGYIKDLSLISKKSLN----------EIIIVDNSPISYAMNVDNAIQVEGWISDPTDTD 353

Query: 420 XXXXXXXXEAMRYSTDVRNILALKHGEKAFNM 451
                   EA+R++TD+RN+L+LK GE+AFN+
Sbjct: 354 LLNLLPLLEALRFTTDIRNVLSLKSGEQAFNI 385

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  361 bits (926), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 186/384 (48%), Positives = 239/384 (62%), Gaps = 47/384 (12%)

Query: 66  NEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVFTFPLN 125
           N   +D E   +V  + K +    + K  S  WA++LF P +LIIKP   +W++ + PL 
Sbjct: 17  NGKTEDVEDKVAVQKREKIVRR--RSKFTSYAWAVILFFPQWLIIKPTQLIWWIISLPLL 74

Query: 126 VIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDLNASDE 185
           +IE  +K   +R      +G                       L +I E+ EDDL   DE
Sbjct: 75  LIEYGLKSRLQRKSTKRSTG----------------------TLQSISELEEDDLAGGDE 112

Query: 186 IILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXLTNHSTANTVFGTKRMGRFLFPKKL 245
           I LQRD VKGSL  A                     +   ++  + GTKRMGRFLFPKKL
Sbjct: 113 IFLQRDAVKGSLAPA---------------KYRRSRSGSRSSTVMLGTKRMGRFLFPKKL 157

Query: 246 IPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRP 305
           IP+S+L+ +K+K+LV+DLDETLIHSASR T+HSNS+QGH+VE++F ISG+STLY++HKRP
Sbjct: 158 IPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRP 217

Query: 306 YCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIK 365
           +CDLFL+K SKWYDL++FTASM+EYADPVIDWLEGSF+  FSKR YR++C+LRDGVGYIK
Sbjct: 218 HCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIK 277

Query: 366 DLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWISXXXXXXXXXXXX 425
           DLSI+                        P+SYAMNVDNAIQVEGWIS            
Sbjct: 278 DLSIVCGP--------TVTLGEVILVDNSPISYAMNVDNAIQVEGWISDPSDTDLLTLLP 329

Query: 426 XXEAMRYSTDVRNILALKHGEKAF 449
             EA+RY+TDVR+ILALK+ E+AF
Sbjct: 330 FLEALRYTTDVRDILALKNSEQAF 353

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  360 bits (923), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 184/364 (50%), Positives = 234/364 (64%), Gaps = 24/364 (6%)

Query: 92  KIVSILWAILLFLPYYLIIKPLMSLWFVFTFPLNVIE----RRVKHTDKRHKESGDSGHE 147
           K   ++W+I+ F P Y++IKP + +WF+ TFPL++IE    RR K T+  H         
Sbjct: 120 KFFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEH-----LSQS 174

Query: 148 PSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHXX 207
           P+T+         K ++ ++ LN I E +EDDL + + + LQ+D +KGSLL         
Sbjct: 175 PATN---------KDNSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTN---KDS 222

Query: 208 XXXXXXXXXXXXXLTNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETL 267
                         +  S  + + GTK MGRF FPKKLIP+SIL ++KKK LVIDLDETL
Sbjct: 223 SQNSSQKDRGKKTTSTPSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETL 282

Query: 268 IHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASM 327
           IHS SRGTTHSNSSQ H++EV+F ISG+STLY++HKRPYCDLFL+K  KWY+LIIFTASM
Sbjct: 283 IHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASM 342

Query: 328 KEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGXXXXXXXX 387
           KEYADPVIDWLE SF+ SF++R YR+ C+ RDGVGYIKDL  +K                
Sbjct: 343 KEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN---ATIPLTD 399

Query: 388 XXXXXXXPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEK 447
                  PVSYAM+VDNAIQVEGWIS              EA+RY+TDVRN+LALK+ EK
Sbjct: 400 VVIIDNSPVSYAMHVDNAIQVEGWISDPTDTELLNLLPFLEALRYTTDVRNVLALKNSEK 459

Query: 448 AFNM 451
           AF +
Sbjct: 460 AFQL 463

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  339 bits (870), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/423 (47%), Positives = 251/423 (59%), Gaps = 47/423 (11%)

Query: 55  NHQHNSSTEGPNEPKQDEECTYSVSTKRKALHSILKEKIV--------SILWAILLFLPY 106
           N+      EGP+   ++ E +  V+      +  LK K          + LW+IL+FLP 
Sbjct: 9   NNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRWAFLWSILVFLPN 68

Query: 107 YLIIKPLMSLWFVFTFPLNVIER-----RVKHTDKRHKESGD--SGHEPSTDSSHSGDFN 159
            L++KP++ +WFV TFPL++IER         T+   + +G+  S  + ST S   G   
Sbjct: 69  LLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVG--- 125

Query: 160 EKQDAKNRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXX 219
               +K R +NTI E  EDD    DEI LQ D VKGS L A + V               
Sbjct: 126 ----SKPR-INTIQE--EDDDLGGDEIFLQPDTVKGS-LTATNCVPPEHSQDLSRRQQHS 177

Query: 220 XLTNH------------STANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETL 267
             +              S+A T  G++RMGRFLFPKKLIP+S+LN +K + LV+DLDETL
Sbjct: 178 KGSRQSPKAASVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETL 237

Query: 268 IHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASM 327
           IHS SRGT+ SNSSQGH+VEVKF ISGISTLY +HKRPYCDLFLT  + WY+L++FTASM
Sbjct: 238 IHSMSRGTSSSNSSQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASM 297

Query: 328 KEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGXXXXXXXX 387
           KEYADPVIDWLE SF   FS+R YR DC+LRDGVGYIKDLS +  +              
Sbjct: 298 KEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPN---------TLLSD 348

Query: 388 XXXXXXXPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEK 447
                  PVSYAM+VDNAIQVEGWIS              EA+R++TDVRNILALK GE 
Sbjct: 349 IFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEH 408

Query: 448 AFN 450
           AF+
Sbjct: 409 AFS 411

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  338 bits (867), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 233/346 (67%), Gaps = 8/346 (2%)

Query: 111 KPLMSLWFVFTFPLNVIERRVKHTDK-RHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNL 169
           KPL+  W++ TFPL + E+   +  + R  ++ +S  + S+ ++++  +  K   +   L
Sbjct: 51  KPLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQL 110

Query: 170 NTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXLTNHSTANT 229
             +  ++EDD+    E+ILQRD VKGSLL A++                    + S A  
Sbjct: 111 QNLDSVLEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVA-- 167

Query: 230 VFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVK 289
            FGTK+MGRFLFPKKLIP+SIL++ +KKKLV+DLDETLIHS SR  ++SN++Q HLVEVK
Sbjct: 168 -FGTKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSNSNSNNAQAHLVEVK 226

Query: 290 FGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKR 349
           F ISGISTLY++HKRPYCDLFL+  SKWYDLIIFTASMKEYADPVIDWLE SF  +FSKR
Sbjct: 227 FQISGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKR 286

Query: 350 YYRSDCVLRDGVGYIKDLSILKSSEE---NGKGXXXXXXXXXXXXXXXPVSYAMNVDNAI 406
           YYR+ C+LRDGVGYIKDLSI+  + +   N                  PVSYAMNVDNAI
Sbjct: 287 YYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAI 346

Query: 407 QVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFNMN 452
           QVEGWIS              E++RY+TDVRNIL+LK+GE+AF++N
Sbjct: 347 QVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  338 bits (867), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 188/409 (45%), Positives = 246/409 (60%), Gaps = 33/409 (8%)

Query: 57  QHNSSTEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSL 116
           +H  ST  P+  +  E+    +    K      K    ++LW++L FLP  +++KP++ +
Sbjct: 15  KHEESTATPHRVEDSEKANARIDVAPKEAQK-RKRARWTLLWSMLAFLPNLIVVKPVLFV 73

Query: 117 WFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIV 176
           WFV TFPL++IER    + +      D+    S   + +G  + K  ++   ++TI E  
Sbjct: 74  WFVITFPLSLIER--ASSSENQGMGFDNAEGDSKSEASAGTISPKNSSR---ISTITE-E 127

Query: 177 EDDLNASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXLTNHST---------- 226
           EDDL A +E+ILQ D VKGSL   +                       ++          
Sbjct: 128 EDDL-AGEEMILQADTVKGSLTVTSGAKERPQDKGRRQPLQPQQQQPKTSRQSLKTSSVR 186

Query: 227 ------ANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNS 280
                 A T  G++RMGRFLFPKKLIP+S+LN +K++ LV+DLDETLIHS SRGT+ SNS
Sbjct: 187 SGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHSMSRGTSSSNS 246

Query: 281 SQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEG 340
           SQGH+VEVKF  SGISTLY +HKRPYCDLFLTK +KWY+L++FTASMKEYADPVIDWLE 
Sbjct: 247 SQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLES 306

Query: 341 SFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAM 400
           SF   FS+R YR DC+LRDGVGYIKDLS++  +                     PVSYAM
Sbjct: 307 SFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPN---------ASLSDIFIIDNSPVSYAM 357

Query: 401 NVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 449
           +VDNAIQVEGWIS              EA+R++TD+RN+LALK GE AF
Sbjct: 358 HVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLALKSGEHAF 406

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  317 bits (811), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 177/392 (45%), Positives = 229/392 (58%), Gaps = 66/392 (16%)

Query: 95  SILWAILLFLPYYLIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSH 154
           S L  +LLF P YL++KP+  LWF+ TFP+ + E++ K   K                  
Sbjct: 62  STLVLVLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPKS----------------- 104

Query: 155 SGDFNEKQDAKNRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQA-ADGVHXXXXXXXX 213
           S + +    +KN N+     +VE+DL+   EIILQRD + GSLL++ A+  H        
Sbjct: 105 SANLDTMSKSKNLNI-----LVEEDLSGGGEIILQRDTLNGSLLKSRANQQHSHQSRHAK 159

Query: 214 XXXXXXXLTNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASR 273
                  L           +K++GRFLFPKKLIP+SIL++ +KKKLV+DLDETLIHS SR
Sbjct: 160 SSSSSVGLI----------SKKIGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISR 209

Query: 274 GTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADP 333
            T +SN++Q HLVEVKF ISGISTLY++HKRPYCDLFL+K  +WYDLIIFTASMKEYADP
Sbjct: 210 STPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADP 269

Query: 334 VIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXX 393
           VIDWLE SF  SFSKR+YR+DC+LRDGVGYIKDLSI+ +   +                 
Sbjct: 270 VIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGSHAASTTSHNNHNNNNNS 329

Query: 394 XP----------------------VSYAMNVDN-----------AIQVEGWISXXXXXXX 420
                                   +S  + +DN           AIQV+GWIS       
Sbjct: 330 NTNSNDNNDNNDTNAHTHQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDL 389

Query: 421 XXXXXXXEAMRYSTDVRNILALKHGEKAFNMN 452
                  E++R +TDVRNIL+LK+GE+AFN+N
Sbjct: 390 LNLLPFLESLRNTTDVRNILSLKNGERAFNVN 421

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  309 bits (791), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 219/366 (59%), Gaps = 52/366 (14%)

Query: 106 YYLIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAK 165
           + ++IKPL+ LW++FTFPL +IE+   HT++++K++     +P   SS + D        
Sbjct: 55  FAILIKPLIFLWYIFTFPLLLIEQ---HTNRKYKDTP-PLIDPKIASSSATDL------- 103

Query: 166 NRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXL---- 221
                       DDLN++DEIILQ D++KGSLL+  +                  L    
Sbjct: 104 ------------DDLNSNDEIILQTDSIKGSLLEKKNTSAAATPSATPPATSPSPLVIKQ 151

Query: 222 ------TNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGT 275
                 + +S  +   G+K MGRFLFPKKLIP SIL T K+KKL++DLDETLIHS SR  
Sbjct: 152 KKIQNKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNI 211

Query: 276 THSNSSQGHLVEVKFGIS------------GISTLYFIHKRPYCDLFLTKASKWYDLIIF 323
           + S  S  HL+EVKF                +S+LY+++KRPYCD FL   S WYDLIIF
Sbjct: 212 SSSTISNYHLIEVKFPTPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIF 271

Query: 324 TASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGXXXX 383
           TASMKEYADPVIDWLE SF  +F KR YR+ C+LRDG+GYIKDLS+L +  ++       
Sbjct: 272 TASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQS------- 324

Query: 384 XXXXXXXXXXXPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALK 443
                      P+S+AMNVDNAIQV+GWIS              E++R++TDVRNILALK
Sbjct: 325 TLNELILIDNSPISFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNILALK 384

Query: 444 HGEKAF 449
           +GE+AF
Sbjct: 385 NGERAF 390

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  300 bits (767), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 169/343 (49%), Positives = 206/343 (60%), Gaps = 65/343 (18%)

Query: 108 LIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNR 167
           + +KP   +WFV T PL +IE  +K   K+  ES          +S  G+   K++    
Sbjct: 59  IFLKPFHLIWFVITSPLILIEYGLK--SKQKVES----------TSRKGEIIRKKE---- 102

Query: 168 NLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXXXXXXLTNHSTA 227
                   V+DDL A DE+ LQRD VKG L   A                          
Sbjct: 103 --------VDDDL-AEDEMFLQRDTVKGGLRGKA-------------------------- 127

Query: 228 NTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVE 287
              FGTK+MGRFLFPKKL+P+SIL  ++KK+LV+DLDETLIHSA+R  +HSNS+QGH+VE
Sbjct: 128 ---FGTKKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVE 184

Query: 288 VKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFS 347
           V+F  S ISTLY++HKRP+CDLFL+K SKWYDLIIFTASMKEYADPVIDWLE SF   F 
Sbjct: 185 VRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFC 244

Query: 348 KRYYRSDCVLRDGVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQ 407
           KR YR +CV+R+GVGYIKDLS++    +                   P SYA N DNAIQ
Sbjct: 245 KRLYRHNCVVREGVGYIKDLSVVTEVLDE-----------VVLIDNSPTSYARNEDNAIQ 293

Query: 408 VEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFN 450
           VEGWIS              EA+RY TDVR+IL LK+GEKA  
Sbjct: 294 VEGWISDPSDTDLLNLLPLLEALRYVTDVRSILGLKNGEKALG 336

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  293 bits (751), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 165/355 (46%), Positives = 220/355 (61%), Gaps = 57/355 (16%)

Query: 95  SILWAILLFLPYYLIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSH 154
           S +W ++ FLP +LIIKP+  +WFV TFPLN+IE    HT  +     +    P T+S  
Sbjct: 54  SWVWRVVFFLPTWLIIKPIWLIWFVLTFPLNLIE----HTSSKDGSVEEEEVIP-TNSQG 108

Query: 155 SGDFNEKQDAKNRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHXXXXXXXXX 214
           SG                 E++EDD    + ++L  D++K                    
Sbjct: 109 SGG---------------GEVIEDDDLVGESMVLHEDSIK-------------------- 133

Query: 215 XXXXXXLTNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRG 274
                  +  ST+ + + + R+G+FLFPKKLIP+SIL T +KK LV+DLDETLIHS SR 
Sbjct: 134 ------SSRPSTSRSSYTSTRLGKFLFPKKLIPQSILQTDRKKVLVLDLDETLIHSMSRS 187

Query: 275 TTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPV 334
           T+ SN+SQGH+VEV F +SG+S+LY++HKRPYCDLFL++  KWYDL+IFTASM+EYADPV
Sbjct: 188 TSSSNTSQGHMVEVTFSVSGVSSLYYVHKRPYCDLFLSRVCKWYDLVIFTASMREYADPV 247

Query: 335 IDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXX 394
           IDWLE   +A F+KR YRSDC+LRDG+GY+KDL+++  + ++                  
Sbjct: 248 IDWLESGISARFTKRKYRSDCILRDGIGYVKDLTMISKNLQD-----------TIIVDNS 296

Query: 395 PVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 449
           PVSYAMNVDNAIQVEGWIS              E +R++TD RNIL+LK+GE AF
Sbjct: 297 PVSYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  286 bits (733), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 161/353 (45%), Positives = 214/353 (60%), Gaps = 60/353 (16%)

Query: 97  LWAILLFLPYYLIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSG 156
           +W +L FLP +L++KP++ +WFV TFPL++IE       +   +  D    P        
Sbjct: 50  VWRVLFFLPKWLVVKPVVLVWFVLTFPLSLIE-------QTSSKEADGAPGPEAAEEEQ- 101

Query: 157 DFNEKQDAKNRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXX 216
                             + +DDL A + ++LQ D+VK                      
Sbjct: 102 --------------LAEAVEDDDL-AGESMVLQEDSVK---------------------- 124

Query: 217 XXXXLTNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTT 276
                +  ST+ + + + R+G+FLFPKKLIP+SIL T +KK LV+DLDETLIHS SR T+
Sbjct: 125 ----SSRPSTSRSSYTSTRLGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHSMSRSTS 180

Query: 277 HSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVID 336
             ++SQGH+VEV F  SG+STLY++HKRPYCDLFL++ SKWYDL+IFTASMKEYADPVID
Sbjct: 181 SVSNSQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVID 240

Query: 337 WLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPV 396
           WLE   +  FS+R YRSDC+LRDGVGY+KDLSI+  + ++                  P+
Sbjct: 241 WLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQD-----------IIIVDNSPI 289

Query: 397 SYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 449
           SYAMNVDNAIQVEGWIS              E +R++TD RNIL+LK+GE+AF
Sbjct: 290 SYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  253 bits (647), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 139/363 (38%), Positives = 198/363 (54%), Gaps = 68/363 (18%)

Query: 97  LWAILLFLPYYLIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSG 156
           +W IL+FLP YL+IKP++++W+V TFPLN++E   +         G+ G           
Sbjct: 70  IWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQ---------GNKGL---------I 111

Query: 157 DFNEKQDAKNRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHXXXXXXXXXXX 216
               + D++   L+    +VE+DL+ +DEII+ +D +K   +                  
Sbjct: 112 QVGSETDSRTEKLS--KYVVEEDLSPTDEIIINQDKMKPRPI------------------ 151

Query: 217 XXXXLTNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTT 276
                           T+ +G+F FPKKL+P+S+L +  +K LV+DLDETLIHS S   +
Sbjct: 152 ----------------TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRS 195

Query: 277 HSNSSQG---------HLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASM 327
             N +           HLVEV+F  + ISTLY + KRPYCD+FL + S+WYD+ IFTASM
Sbjct: 196 LGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASM 255

Query: 328 KEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGXXXXXXXX 387
           KEYADPVIDWL+ + +  F  R+YR DC LR GVGY+KD+  + +  E  +         
Sbjct: 256 KEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRD-----LSQ 310

Query: 388 XXXXXXXPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEK 447
                  P+SYAM++DNAIQV GWI+              +AMR+ TD R ILALK G  
Sbjct: 311 MIIIDNSPISYAMHLDNAIQVHGWINDPSDSELLHLLPLLKAMRHVTDSRCILALKSGRA 370

Query: 448 AFN 450
           + +
Sbjct: 371 SIS 373

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 89/170 (52%), Gaps = 22/170 (12%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHL-VEVKFGISGISTLYFIHK 303
           L+P  +   Q+KK L++DLDETL+HS+ +   + +S+   L VE+   +  +    ++ K
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHSSFK---YMHSADFVLPVEIDDQVHNV----YVIK 268

Query: 304 RPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGY 363
           RP  D FL + S+ Y++++FTAS+  YA+P++D L+ +   +   R +R  C   +G  Y
Sbjct: 269 RPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NY 325

Query: 364 IKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           IK+LS +      G+                P SY  +  +A+ +  W S
Sbjct: 326 IKNLSQI------GR-----PLSETIILDNSPASYIFHPQHAVPISSWFS 364

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 81/174 (46%), Gaps = 29/174 (16%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGI-----SGISTLY 299
           L PK  +  + KK LV+DLDETL+HS+ +          +L    F +       I  +Y
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFK----------YLPNADFNLPVNIDDQIHNVY 381

Query: 300 FIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRD 359
            I KRP  D FL K  K ++++IFTAS+  Y DP++D L+     S   R +R  C   +
Sbjct: 382 VI-KRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPK-GKSIHHRLFREACYNYE 439

Query: 360 GVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           G  YIK+LS +      G+                P SY  +  +AI +  W S
Sbjct: 440 G-NYIKNLSQM------GR-----PLSEIIILDNSPASYIFHPQHAIPISSWFS 481

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 87/169 (51%), Gaps = 20/169 (11%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKR 304
           L+P  +L  Q+KK L++DLDETL+HS+ +    ++      VE+   +  +    ++ KR
Sbjct: 204 LLPPKLLPFQQKKCLILDLDETLVHSSFKYLHTADFVLP--VEIDDQVHNV----YVIKR 257

Query: 305 PYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYI 364
           P  D FL + S+ Y++++FTAS+  YA+P++D L+ +   +   R +R  C   +G  YI
Sbjct: 258 PGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPN--RTIHHRLFREACYNYEG-NYI 314

Query: 365 KDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           K+LS +      G+                P SY  +  +A+ +  W S
Sbjct: 315 KNLSQI------GRP-----LSETIILDNSPASYIFHPQHAVPISSWFS 352

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 86/169 (50%), Gaps = 20/169 (11%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKR 304
           L+P  +   Q+KK L++DLDETL+HS+ +    ++      VE+   +  +    ++ KR
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 305 PYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYI 364
           P  D FL + S+ Y++++FTAS+  YA+P++D L+ +   +   R +R  C   +G  YI
Sbjct: 265 PGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 321

Query: 365 KDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           K+LS +      G+                P SY  +  +A+ +  W S
Sbjct: 322 KNLSQI------GRP-----LSETIILDNSPASYIFHPQHAVPISSWFS 359

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 83/169 (49%), Gaps = 18/169 (10%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKR 304
           L+P      + KK L++DLDETL+HS+ +   + +     ++ ++     I  +Y I KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINNPD----FILPIEIEDGQIHNVYVI-KR 355

Query: 305 PYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYI 364
           P  D FL +  KWY+++IFTAS+  YA+P++D L+       + R +R  C   +   +I
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNL-INHRLFRDACYNYEN-NFI 413

Query: 365 KDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           K+LS +      G+                P SY  +  +AI +  W S
Sbjct: 414 KNLSQI------GRP-----LHDIIILDNSPASYIFHPQHAIPISSWFS 451

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 89/170 (52%), Gaps = 22/170 (12%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHL-VEVKFGISGISTLYFIHK 303
           L+P  +   Q+KK L++DLDETL+HS+ +   + +++   L VE+   +  +    ++ K
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFK---YMHTADFVLPVEIDDQVHNV----YVIK 263

Query: 304 RPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGY 363
           RP  D FL++  + Y++++FTAS+  YA+P++D L+ +   +   R +R  C   +G  Y
Sbjct: 264 RPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NY 320

Query: 364 IKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           IK+LS +      G+                P SY  +  +A+ +  W S
Sbjct: 321 IKNLSQI------GR-----PLSETIILDNSPASYIFHPQHAVPISSWFS 359

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 82/169 (48%), Gaps = 19/169 (11%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKR 304
           L PK I    +KK L++DLDETL+HS+ +       S   ++ V   I   +   ++ KR
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYV----DSADFVIPVT--IDNQTHHVYVIKR 365

Query: 305 PYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYI 364
           P  D FL + S+ Y++++FTAS+  Y DP+++ L+ +       R +R  C   +G  Y+
Sbjct: 366 PGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTI-IHHRLFRESCYTYEG-NYV 423

Query: 365 KDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           K+LS L      G+                P SY  +  +AI +  W S
Sbjct: 424 KNLSQL------GRP-----LNEIIILDNSPASYIFHPQHAIPISSWFS 461

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 81/174 (46%), Gaps = 30/174 (17%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGIS-----GISTLY 299
           L+P      + KK LV+DLDETL+HS+ +          +L    F I       +  +Y
Sbjct: 218 LLPPKDPVFEGKKCLVLDLDETLVHSSFK----------YLRTADFVIPVEIDDQVHNVY 267

Query: 300 FIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRD 359
            I KRP  D FL +  K Y++++FTAS+  Y DP++D L+   A     R +R  C   D
Sbjct: 268 VI-KRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHH--RLFRDSCYNYD 324

Query: 360 GVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           G  YIK+LS +      G+                P SY ++  +AI +  W S
Sbjct: 325 G-NYIKNLSQI------GR-----PLSDLIILDNSPASYILHPQHAIPISSWFS 366

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 88/181 (48%), Gaps = 22/181 (12%)

Query: 235 RMGRFLFP--KKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGI 292
           + G++  P  K L+P    NT+ KK L++DLDETL+HS+ +       S   ++ V+   
Sbjct: 221 QQGQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLR----SADFVLPVEID- 275

Query: 293 SGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYR 352
             +  +Y I KRP  + FL +  K +++++FTAS+  Y DP++D L+         R +R
Sbjct: 276 DQVHNVYVI-KRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDADKV--IHHRLFR 332

Query: 353 SDCVLRDGVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWI 412
             C   +G  YIK+LS +      G+                P SY  +  +AI +  W 
Sbjct: 333 EACYNYEG-NYIKNLSQI------GR-----PLSDIIILDNSPASYIFHPQHAIPISSWF 380

Query: 413 S 413
           S
Sbjct: 381 S 381

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 78/160 (48%), Gaps = 20/160 (12%)

Query: 254 QKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTK 313
           + KK LV+DLDETL+HS+ +    ++        +   I   +   ++ KRP  D FL +
Sbjct: 305 KNKKCLVLDLDETLVHSSFKYIDTAD------FVLPVTIDDQTHQVYVIKRPGVDEFLKR 358

Query: 314 ASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSS 373
             K +++++FTAS+  Y DP++D L+ S   S   R +R  C + DG  Y+K+LS +   
Sbjct: 359 VGKIFEVVVFTASVSRYGDPLLDILDSS--KSIHHRLFRESCYIYDG-NYVKNLSQI--- 412

Query: 374 EENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
              G+                P SY  +  +AI +  W S
Sbjct: 413 ---GR-----PLSDIIILDNSPASYIFHPQHAIPISSWFS 444

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 78/174 (44%), Gaps = 30/174 (17%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGI-----SGISTLY 299
           L+P        +K LV+DLDETL+HS+ +          +L    F +       I  +Y
Sbjct: 300 LLPPPSKAVSHRKCLVLDLDETLVHSSFK----------YLKSADFVLPVDIDDQIHNVY 349

Query: 300 FIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRD 359
            I KRP  D FL +  K Y++++FTAS+  Y DP++D L+     S   R +R  C   +
Sbjct: 350 VI-KRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKD--KSIHHRLFREACYNYE 406

Query: 360 GVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           G  YIK+LS +     N                  P SY  +  +AI +  W S
Sbjct: 407 G-NYIKNLSQIGRPLSN-----------IIILDNSPASYIFHPQHAIPISSWFS 448

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 81/169 (47%), Gaps = 20/169 (11%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKR 304
           L+P    +  +KK LV+DLDETL+HS+ +       S   ++ V      I  +Y I KR
Sbjct: 302 LLPPPEKSLSRKKCLVLDLDETLVHSSFKYL----KSADFVLPVDID-DQIHNVYVI-KR 355

Query: 305 PYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYI 364
           P  D FL +  + +++++FTAS+  Y DP++D L+     S   R +R  C   +G  YI
Sbjct: 356 PGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDK--GKSIHHRLFREACYNYEG-NYI 412

Query: 365 KDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           K+LS L      G+                P SY  +  +AI +  W S
Sbjct: 413 KNLSQL------GRP-----LSDIIILDNSPASYIFHPQHAIPISSWFS 450

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 81/174 (46%), Gaps = 26/174 (14%)

Query: 243 KKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGIS---GISTLY 299
           + L+P        KK LV+DLDETL+HS+ +          H  +    +     I  +Y
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVY 259

Query: 300 FIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRD 359
            I KRP  D FL + ++ Y++++FTAS+  Y DP++D L+ S   S   R +R  C   +
Sbjct: 260 VI-KRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSS--NSIHHRLFREACYNYE 316

Query: 360 GVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           G  Y+K+L+ +      G+                P SY  +  +AI +  W S
Sbjct: 317 G-NYVKNLAQI------GRP-----LSEIVILDNSPASYMFHPQHAIPISSWFS 358

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 85/169 (50%), Gaps = 19/169 (11%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKR 304
           L+P    + Q +K LV+DLDETL+HS+ +  + ++      ++ +F       +Y I KR
Sbjct: 168 LLPPIQQSLQNRKCLVLDLDETLVHSSFKYVSTADFVLPVDIDDQF-----QNVYVI-KR 221

Query: 305 PYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYI 364
           P  D FL   SK ++++IFTAS+++Y +P++D L+ +       R +R  C   +G  YI
Sbjct: 222 PGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDST-NDLVHHRLFRDACYNYNG-NYI 279

Query: 365 KDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           K+L+ L     +                  P SY  + ++AI +  W S
Sbjct: 280 KNLAQLGRPLSD-----------IIILDNSPTSYLFHPNHAIPISSWFS 317

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 69.3 bits (168), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 76/158 (48%), Gaps = 20/158 (12%)

Query: 256 KKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKAS 315
           KK L++DLDETL+HS+ +  T    S   ++ V      I  +Y I KRP  D FL   S
Sbjct: 518 KKCLILDLDETLVHSSFKYLT----SADFVIPVDID-EQIHNVYVI-KRPGVDQFLETVS 571

Query: 316 KWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEE 375
           K +++++FTAS+  Y DP++D L+         R +R  C   +G  YIK+LS +     
Sbjct: 572 KIFEVVVFTASVSRYGDPLLDVLDKHRC--IHHRLFREACYDYEG-NYIKNLSQI----- 623

Query: 376 NGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
            G+                P SY  +  +AI +  W S
Sbjct: 624 -GRP-----LSELIILDNSPASYIFHPQHAIPISSWFS 655

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 80/174 (45%), Gaps = 30/174 (17%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGI-----SGISTLY 299
           L+P      + KK LV+DLDETL+HS+ +          +L    F +       +  +Y
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFK----------YLRTADFVLPVNIDDQVHNVY 278

Query: 300 FIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRD 359
            I KRP  D FL +  + Y++++FTAS+  Y DP++D L+     S   R +R  C   +
Sbjct: 279 VI-KRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQH--KSIHHRLFREACYNYE 335

Query: 360 GVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           G  YIK+LS +      G+                P SY  +  +AI V  W S
Sbjct: 336 G-NYIKNLSQI------GR-----PLSEIIILDNSPASYIFHPQHAIPVSSWFS 377

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 86/171 (50%), Gaps = 25/171 (14%)

Query: 248 KSILNTQK-----KKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIH 302
           K++L+ +K     KK LV+DLDETL+HS+ +    ++      VE++  I  +    ++ 
Sbjct: 215 KTLLSPRKPEFSNKKCLVLDLDETLVHSSFKYVRTADFVLP--VEIEDQIHNV----YVI 268

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP  D FL +  + Y++++FTAS+  Y DP+++ L+ S   S   R +R  C   +G  
Sbjct: 269 KRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQS--NSVHHRLFREACYNYEG-N 325

Query: 363 YIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           YIK+L+ +      G+                P SY  +  +AI +  W S
Sbjct: 326 YIKNLAQI------GRP-----LSDIIILDNSPASYMFHPQHAIPISSWFS 365

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 84/174 (48%), Gaps = 31/174 (17%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGI-----SGISTLY 299
           L+PK+ +  + KK LV+DLDETL+HS+ +          +L    F I     + +  +Y
Sbjct: 234 LLPKADM-FKGKKCLVLDLDETLVHSSFK----------YLRTADFVIPVEIDNQVHNVY 282

Query: 300 FIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRD 359
            I KRP  D FL + ++ Y++++FTAS+  Y DP++D L+     +   R +R  C   +
Sbjct: 283 VI-KRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKD--KTIHHRLFRDSCYNYE 339

Query: 360 GVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           G  YIK+LS +     +                  P SY  +  +AI +  W S
Sbjct: 340 G-NYIKNLSQIGRPLSD-----------MIILDNSPASYIFHPQHAIPISSWFS 381

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 79/169 (46%), Gaps = 20/169 (11%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKR 304
           L+P        KK LV+DLDETL+HS+ +    ++     ++ V+   + +  +Y I KR
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTAD----FVIPVEID-NQVHNVYVI-KR 281

Query: 305 PYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYI 364
           P  D FL    + Y++++FTAS+  Y DP++D L+ +       R +R  C   DG  YI
Sbjct: 282 PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHC--IHHRLFRDSCYNYDG-NYI 338

Query: 365 KDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           K+LS +                        P SY  +  +AI +  W S
Sbjct: 339 KNLSQIGRP-----------LSDLIILDNSPASYIFHPQHAIPISSWFS 376

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 87/186 (46%), Gaps = 32/186 (17%)

Query: 235 RMGRFLFP--KKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGI 292
           + G++  P    L+P    +T+ KK L++DLDETL+HS+ +          +L    F +
Sbjct: 234 QQGQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFK----------YLRSADFVL 283

Query: 293 S-----GISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFS 347
           S      +  +Y I KRP  + FL +  K +++++FTAS+  Y DP++D L+        
Sbjct: 284 SVEIDDQVHNVYVI-KRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKV--IH 340

Query: 348 KRYYRSDCVLRDGVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQ 407
            R +R  C   +G  YIK+LS +      G+                P SY  +  +AI 
Sbjct: 341 HRLFREACYNYEG-NYIKNLSQI------GR-----PLSDIIILDNSPASYIFHPQHAIP 388

Query: 408 VEGWIS 413
           +  W S
Sbjct: 389 ISSWFS 394

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 76/158 (48%), Gaps = 20/158 (12%)

Query: 256 KKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKAS 315
           KK LV+DLDETL+HS+ +    ++     ++ V+   + I  +Y I KRP  D FL    
Sbjct: 240 KKCLVLDLDETLVHSSFKFLRTAD----FVIPVEID-NQIHNVYVI-KRPGVDEFLKLVG 293

Query: 316 KWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEE 375
           + Y++++FTAS+  Y DP++D L+ +       R +R  C   DG  YIK+LS +     
Sbjct: 294 QLYEVVVFTASVSRYGDPLLDVLDQT--QCIHHRLFRDSCYNYDG-NYIKNLSQIGRP-- 348

Query: 376 NGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
                              P SY  +  +AI +  W S
Sbjct: 349 ---------LSDLIILDNSPASYIFHPQHAIPISSWFS 377

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 84/170 (49%), Gaps = 22/170 (12%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHL-VEVKFGISGISTLYFIHK 303
           L+P    +T+ KK L++DLDETL+HS+ +   +  S+   L VE+   +  +    ++ K
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFK---YLRSADFVLPVEIDDQVHNV----YVIK 286

Query: 304 RPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGY 363
           RP  + FL +  K +++++FTAS+  Y DP++D L+ +       R +R  C   +G  Y
Sbjct: 287 RPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTNKV--IHHRLFREACYNYEG-NY 343

Query: 364 IKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           IK+LS +     +                  P SY  +  +AI +  W S
Sbjct: 344 IKNLSQIGRPLSD-----------IIILDNSPASYIFHPQHAIPISSWFS 382

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 76/161 (47%), Gaps = 26/161 (16%)

Query: 256 KKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGIS---GISTLYFIHKRPYCDLFLT 312
           KK LV+DLDETL+HS+ +          H  +    +     I  +Y I KRP  D FL 
Sbjct: 277 KKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVYVI-KRPGVDEFLQ 327

Query: 313 KASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKS 372
           +  + Y++++FTAS+  Y DP++D L+ S   +   R +R  C   +G  YIK+LS +  
Sbjct: 328 RVGELYEVVVFTASVSRYGDPLLDVLDKS--NNIHHRLFRDACYTYEG-NYIKNLSQI-- 382

Query: 373 SEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
               G+                P SY  +  +AI +  W S
Sbjct: 383 ----GR-----PLSEIIILDNSPPSYIFHPQHAIPISSWFS 414

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 77/169 (45%), Gaps = 20/169 (11%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKR 304
           L+P    +   KK LV+DLDETL+HS+ +        +G    +   I       ++ KR
Sbjct: 301 LLPPQSKHLSGKKCLVLDLDETLVHSSFKYL------KGADFVLPVDIDDQIHNVYVMKR 354

Query: 305 PYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYI 364
           P  D FL K    ++++IFTAS+  Y DP++D L+     S   R +R  C   +G  YI
Sbjct: 355 PGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKH--KSVHHRLFREACYNYEG-NYI 411

Query: 365 KDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           K+LS +      G+                P SY  +  +AI +  W S
Sbjct: 412 KNLSQI------GR-----PLSEIIILDNSPASYIFHPQHAIPISSWFS 449

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 80/176 (45%), Gaps = 30/176 (17%)

Query: 243 KKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGI-----SGIST 297
           + L+P       ++K LV+DLDETL+HS+ +          +L    F I     + +  
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFK----------YLHTADFVIPVEIDNQVHN 358

Query: 298 LYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVL 357
           +Y I KRP  D FL +  + Y++++FTAS+  Y DP++D L+         R +R  C  
Sbjct: 359 VYVI-KRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDKHNVV--HHRLFRDSCYN 415

Query: 358 RDGVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
            +G  YIK+LS +     +                  P SY  +  +AI +  W S
Sbjct: 416 YEG-NYIKNLSQIGRPLSD-----------LIILDNSPASYIFHPHHAIPISSWFS 459

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 76/174 (43%), Gaps = 30/174 (17%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGI-----SGISTLY 299
           L+P        KK LV+DLDETL+HS+ +          +L    F +       I  +Y
Sbjct: 272 LLPPRAPAFNGKKCLVLDLDETLVHSSFK----------YLRTADFVLPVDIDDQIHNVY 321

Query: 300 FIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRD 359
            I KRP  D FL +    Y++++FTAS+  Y DP++D L+     +   R +R  C   +
Sbjct: 322 VI-KRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKH--KTIHHRLFRESCYNYE 378

Query: 360 GVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           G  YIK+LS +                        P SY  +  +AI +  W S
Sbjct: 379 G-NYIKNLSQIGRP-----------LSDIIILDNSPASYIFHPQHAIPISSWFS 420

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 81/169 (47%), Gaps = 20/169 (11%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKR 304
           L+P    + + KK L++DLDETL+HS+ +       S   ++ V+     +  +Y I KR
Sbjct: 234 LLPPPDKSIKDKKCLILDLDETLVHSSFKYL----RSADFVLPVEID-DQVHNVYVI-KR 287

Query: 305 PYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYI 364
           P  + FL +  K +++++FTAS+  Y DP++D L+         R +R  C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKV--IHHRLFREACYNYEG-NYI 344

Query: 365 KDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           K+LS +      G+                P SY  +  +AI +  W S
Sbjct: 345 KNLSQI------GRP-----LSEIIILDNSPASYIFHPQHAIPISSWFS 382

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 79/174 (45%), Gaps = 29/174 (16%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGI-----SGISTLY 299
           L PK+      KK LV+DLDETL+HS+ +          +L    F +       I  +Y
Sbjct: 291 LPPKTEKKLIGKKCLVLDLDETLVHSSFK----------YLQTADFVLPVNIDEQIHNVY 340

Query: 300 FIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRD 359
            I KRP  + FL +  + +++++FTAS+  Y DP++D L+         R +R  C   +
Sbjct: 341 VI-KRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQL-IHHRLFREACYNYE 398

Query: 360 GVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           G  YIK+LS +      G+                P SY  +  +AI +  W S
Sbjct: 399 G-NYIKNLSQM------GRP-----LSEIIILDNSPASYIFHPQHAIPISSWFS 440

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 80/174 (45%), Gaps = 30/174 (17%)

Query: 245 LIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGI-----SGISTLY 299
           L+P      + +K LV+DLDETL+HS+ +          +L    F I     + +  +Y
Sbjct: 297 LLPPQRPEFRGRKCLVLDLDETLVHSSFK----------YLHTADFVIPVEIDNQVHNVY 346

Query: 300 FIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRD 359
            I KRP  D FL +  + +++++FTAS+  Y DP++D L+   A     R +R  C   +
Sbjct: 347 VI-KRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQYKA--VHHRLFRDSCYNYE 403

Query: 360 GVGYIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
           G  YIK+LS +     +                  P SY  +  +A+ +  W S
Sbjct: 404 G-NYIKNLSQIGRPLSD-----------LIILDNSPASYIFHPQHAVPISSWFS 445

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 77/159 (48%), Gaps = 22/159 (13%)

Query: 256 KKKLVIDLDETLIHSASRGTTHSNSSQGHL-VEVKFGISGISTLYFIHKRPYCDLFLTKA 314
           +K LV+DLDETL+HS+ +   + N +   L V++   +  +    ++ KRP  D FL   
Sbjct: 282 RKCLVLDLDETLVHSSFK---YLNIADFVLPVDIDNQVQNV----YVSKRPGVDEFLKIV 334

Query: 315 SKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSE 374
              Y++I+FTAS+  Y +P++D L+         R +R  C + +G  Y+K+LS +    
Sbjct: 335 GDLYEVIVFTASVSRYGNPLMDILDPH--KYIHHRLFRDSCYVYEG-NYVKNLSQI---- 387

Query: 375 ENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 413
             G+                P SY  +  +AI +  W S
Sbjct: 388 --GR-----PLGDIIILDNSPASYIFHPQHAIPISSWFS 419

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 74/153 (48%), Gaps = 34/153 (22%)

Query: 259 LVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWY 318
           LVI L++ L+HS          SQ      K+G       +   KRP CD FL   S++Y
Sbjct: 185 LVITLEDFLVHS--------EWSQ------KYG-------WRTAKRPGCDYFLGYLSQYY 223

Query: 319 DLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGK 378
           ++++F+++   YA+ + + L+    A  S   ++  CV +DGV +IKD+S  K + + GK
Sbjct: 224 EIVLFSSNYMMYAEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV-HIKDIS--KLNRDLGK 279

Query: 379 GXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
                           P +Y +  +NAI ++ W
Sbjct: 280 ---------VVTIDTDPNTYKLQPENAIPMDPW 303

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 68/153 (44%), Gaps = 34/153 (22%)

Query: 259 LVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWY 318
           LVI L++ L+HS          SQ H         G  T     KRP  D FL   S++Y
Sbjct: 194 LVITLEDFLVHS--------EWSQKH---------GWRT----AKRPGADYFLGYLSQYY 232

Query: 319 DLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGK 378
           ++++F+++   Y+D + + L+    A  S   ++  CV +DGV +IKDLS L        
Sbjct: 233 EIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYKDGV-HIKDLSKLNRD----- 285

Query: 379 GXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
                           P SY +  +NAI +E W
Sbjct: 286 ------LSKVIIIDTDPNSYKLQPENAIPMEPW 312

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 70/153 (45%), Gaps = 34/153 (22%)

Query: 259 LVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWY 318
           LV+ L++ L+HS          SQ H         G  T     KRP  D FL   S++Y
Sbjct: 198 LVLTLEDLLVHS--------EWSQKH---------GWRT----AKRPGVDYFLGYLSQYY 236

Query: 319 DLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGK 378
           ++++F+++   Y+D + + L+    A  S   ++  C+ +DGV +IKDLS L   E+   
Sbjct: 237 EIVLFSSNYMMYSDRIAEKLD-PIHAFVSYNLFKEHCLYKDGV-HIKDLSKLNRDEKK-- 292

Query: 379 GXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
                           P SY +  +NAI ++ W
Sbjct: 293 ---------VLIIDVDPNSYKLQPENAIPMKPW 316

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 13/109 (11%)

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP  D FL   S++Y++++F+++   YA+ V + ++    A  +   Y+  C+ +DGV 
Sbjct: 216 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMD-PIHAFVTYNLYKEHCLYKDGV- 273

Query: 363 YIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
           +IKDLS L  + + GK                P SY +  +NAI V+ W
Sbjct: 274 HIKDLSKL--NRDLGK---------TMIIDTDPNSYKLQPENAIPVKPW 311

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 55/109 (50%), Gaps = 13/109 (11%)

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP CD FL   S++Y++++F+++   Y+D + + L+    A  S   ++  CV +DG+ 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLD-PIHAFISYNLFKEHCVYKDGI- 278

Query: 363 YIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
           +IKD+S  K + + GK                P  Y    +NAI  + W
Sbjct: 279 HIKDIS--KMNRDVGK---------VVMIDTDPNCYKSQPENAIPAKPW 316

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 53/109 (48%), Gaps = 13/109 (11%)

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP  D FL   S+++++++F+++   Y+D + + L+    A  S   ++  CV +DGV 
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 274

Query: 363 YIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
           +IKDLS L                        P SY +  +NAI ++ W
Sbjct: 275 HIKDLSKLNRD-----------LSKVIIIDTEPNSYKLQPENAIPMDPW 312

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 71/158 (44%), Gaps = 34/158 (21%)

Query: 254 QKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTK 313
           Q+   LVI L++ L+HS          SQ      K+G       +   KRP  D FL  
Sbjct: 194 QRPLTLVITLEDFLVHS--------EWSQ------KYG-------WRTAKRPGADYFLGY 232

Query: 314 ASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSS 373
            S+++++++F+++   Y++ + + L+    A  S   ++  CV +DGV +IKDLS L   
Sbjct: 233 LSQYFEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV-HIKDLSKLNRD 290

Query: 374 EENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
                                P SY +  +NAI +E W
Sbjct: 291 -----------LSKVIIIDTDPNSYKLQPENAIPMEPW 317

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 52/109 (47%), Gaps = 13/109 (11%)

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP  D FL   S++Y++++F+++   Y + + + L+    A  S   ++  CV +DGV 
Sbjct: 236 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYSLFKEHCVYKDGV- 293

Query: 363 YIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
           +IKDLS L                        P +Y +  +NAI +E W
Sbjct: 294 HIKDLSKLNRD-----------VNKVLIIDTDPNNYKLQPENAIPMEPW 331

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 70/158 (44%), Gaps = 34/158 (21%)

Query: 254 QKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTK 313
           Q+   LVI L++ L+HS          SQ      K+G       +   KRP  D FL  
Sbjct: 200 QRPLTLVITLEDFLVHS--------EWSQ------KYG-------WRTAKRPGVDYFLGY 238

Query: 314 ASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSS 373
            S++Y++++F+++   Y + + + L+    A  S   ++  CV +DGV +IKDLS L   
Sbjct: 239 LSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYNLFKEHCVYKDGV-HIKDLSKLNRD 296

Query: 374 EENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
                                P +Y +  +NAI V+ W
Sbjct: 297 -----------VNKVLIIDTEPNNYKLQPENAIPVKPW 323

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 13/109 (11%)

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP  D FL   S++Y++++F+++   Y++ + + L+    A  S   Y+  CV ++G  
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLD-PIHAFISYNLYKEHCVYKEG-D 283

Query: 363 YIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
           +IKDLS L  + + GK                P SY +  +NAI ++ W
Sbjct: 284 HIKDLSKL--NRDLGK---------VIIVDTDPASYKLQPENAIPMQPW 321

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 13/109 (11%)

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP  D FL   S++Y++++F+++   Y+D V + L+    A  +   ++  C+ +DGV 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 269

Query: 363 YIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
           +IKDLS L  + + GK                P +Y +  +NAI ++ W
Sbjct: 270 HIKDLSKL--NRDLGK---------TVIIDCDPNAYKLQPENAIPMKPW 307

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 34/153 (22%)

Query: 259 LVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWY 318
           LVI L++ L+HS          SQ      K+G       +   KRP  + FL   S++Y
Sbjct: 197 LVITLEDFLVHS--------EWSQ------KYG-------WRTAKRPGAEYFLGYLSQYY 235

Query: 319 DLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGK 378
           ++++F+++   Y++   + L+    A  S   ++  CV +DGV +IKDLS LK       
Sbjct: 236 EIVLFSSNYMMYSEKTAEKLD-PIHAFVSYNLFKEHCVYKDGV-HIKDLSKLKRD----- 288

Query: 379 GXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
                           P SY +  +NAI ++ W
Sbjct: 289 ------LSKVIIIDTDPNSYKLQPENAIPMDPW 315

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 13/109 (11%)

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP  D FL   S++Y++++F+++   Y+D V + L+    A  +   ++  C+ +DGV 
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 270

Query: 363 YIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
           +IKDLS L  + + GK                P +Y +  +NAI +  W
Sbjct: 271 HIKDLSKL--NRDLGK---------TIIVDCDPNAYKLQPENAIPMRPW 308

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP  D FL   S++Y++++F+++   YA+ + + ++    A  S   ++  CV +DGV 
Sbjct: 223 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMD-PIHAFISYNLFKEHCVYKDGV- 280

Query: 363 YIKDLSIL 370
           +IKDLS L
Sbjct: 281 HIKDLSKL 288

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP  D FL   S++Y++++F+++   YA+ + + L+    A  +   ++  C+ +DGV 
Sbjct: 220 KRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFITYNLFKEHCLYKDGV- 277

Query: 363 YIKDLSIL 370
           +IKDLS L
Sbjct: 278 HIKDLSKL 285

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 13/109 (11%)

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP  D FL   S++Y++++F+++   Y++ + + L+    A  S   Y+  CV ++G  
Sbjct: 217 KRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLYKEHCVYKEGT- 274

Query: 363 YIKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
           +IKDLS L    +                   P +Y    +NAI V+ W
Sbjct: 275 HIKDLSKLNRDLDK-----------VLIIDCDPNNYKFQPENAIPVKPW 312

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP  D FL   S++Y++++F+++   +++ + + L+    A  +   ++  CV +DG+ 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLD-PIHAFITYNLFKEHCVYKDGI- 284

Query: 363 YIKDLSIL 370
           +IKDLS L
Sbjct: 285 HIKDLSHL 292

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 23/117 (19%)

Query: 254 QKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTK 313
           Q+   LV+ L++ L+HS     T   ++                     KRP  D FL  
Sbjct: 183 QRPLTLVLTLEDLLVHSEWSQKTGWRTA---------------------KRPGVDYFLGY 221

Query: 314 ASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSIL 370
            S++Y++++F+++   Y++ + + L+    A  S   ++  CV +D V +IKDLS L
Sbjct: 222 LSQYYEIVLFSSNYMMYSERIAEKLD-PLHAFISYNLFKEHCVYKDHV-HIKDLSKL 276

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 2/68 (2%)

Query: 303 KRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVG 362
           KRP  D FL   S++Y++++F+++   Y++ + + L+    A  S   ++  CV + G  
Sbjct: 191 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFISYNLFKEHCVYKKG-K 248

Query: 363 YIKDLSIL 370
           +IKDLS L
Sbjct: 249 HIKDLSKL 256

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 13/108 (12%)

Query: 304 RPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGY 363
           RP  D  L   S +Y+ ++F ++   Y+  V++ L+    A  +   ++  CV +DG+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLD-PIRAFITYNLFKDHCVYKDGI-H 274

Query: 364 IKDLSILKSSEENGKGXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 411
           IKDLS L  + + GK                P S  + ++NAI  E W
Sbjct: 275 IKDLSHL--NRDLGK---------TLIIDTDPNSVKLQMENAILAEPW 311

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 43/103 (41%), Gaps = 22/103 (21%)

Query: 251 LNTQKKKKLVIDLDETLIHSASRGTTH------SNSSQGHLVEVK-FGISGISTL----- 298
           L   KK  LV+DLD+T+IH     T H      SN +   L  VK F +     L     
Sbjct: 160 LREHKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYM 219

Query: 299 ----------YFIHKRPYCDLFLTKASKWYDLIIFTASMKEYA 331
                     Y++  RP    F  K +  ++L I+T + + YA
Sbjct: 220 GPRPPPRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYA 262

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 22/103 (21%)

Query: 251 LNTQKKKKLVIDLDETLIHSASRGTT------HSNSSQGHLVEVK-FGISGISTL----- 298
           L  +KK  LV+DLD+T+IH     T        SN +   L +VK F +     L     
Sbjct: 162 LKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYM 221

Query: 299 ----------YFIHKRPYCDLFLTKASKWYDLIIFTASMKEYA 331
                     Y++  RP    F  K +  Y++ I+T + + YA
Sbjct: 222 GPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYA 264

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 47/109 (43%), Gaps = 22/109 (20%)

Query: 248 KSILNTQKKKKLVIDLDETLIHSASRGTTH------SNSSQGHLVEVK-FGISGISTL-- 298
           KS L   KK  LV+DLD+T+IH     T        SN +   L  VK F +   + L  
Sbjct: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218

Query: 299 -------------YFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPV 334
                        Y++  RP    F  K +  Y++ I+T + + YA+ +
Sbjct: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score = 34.3 bits (77), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 43/103 (41%), Gaps = 22/103 (21%)

Query: 251 LNTQKKKKLVIDLDETLIHSASRGTTH------SNSSQGHLVEVK-FGISGISTL----- 298
           L  +KK  LV+DLD+T+IH     T        SN +   L  VK F +     L     
Sbjct: 160 LRERKKLVLVVDLDQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYM 219

Query: 299 ----------YFIHKRPYCDLFLTKASKWYDLIIFTASMKEYA 331
                     Y++  RP    F  K +  ++L I+T + + YA
Sbjct: 220 GPRPPPRRCQYYVKLRPGLQEFFDKVAPHFELHIYTMATRAYA 262

>YNL321W Chr14 (34696..37422) [2727 bp, 908 aa] {ON}  VNX1Calcium/H+
           antiporter localized to the endoplasmic reticulum
           membrane; member of the calcium exchanger (CAX) family;
           potential Cdc28p substrate
          Length = 908

 Score = 33.9 bits (76), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 42/78 (53%), Gaps = 6/78 (7%)

Query: 100 ILLFLPYYLIIKPLMS-----LWF-VFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSS 153
           +L +  ++L+++P+++     LW  VFT P++ +  ++ +  +RH  +    +  ++  S
Sbjct: 401 VLFYTIFHLVLQPILAVLSLCLWLLVFTIPMSNVLWQIMYHCRRHPLALGFKYVENSSQS 460

Query: 154 HSGDFNEKQDAKNRNLNT 171
           H  +  ++Q  KN  L T
Sbjct: 461 HENEITQQQLNKNILLCT 478

>ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} similar
           to uniprot|P41808 Saccharomyces cerevisiae YPR054W SMK1
           Mitogen-activated protein kinase required for spore
           morphogenesis that is expressed as a middle
           sporulation-specific gene
          Length = 437

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 267 LIHSASRGTTHSNSSQGHLVEVKFGIS-GISTLYFIHKRPYCDLFLTKASKWYDLIIFTA 325
           +IH   +      S  G L    FG++ G++  YF  K  Y D+    A++WY       
Sbjct: 197 VIHRDLKPGNILCSLNGCLKICDFGLARGVAPQYFTTKESYHDITNYVATRWYRAPELIL 256

Query: 326 SMKEYADPVIDWLEGSFAASFSKR 349
           S K Y+  +  W  G   A F  R
Sbjct: 257 SHKAYSKAIDMWSVGCILAEFYGR 280

>NCAS0E01330 Chr5 (256495..259578) [3084 bp, 1027 aa] {ON} Anc_3.19
           YNL321W
          Length = 1027

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 9/80 (11%)

Query: 98  WAILLF-LPYYLIIKP------LMSLWFVFTFPL-NVIERRVKHTDKRHKESGDSGHEPS 149
           W  L+F L ++LI++P      L+S  FVFT P+ N++   + H  K     G      +
Sbjct: 476 WGRLIFYLCFHLILEPIVFVVTLISWLFVFTIPMSNILWNLMYHCRKHPLALGFKNIRNT 535

Query: 150 TDSSHSGDFNEKQDAKNRNL 169
            ++  + +++E +D+ NRN+
Sbjct: 536 REAPSTANYDEDRDS-NRNI 554

>NCAS0E01970 Chr5 complement(378462..380516) [2055 bp, 684 aa] {ON}
           Anc_7.177 YBR255W
          Length = 684

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 82  RKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVFTFPL 124
           R+ ++ +L+  IV +LW I LF+ +   IK    L F+F F L
Sbjct: 636 RRLIYRVLEMAIVVVLWTIWLFVSFLRYIK----LVFMFIFHL 674

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 22/106 (20%)

Query: 248 KSILNTQKKKKLVIDLDETLIHSASRGTTHS------NSSQGHLVEVK-FGISGISTL-- 298
           ++ L  +KK  LV+DLD+T+IH     T         N +   L +VK F +     L  
Sbjct: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPT 219

Query: 299 -------------YFIHKRPYCDLFLTKASKWYDLIIFTASMKEYA 331
                        Y++  RP    FL K +  +++ I+T + + YA
Sbjct: 220 LYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYA 265

>KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {ON}
           Anc_7.336 YDL160C
          Length = 512

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 88  ILKEKIVSILWAILLFLPYYLIIKPLMSLWFVFTFPLNVIERRVKHTDKRHK 139
           +L     +I+  IL+FLP     K   SL F  TFPL V E  VKH +K ++
Sbjct: 199 MLSRDFKTIIEQILIFLP-----KNHQSLLFSATFPLTVKEFMVKHLNKPYE 245

>Suva_13.121 Chr13 complement(192780..194105) [1326 bp, 441 aa] {ON}
           YML038C (REAL)
          Length = 441

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 1   MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS 60
           ++ L++    L+  N P +T  V + +S D+L A NE       N + +P V  N  +N 
Sbjct: 181 LSGLRWVYTQLVLRNNPVQTTVVAIEESNDTLFAVNE------DNADDEPIV--NPANNK 232

Query: 61  STEGPNEPK 69
             E P   K
Sbjct: 233 MLENPRGGK 241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,846,358
Number of extensions: 1878946
Number of successful extensions: 10311
Number of sequences better than 10.0: 119
Number of HSP's gapped: 10586
Number of HSP's successfully gapped: 123
Length of query: 452
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 339
Effective length of database: 40,524,141
Effective search space: 13737683799
Effective search space used: 13737683799
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)