Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_8.436na 1ON54554529370.0
Skud_15.546na 1ON54254524400.0
YOR380W (RDR1)na 1ON54654623290.0
Smik_15.561na 1ON54654622210.0
Kwal_23.6537na 1ON55255016210.0
KLTH0C10516gna 1ON56154915750.0
KLTH0D07898g2.565ON6723751822e-13
KAFR0F014901.128ON6583421591e-10
KAFR0B028208.283ON6644071456e-09
Skud_10.101.128ON8333761431e-08
SAKL0D13464g2.565ON6873791412e-08
NDAI0B038502.231ON930791386e-08
Kpol_1039.112.231ON992461369e-08
TBLA0G026102.231ON1000491361e-07
KAFR0A021302.565ON7074211342e-07
KNAG0M021202.565ON6083321332e-07
Smik_10.251.128ON7723641322e-07
SAKL0A02860g6.279ON7453741313e-07
KLLA0F04609g2.231ON916391304e-07
TDEL0C044802.231ON852781304e-07
TPHA0F013802.231ON890501295e-07
Smik_5.9singletonOFF56371136e-07
Smik_9.392.231ON1012421271e-06
YKL015W (PUT3)2.654ON9791011271e-06
YIL130W (ASG1)2.231ON964421271e-06
KNAG0I005601.128ON6633551271e-06
SAKL0E08998g2.231ON823451271e-06
Suva_9.592.231ON926421271e-06
KAFR0J017102.231ON848391271e-06
Skud_9.372.231ON954421271e-06
Skud_7.2744.113ON1080531261e-06
TBLA0A007302.654ON1037461252e-06
CAGL0A00451g4.113ON1107551252e-06
Kwal_23.47542.231ON812391252e-06
NCAS0B065502.231ON906371252e-06
KLTH0G09108g2.231ON782391242e-06
KAFR0F034104.113ON995521242e-06
KNAG0E017602.231ON902371233e-06
TPHA0F008304.113ON1192681234e-06
TPHA0C010808.283ON5913581215e-06
KAFR0C03730singletonON791801215e-06
KLTH0E08140g4.121ON6321941215e-06
SAKL0C03938g1.128ON780401215e-06
Smik_7.2774.113ON1069501216e-06
SAKL0B06732gna 2ON878391207e-06
ZYRO0D06688g8.283ON595521198e-06
ZYRO0E06270g2.565ON912371208e-06
CAGL0G08844g2.231ON847411208e-06
NDAI0D035504.113ON1118591209e-06
YBL005W (PDR3)4.113ON976881191e-05
KLLA0C03201g1.128ON650471181e-05
YGL013C (PDR1)4.113ON1068411172e-05
Suva_7.2684.113ON1000531172e-05
Suva_6.2851.128ON7863701162e-05
KLTH0C00814g2.654ON834601162e-05
Skud_2.1064.113ON1010421162e-05
KNAG0C059804.113ON968491153e-05
Suva_2.1214.113ON971361153e-05
Smik_2.1154.113ON971401153e-05
Smik_11.2402.654ON976391153e-05
AER370W2.231ON801391144e-05
Ecym_53972.231ON826391144e-05
KLLA0F22990g1.380ON1253511144e-05
NDAI0A034204.113ON1108381144e-05
KNAG0D035204.113ON1030371135e-05
YJL206C1.128ON758451126e-05
SAKL0G19470g2.654ON831621126e-05
SAKL0B04620gna 3ON362371116e-05
Kpol_1061.424.113ON1129411126e-05
Ecym_7440na 2ON898371127e-05
KNAG0G021308.283ON632361127e-05
KNAG0H002502.654ON896381127e-05
Skud_11.2142.654ON981491118e-05
KLLA0A02585gna 3ON370501099e-05
ZYRO0G10252g4.113ON1036361119e-05
KLLA0E18129g2.654ON865631119e-05
Ecym_33922.654ON847661119e-05
ZYRO0G22550gsingletonON724581101e-04
NDAI0B015402.565ON803381101e-04
KLLA0A09119g4.113ON1082461101e-04
NCAS0A016304.113ON1043901101e-04
NCAS0A035804.113ON1113381101e-04
TBLA0E034803.109ON1046911101e-04
KLTH0E00440gsingletonON688281091e-04
KLTH0B10076gsingletonON688281091e-04
Suva_13.1862.565ON894461082e-04
KLTH0E07854g4.113ON938431072e-04
Kwal_14.9152.654ON822691072e-04
KLTH0B09262gsingletonON820351073e-04
AER183Cna 2ON879371073e-04
Suva_11.2132.654ON985441073e-04
TBLA0A012101.380ON1422431073e-04
Kwal_47.175064.113ON924471073e-04
TPHA0B036301.380ON1429541073e-04
TDEL0G04920singletonON696841063e-04
Ecym_72354.113ON943351063e-04
NDAI0D03540na 4ON1107351063e-04
SAKL0D01100g4.113ON940391063e-04
KLLA0C14212gna 5ON1040471064e-04
TDEL0F023304.113ON1086451064e-04
Kpol_467.11.380ON1289511064e-04
NCAS0E023107.56ON718391054e-04
NCAS0H034202.654ON902461054e-04
KLTH0E05786gna 6ON817921054e-04
KLTH0E06666gna 7ON9462431055e-04
Kpol_1033.158.283ON594421045e-04
Smik_12.1578.283ON644521045e-04
KAFR0I020301.380ON12331191055e-04
TBLA0C040504.113ON1207371055e-04
NCAS0A03570na 4ON978421046e-04
NCAS0G011006.279ON9351841046e-04
TBLA0E019007.56ON840361046e-04
NDAI0G052601.380ON1581531046e-04
ZYRO0G14278g8.845ON12501181046e-04
SAKL0C00242gna 6ON833521037e-04
SAKL0D01342g8.845ON1270521038e-04
NDAI0D034804.121ON7083301038e-04
Suva_16.596.279ON8954101038e-04
NCAS0A076107.17ON1022731038e-04
ZYRO0B14476gna 8ON707441038e-04
TPHA0O006001.380ON13721121038e-04
YMR019W (STB4)2.565ON949471038e-04
Skud_13.1732.565ON920461039e-04
NDAI0A03410na 4ON980381039e-04
TDEL0C056801.128ON691371020.001
KLTH0G13200g8.283ON566281020.001
KLTH0C03762g8.845ON1206431020.001
Suva_13.4688.845ON1418381020.001
Kwal_27.102328.845ON1209431020.001
ZYRO0C18150g1.128ON571501010.001
KLTH0E14454gna 2ON902371020.001
CAGL0F09229gna 6ON835361020.001
ZYRO0E00572g2.654ON8381021020.001
Kpol_1061.261.380ON1274431020.001
TBLA0C062306.60ON795411010.001
TDEL0B005308.845ON1301381010.001
TDEL0B062601.380ON1247431010.001
Skud_15.643.109ON1032691010.001
Smik_13.4938.845ON1433381010.001
YLR266C (PDR8)6.60ON701661010.001
Ecym_46168.845ON1577381010.001
ZYRO0E05412g1.380ON1244511010.001
KLLA0D10153gsingletonON655401000.001
KLLA0A06039g1.199ON657621000.001
Ecym_27321.380ON1198541010.001
Skud_13.4528.845ON1432381010.001
KAFR0E024107.56ON691381000.001
TBLA0J003708.642ON4711221000.002
YMR280C (CAT8)8.845ON1433381010.002
SAKL0H00660gsingletonON912821000.002
Skud_5.331singletonON17042950.002
CAGL0B03421g1.380ON1355511010.002
Skud_12.3466.60ON694521000.002
NCAS0A088401.380ON1478431000.002
SAKL0B10538g7.56ON701501000.002
TDEL0D00260singletonON647321000.002
ABL121C8.845ON1285381000.002
NDAI0E038507.56ON768391000.002
YLR256W (HAP1)1.380ON1502521000.002
NCAS0A127202.565ON75938990.002
Smik_12.3271.380ON150352990.002
CAGL0L03377g1.277ON120934990.002
KAFR0B039508.845ON124638990.002
Smik_13.1832.565ON91136990.002
KAFR0G005701.199ON86277990.002
ZYRO0G10450g4.121ON639315980.003
Skud_12.3351.380ON147952990.003
TBLA0C011201.380ON148643990.003
KNAG0I014501.380ON147643990.003
KAFR0C013203.109ON100643980.003
CAGL0F02519g1.128ON83239980.003
AFL160C6.279ON648391980.003
KLLA0D01452g8.845ON144538980.003
NDAI0K003908.845ON149539980.003
YBR297W (MAL33)na 9ON46862970.003
Suva_11.2991.199ON88950980.003
AFR117C1.380ON115243980.003
NDAI0B025208.283ON71041970.003
Smik_2.438na 9ON46935970.004
Kwal_YGOB_0.1391.380ON124043980.004
CAGL0K05841g1.380ON137242980.004
KNAG0E041507.17ON113649970.004
NDAI0C034505.59ON776185970.004
SAKL0D07898g1.380ON124443970.004
KLLA0F19602g8.283ON60355970.004
CAGL0E05434g7.56ON81651970.004
TPHA0N004407.56ON75736970.004
Kwal_26.70147.56ON65438960.004
Kpol_1059.268.642ON42048960.004
Suva_10.3511.380ON32452950.005
KLLA0C18953gna 10ON70329960.005
ZYRO0D02090g1.199ON84241960.005
Kpol_2001.161.199ON802100960.005
SAKL0H00682gna 5ON92258960.005
KLTH0H11572g1.380ON123743960.005
Kwal_0.142singletonOFF62943960.005
Suva_8.3877.56ON75945960.005
TBLA0E007007.17ON127444960.006
ACL058Wna 7ON81764960.006
KLLA0F09559gsingletonON65850950.006
TPHA0L003505.525ON859258950.006
Suva_15.425singletonON64434950.007
TDEL0D00820na 8ON68540950.007
ACL096W2.654ON83563950.007
TDEL0B074902.654ON86554950.007
Skud_15.5027.56ON75938950.007
SAKL0A00704gna 11ON71849950.007
YOR337W (TEA1)7.56ON75938950.007
TBLA0G005106.60ON93548950.007
YER184Cna 6ON79461950.007
NCAS0C003908.845ON116438950.007
YKR064W (OAF3)1.199ON86359950.008
Suva_16.25singletonON14335890.008
KLTH0C07480g3.264ON77548940.008
Smik_15.5157.56ON75938940.008
KLTH0C10032g3.109ON86644940.008
KLLA0C19228gsingletonON59130940.008
Skud_7.627na 12ON47467930.009
NCAS0B051108.283ON62745930.010
Kwal_47.175654.121ON62836930.010
TDEL0H007901.199ON82759930.011
Kwal_56.226053.109ON86568930.011
KLLA0F02750g3.109ON114855940.011
SAKL0H22374g4.121ON640296930.011
CAGL0M03025g8.845ON125450930.011
Kwal_47.17233na 7ON94843930.011
AGR061C8.283ON61239930.012
KAFR0A03060singletonON86043930.012
TPHA0N002307.17ON123264930.012
Kwal_56.230583.264ON775128930.013
CAGL0L09691g2.654ON82447930.013
ZYRO0G00308gsingletonON64927920.013
KAFR0C039002.654ON81839930.013
KLTH0H00968g7.360ON62344920.015
SAKL0H24860gna 7ON97143920.015
KLLA0C17050gna 7ON95539920.015
Ecym_42868.283ON62738920.016
KNAG0M00120singletonON88138920.016
Suva_8.2166.60ON78152920.017
KAFR0A066904.113ON99737920.018
Skud_7.638singletonON47334910.019
Skud_2.427na 9ON46856910.020
Suva_15.773.109ON102951910.020
Smik_26.8singletonON11737840.020
NDAI0C047908.416ON103338910.020
TBLA0B079205.59ON767205910.020
TBLA0A04280singletonON89239910.021
KNAG0M006206.154ON45947900.022
AGL233Cna 11ON87241910.022
CAGL0F07909g3.109ON104975910.022
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_8.436
         (545 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...  1135   0.0  
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...   944   0.0  
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...   901   0.0  
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...   860   0.0  
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...   629   0.0  
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...   611   0.0  
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    75   2e-13
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    66   1e-10
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    60   6e-09
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    60   1e-08
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    59   2e-08
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    58   6e-08
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    57   9e-08
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    57   1e-07
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    56   2e-07
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    56   2e-07
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    55   2e-07
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    55   3e-07
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    55   4e-07
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    55   4e-07
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    54   5e-07
Smik_5.9 Chr5 complement(10186..10212,10216..10227,10231..10359)...    48   6e-07
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    54   1e-06
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    54   1e-06
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    54   1e-06
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    54   1e-06
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    54   1e-06
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    54   1e-06
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    54   1e-06
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    54   1e-06
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    53   1e-06
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    53   2e-06
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    53   2e-06
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    53   2e-06
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    53   2e-06
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    52   2e-06
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    52   2e-06
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    52   3e-06
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    52   4e-06
TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.2...    51   5e-06
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               51   5e-06
KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conser...    51   5e-06
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    51   5e-06
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    51   6e-06
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    51   7e-06
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    50   8e-06
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    51   8e-06
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    51   8e-06
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    51   9e-06
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    50   1e-05
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    50   1e-05
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    50   2e-05
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    50   2e-05
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    49   2e-05
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    49   2e-05
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    49   2e-05
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    49   3e-05
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    49   3e-05
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    49   3e-05
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    49   3e-05
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    49   4e-05
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    49   4e-05
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    49   4e-05
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    49   4e-05
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    48   5e-05
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    48   6e-05
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    48   6e-05
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    47   6e-05
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    48   6e-05
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    48   7e-05
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    48   7e-05
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    48   7e-05
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    47   8e-05
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    47   9e-05
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    47   9e-05
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    47   9e-05
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    47   9e-05
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    47   1e-04
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    47   1e-04
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    47   1e-04
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    47   1e-04
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    47   1e-04
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    47   1e-04
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    47   1e-04
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    47   1e-04
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    46   2e-04
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    46   2e-04
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    46   2e-04
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    46   3e-04
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    46   3e-04
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    46   3e-04
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    46   3e-04
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    46   3e-04
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    46   3e-04
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    45   3e-04
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    45   3e-04
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    45   3e-04
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    45   3e-04
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    45   4e-04
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    45   4e-04
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    45   4e-04
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      45   4e-04
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    45   4e-04
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    45   4e-04
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    45   5e-04
Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 b...    45   5e-04
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    45   5e-04
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    45   5e-04
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    45   5e-04
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    45   6e-04
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    45   6e-04
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    45   6e-04
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    45   6e-04
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...    45   6e-04
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    44   7e-04
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...    44   8e-04
NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {O...    44   8e-04
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    44   8e-04
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    44   8e-04
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    44   8e-04
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    44   8e-04
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    44   8e-04
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    44   9e-04
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    44   9e-04
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    44   0.001
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    44   0.001
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...    44   0.001
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...    44   0.001
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...    44   0.001
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    44   0.001
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    44   0.001
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    44   0.001
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    44   0.001
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    44   0.001
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    44   0.001
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...    44   0.001
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    44   0.001
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    44   0.001
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...    44   0.001
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    44   0.001
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...    44   0.001
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    44   0.001
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    43   0.001
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    43   0.001
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    44   0.001
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...    44   0.001
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    43   0.001
TBLA0J00370 Chr10 complement(67871..69286) [1416 bp, 471 aa] {ON...    43   0.002
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...    44   0.002
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    43   0.002
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    41   0.002
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    44   0.002
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    43   0.002
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    43   0.002
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    43   0.002
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       43   0.002
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...    43   0.002
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      43   0.002
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    43   0.002
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    43   0.002
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    43   0.002
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    43   0.002
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...    43   0.002
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    43   0.002
KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa] {O...    43   0.002
ZYRO0G10450g Chr7 (842921..844840) [1920 bp, 639 aa] {ON} conser...    42   0.003
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    43   0.003
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    43   0.003
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              43   0.003
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    42   0.003
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    42   0.003
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    42   0.003
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...    42   0.003
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845     42   0.003
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    42   0.003
Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064...    42   0.003
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    42   0.003
NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa] {O...    42   0.003
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    42   0.004
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    42   0.004
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    42   0.004
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    42   0.004
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      42   0.004
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    42   0.004
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    42   0.004
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    42   0.004
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    42   0.004
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    42   0.004
Kpol_1059.26 s1059 complement(57391..58653) [1263 bp, 420 aa] {O...    42   0.004
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    41   0.005
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    42   0.005
ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa] {...    42   0.005
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    42   0.005
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    42   0.005
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    42   0.005
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    42   0.005
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    42   0.005
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    42   0.006
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    42   0.006
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    41   0.006
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}      41   0.006
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    41   0.007
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               41   0.007
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    41   0.007
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    41   0.007
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    41   0.007
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    41   0.007
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    41   0.007
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    41   0.007
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    41   0.007
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845      41   0.007
YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}  OAF3Putat...    41   0.008
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    39   0.008
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    41   0.008
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    41   0.008
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    41   0.008
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    41   0.008
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    40   0.009
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    40   0.010
Kwal_47.17565 s47 (457523..459409) [1887 bp, 628 aa] {ON} [conti...    40   0.010
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    40   0.011
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    40   0.011
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    41   0.011
SAKL0H22374g Chr8 (1947498..1949420) [1923 bp, 640 aa] {ON} cons...    40   0.011
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...    40   0.011
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    40   0.011
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    40   0.012
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    40   0.012
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    40   0.012
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    40   0.013
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    40   0.013
ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar ...    40   0.013
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    40   0.013
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    40   0.015
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    40   0.015
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    40   0.015
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    40   0.016
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      40   0.016
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    40   0.017
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    40   0.018
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    40   0.019
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    40   0.020
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    40   0.020
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      37   0.020
NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]...    40   0.020
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    40   0.020
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    40   0.021
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    39   0.022
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    40   0.022
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    40   0.022
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    40   0.024
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    39   0.025
Suva_14.423 Chr14 (733379..735229) [1851 bp, 616 aa] {ON} YNR063...    39   0.025
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    39   0.025
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    39   0.025
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    39   0.026
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    39   0.026
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    39   0.028
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    39   0.029
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    39   0.029
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    39   0.030
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    39   0.031
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    39   0.036
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    39   0.037
Suva_10.182 Chr10 complement(342360..344330) [1971 bp, 656 aa] {...    39   0.038
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    39   0.038
KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {O...    39   0.039
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    39   0.040
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    39   0.040
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    39   0.042
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    39   0.042
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    39   0.046
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    39   0.046
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    39   0.046
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    39   0.047
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    39   0.048
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    39   0.048
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    39   0.049
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    39   0.050
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    39   0.051
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               39   0.051
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    39   0.051
Kwal_14.778 s14 complement(40408..42405) [1998 bp, 665 aa] {ON} ...    38   0.054
NCAS0C05100 Chr3 complement(1038084..1041143) [3060 bp, 1019 aa]...    39   0.055
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    38   0.056
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    38   0.057
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    38   0.057
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    38   0.059
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    38   0.066
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    38   0.067
ZYRO0D04422g Chr4 (366583..368877) [2295 bp, 764 aa] {ON} simila...    38   0.068
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    38   0.069
Kwal_26.8200 s26 (688203..690161) [1959 bp, 652 aa] {ON} YMR019W...    38   0.073
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    38   0.073
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    38   0.075
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    38   0.075
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    38   0.075
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    38   0.077
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    38   0.078
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    38   0.082
Kwal_26.8662 s26 (888487..889554) [1068 bp, 355 aa] {ON} YPL133C...    37   0.083
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    37   0.084
ABR174W Chr2 (728570..731164) [2595 bp, 864 aa] {ON} Syntenic ho...    38   0.084
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    38   0.085
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    38   0.086
Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064...    38   0.087
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               37   0.091
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    38   0.092
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    37   0.092
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    37   0.094
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    37   0.095
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    37   0.096
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    37   0.096
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               37   0.100
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     37   0.10 
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    37   0.10 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    37   0.10 
Ecym_3395 Chr3 complement(750356..753481) [3126 bp, 1041 aa] {ON...    37   0.10 
CAGL0A00583g Chr1 (65286..67226) [1941 bp, 646 aa] {ON} weakly s...    37   0.10 
AGL361C Chr7 complement(24101..26191) [2091 bp, 696 aa] {ON} NOH...    37   0.11 
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    37   0.11 
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    37   0.12 
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    37   0.12 
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                37   0.12 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    37   0.12 
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    37   0.12 
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    37   0.12 
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    37   0.12 
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    37   0.12 
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 37   0.12 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    37   0.12 
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    37   0.13 
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    37   0.13 
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    37   0.13 
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    37   0.14 
Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa...    37   0.14 
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    37   0.14 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    37   0.15 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    37   0.15 
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    37   0.15 
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    37   0.16 
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    37   0.16 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    37   0.17 
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    37   0.17 
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    37   0.18 
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...    37   0.18 
KNAG0D03450 Chr4 (620486..622552) [2067 bp, 688 aa] {ON} Anc_4.121     37   0.18 
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    37   0.19 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    37   0.19 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    37   0.19 
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    37   0.19 
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...    37   0.19 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    37   0.19 
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    37   0.20 
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    37   0.21 
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    36   0.22 
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    36   0.22 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    36   0.23 
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    36   0.24 
Skud_12.166 Chr12 complement(320672..322621) [1950 bp, 649 aa] {...    36   0.26 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    36   0.27 
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    36   0.28 
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    36   0.28 
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    36   0.29 
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    36   0.29 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    36   0.29 
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    36   0.30 
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    36   0.30 
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    36   0.30 
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    36   0.30 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    36   0.30 
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    36   0.31 
SAKL0H07370g Chr8 complement(641801..642982) [1182 bp, 393 aa] {...    35   0.31 
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    36   0.32 
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    36   0.33 
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    36   0.33 
KNAG0J01530 Chr10 (281029..282111) [1083 bp, 360 aa] {ON} Anc_8....    35   0.34 
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     36   0.34 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    35   0.35 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    36   0.35 
TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa] ...    35   0.35 
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    35   0.35 
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    35   0.36 
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    36   0.36 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    35   0.37 
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    35   0.37 
Suva_5.324 Chr5 (529581..530993) [1413 bp, 470 aa] {ON} YFL052W ...    35   0.37 
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    35   0.38 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    35   0.39 
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     35   0.39 
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    35   0.39 
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    35   0.40 
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    35   0.40 
KAFR0G01360 Chr7 complement(305620..308121) [2502 bp, 833 aa] {O...    35   0.41 
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    35   0.42 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    35   0.43 
KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserve...    35   0.43 
TBLA0G02350 Chr7 complement(605666..610141) [4476 bp, 1491 aa] {...    35   0.44 
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    35   0.44 
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    35   0.45 
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    35   0.45 
Ecym_8327 Chr8 (663876..665114) [1239 bp, 412 aa] {ON} similar t...    35   0.45 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    35   0.46 
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    35   0.46 
SAKL0D08008g Chr4 complement(665498..669184) [3687 bp, 1228 aa] ...    35   0.46 
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    35   0.48 
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    35   0.48 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    35   0.49 
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    35   0.49 
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    35   0.49 
Kwal_23.3514 s23 (324012..325751) [1740 bp, 579 aa] {ON} YMR168C...    35   0.50 
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    35   0.51 
TPHA0F03260 Chr6 (709472..710887) [1416 bp, 471 aa] {ON} Anc_8.6...    35   0.51 
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    35   0.52 
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    35   0.53 
KLLA0E19229g Chr5 (1713099..1715318) [2220 bp, 739 aa] {ON} simi...    35   0.55 
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    35   0.56 
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    35   0.57 
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    35   0.58 
SAKL0F00418g Chr6 (34751..36430) [1680 bp, 559 aa] {ON} conserve...    35   0.58 
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    35   0.60 
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    35   0.60 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    35   0.61 
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    35   0.63 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    35   0.64 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    35   0.65 
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    35   0.66 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    35   0.67 
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    35   0.69 
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    35   0.69 
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    35   0.70 
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               35   0.70 
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    35   0.71 
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    35   0.72 
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    35   0.74 
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    35   0.77 
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    35   0.78 
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    35   0.78 
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    35   0.78 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    34   0.78 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    35   0.79 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       35   0.81 
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    35   0.81 
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    34   0.81 
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    35   0.82 
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    35   0.83 
TBLA0J00620 Chr10 complement(140248..142545) [2298 bp, 765 aa] {...    34   0.83 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    35   0.83 
Suva_16.177 Chr16 complement(309358..310716) [1359 bp, 452 aa] {...    34   0.84 
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    34   0.86 
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    34   0.87 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    34   0.87 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    32   0.88 
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    34   0.89 
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    34   0.90 
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    34   0.90 
ACR107W Chr3 (544402..545556) [1155 bp, 384 aa] {ON} Syntenic ho...    34   0.91 
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    34   0.92 
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    34   0.93 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    34   0.93 
NCAS0C01530 Chr3 (281676..282899) [1224 bp, 407 aa] {ON} Anc_8.642     34   0.95 
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    32   0.96 
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    34   0.97 
KLTH0H05764g Chr8 (508783..510153) [1371 bp, 456 aa] {ON} simila...    34   0.99 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    34   0.99 
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    34   1.0  
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    34   1.0  
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    34   1.1  
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    34   1.1  
Ecym_3382 Chr3 (724394..726190) [1797 bp, 598 aa] {ON} similar t...    34   1.1  
SAKL0D12254g Chr4 complement(1013532..1017065) [3534 bp, 1177 aa...    34   1.1  
AFL033W Chr6 (373485..374633) [1149 bp, 382 aa] {ON} Syntenic ho...    34   1.1  
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    34   1.1  
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    34   1.2  
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    34   1.2  
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    34   1.2  
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    34   1.2  
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    34   1.2  
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    34   1.2  
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    34   1.2  
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    34   1.2  
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    34   1.2  
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    34   1.3  
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    34   1.3  
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    34   1.3  
Smik_2.290 Chr2 complement(527416..530511) [3096 bp, 1031 aa] {O...    34   1.3  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    33   1.4  
NCAS0D00890 Chr4 (166411..168324) [1914 bp, 637 aa] {ON} Anc_2.3...    34   1.4  
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    33   1.4  
KAFR0B06270 Chr2 complement(1288724..1290085) [1362 bp, 453 aa] ...    33   1.4  
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    34   1.4  
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    34   1.4  
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    34   1.4  
KLTH0D10428g Chr4 (861135..862196) [1062 bp, 353 aa] {ON} simila...    33   1.4  
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    33   1.5  
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    33   1.5  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     33   1.5  
Skud_9.204 Chr9 (367291..370320) [3030 bp, 1009 aa] {ON} YIR023W...    33   1.5  
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    34   1.5  
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    33   1.5  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...    33   1.5  
Skud_4.87 Chr4 (152240..153826) [1587 bp, 528 aa] {ON} YDL170W (...    33   1.6  
KNAG0F03040 Chr6 complement(576753..580325) [3573 bp, 1190 aa] {...    33   1.6  
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    33   1.6  
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    33   1.6  
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    33   1.7  
NCAS0A00300 Chr1 (43991..46324) [2334 bp, 777 aa] {ON} Anc_1.26 ...    33   1.7  
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    33   1.7  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...    33   1.7  
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    33   1.8  
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    33   1.8  
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    33   1.8  
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             33   1.8  
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    33   1.9  
KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {...    33   1.9  
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    33   2.0  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             33   2.0  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    33   2.0  
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    33   2.0  
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    33   2.1  
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    33   2.1  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...    33   2.1  
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    33   2.1  
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               33   2.1  
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    33   2.2  
KAFR0B04830 Chr2 (1003592..1005487) [1896 bp, 631 aa] {ON} Anc_2...    33   2.2  
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...    33   2.2  
KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON} uni...    33   2.2  
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    33   2.3  
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    33   2.3  
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    33   2.3  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    33   2.3  
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    33   2.3  
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    33   2.3  
KAFR0G03500 Chr7 complement(724418..726127) [1710 bp, 569 aa] {O...    33   2.3  
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    33   2.4  
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    33   2.6  
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    33   2.6  
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    33   2.6  
ZYRO0F06556g Chr6 (542397..543476) [1080 bp, 359 aa] {ON} simila...    33   2.6  
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    33   2.7  
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    33   2.7  
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    33   2.7  
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    33   2.8  
TBLA0C04000 Chr3 complement(961730..963748) [2019 bp, 672 aa] {O...    33   2.8  
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    33   2.9  
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    33   2.9  
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    33   2.9  
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    33   2.9  
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    33   3.1  
SAKL0F12342g Chr6 (964262..967393) [3132 bp, 1043 aa] {ON} simil...    33   3.2  
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    33   3.2  
Kwal_14.1636 s14 (400872..402242) [1371 bp, 456 aa] {ON} YBR239C...    32   3.2  
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     32   3.5  
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    32   3.5  
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     32   3.5  
SAKL0D05236g Chr4 complement(414228..415826) [1599 bp, 532 aa] {...    32   3.6  
KLLA0D07029g Chr4 (602763..604367) [1605 bp, 534 aa] {ON} simila...    32   3.8  
NDAI0G03660 Chr7 complement(881936..883471) [1536 bp, 511 aa] {O...    32   3.9  
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    32   3.9  
TPHA0N01110 Chr14 (232891..233982) [1092 bp, 363 aa] {ON} Anc_6....    32   3.9  
CAGL0K06985g Chr11 (681944..683734) [1791 bp, 596 aa] {ON} simil...    32   4.0  
YIR023W Chr9 (399777..402689) [2913 bp, 970 aa] {ON}  DAL81Posit...    32   4.0  
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    32   4.0  
AGR369W Chr7 (1412833..1415988) [3156 bp, 1051 aa] {ON} Syntenic...    32   4.0  
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    32   4.1  
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    32   4.3  
TDEL0H01310 Chr8 (224588..226165) [1578 bp, 525 aa] {ON} Anc_1.2...    32   4.3  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...    32   4.4  
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    32   4.6  
Ecym_2265 Chr2 (521409..523064) [1656 bp, 551 aa] {ON} similar t...    32   4.6  
Smik_4.453 Chr4 complement(820614..823172) [2559 bp, 852 aa] {ON...    32   4.8  
Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON} (244...    32   4.8  
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    32   4.9  
NDAI0E04190 Chr5 complement(944753..948466) [3714 bp, 1237 aa] {...    32   4.9  
SAKL0C13200g Chr3 (1167325..1168065) [741 bp, 246 aa] {ON} simil...    31   5.1  
KAFR0H02600 Chr8 complement(496353..497432) [1080 bp, 359 aa] {O...    32   5.1  
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    32   5.2  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     32   5.2  
YDR207C Chr4 complement(865012..867522) [2511 bp, 836 aa] {ON}  ...    32   5.3  
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               32   5.3  
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    32   5.9  
KLLA0E01651g Chr5 complement(155975..160627) [4653 bp, 1550 aa] ...    32   5.9  
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    32   5.9  
KNAG0E00780 Chr5 (140071..142353) [2283 bp, 760 aa] {ON} Anc_5.5...    32   5.9  
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    32   6.1  
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    32   6.5  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    31   6.6  
Skud_4.469 Chr4 complement(831562..834189) [2628 bp, 875 aa] {ON...    32   6.7  
Suva_2.374 Chr2 complement(656129..658624) [2496 bp, 831 aa] {ON...    32   6.9  
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    32   6.9  
Smik_6.332 Chr6 (522940..524292) [1353 bp, 450 aa] {ON} YPL133C ...    31   7.1  
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    32   7.1  
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 32   7.2  
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    32   7.4  
Kpol_1061.19 s1061 (51386..54709) [3324 bp, 1107 aa] {ON} (51386...    31   7.8  
Smik_9.227 Chr9 (373211..376084) [2874 bp, 957 aa] {ON} YIR023W ...    31   7.9  
Skud_16.147 Chr16 complement(271583..272935) [1353 bp, 450 aa] {...    31   9.1  
Kwal_23.3178 s23 (185722..187557) [1836 bp, 611 aa] {ON} YDR207C...    31   9.2  
KLTH0F08074g Chr6 (701778..703685) [1908 bp, 635 aa] {ON} some s...    31   10.0 

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score = 1135 bits (2937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/545 (100%), Positives = 545/545 (100%)

Query: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRM 60
           MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRM
Sbjct: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRM 60

Query: 61  NQVEELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLG 120
           NQVEELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLG
Sbjct: 61  NQVEELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLG 120

Query: 121 LELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIVD 180
           LELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIVD
Sbjct: 121 LELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIVD 180

Query: 181 PEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPTF 240
           PEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPTF
Sbjct: 181 PEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPTF 240

Query: 241 SRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVP 300
           SRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVP
Sbjct: 241 SRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVP 300

Query: 301 LKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLAQ 360
           LKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLAQ
Sbjct: 301 LKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLAQ 360

Query: 361 LVPQESVNANVTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDKSVVSQ 420
           LVPQESVNANVTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDKSVVSQ
Sbjct: 361 LVPQESVNANVTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDKSVVSQ 420

Query: 421 IIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNITQ 480
           IIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNITQ
Sbjct: 421 IIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNITQ 480

Query: 481 VLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDALLDPSD 540
           VLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDALLDPSD
Sbjct: 481 VLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDALLDPSD 540

Query: 541 TLSFM 545
           TLSFM
Sbjct: 541 TLSFM 545

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score =  944 bits (2440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/545 (84%), Positives = 499/545 (91%), Gaps = 3/545 (0%)

Query: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRM 60
           M SSGSN QPYKRQRVRKACVPCRERKRKCNGKSPCEMC+AYGY CHYT+ DG   S R 
Sbjct: 1   MVSSGSNSQPYKRQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSSTSPR- 59

Query: 61  NQVEELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLG 120
             V+E P+ T NRPY   +I+ N   S D+Q+VTN NIID  KSRYTIQHSAVAFPR LG
Sbjct: 60  --VDETPYGTDNRPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAFPRCLG 117

Query: 121 LELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIVD 180
           LELRSTNPPRLH FAWHCGIRPEE P+ H+ LS +VTKEEYYRISKVYFSVVHPIFD+VD
Sbjct: 118 LELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPIFDVVD 177

Query: 181 PEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPTF 240
           PEQL KNVE+YW+GD +  EYGAVIAGVIALGSFFLGSLGHPREMD++QYAKGILDDPTF
Sbjct: 178 PEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGILDDPTF 237

Query: 241 SRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVP 300
            RIP+VEQ+SAWVLRTIYLRAT+RPHVAWLASC+TIHLSEAIGLHHEIDREDL +T+NVP
Sbjct: 238 CRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVMTSNVP 297

Query: 301 LKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLAQ 360
           L+RTTEVSEHTRRLFW AWSINTILSYDYGRSSVTLNRITCK VKET+GN+TV+LV+LAQ
Sbjct: 298 LRRTTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHLVALAQ 357

Query: 361 LVPQESVNANVTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDKSVVSQ 420
           L+PQ+ VNAN TQLLQALAAVH+SP+AHPFLSLTK+DICLS YRRLRLLNHILDKSVV Q
Sbjct: 358 LIPQDCVNANATQLLQALAAVHKSPNAHPFLSLTKSDICLSLYRRLRLLNHILDKSVVLQ 417

Query: 421 IIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNITQ 480
           IIDIGNTAL+AAYALVK+DQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNITQ
Sbjct: 418 IIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNITQ 477

Query: 481 VLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDALLDPSD 540
           VLGTHIA+EAQKTAKLLLEDS+KKKRQEIQQLE+ATHQRS  ETTHLLDIDWD LLDPSD
Sbjct: 478 VLGTHIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDIDWDVLLDPSD 537

Query: 541 TLSFM 545
           TL+FM
Sbjct: 538 TLNFM 542

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/546 (83%), Positives = 496/546 (90%), Gaps = 1/546 (0%)

Query: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRM 60
           MAS GS   P+KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY +   P AS ++
Sbjct: 1   MASPGSTALPHKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSASPQV 60

Query: 61  NQVEELPHDTKNRPYVPLDIIGNGT-HSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSL 119
            QV E   DT++RP+V   I  N      ++Q+VT+ NI+D TKSRYTIQHSAVAFPR L
Sbjct: 61  QQVGETSPDTESRPFVLPGIHRNEQPQPINTQNVTSQNIVDPTKSRYTIQHSAVAFPRCL 120

Query: 120 GLELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIV 179
           GLELRSTNPPRLH FAWHCGIRPEE P+ HV LSD+VTKEEYYRISKVYFSVVHPIFD+V
Sbjct: 121 GLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSVVHPIFDVV 180

Query: 180 DPEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPT 239
           +PEQL KNVEKYW+GD +T EYGAVIAGVIALGSFF+GSLGHPREMDI+QYAKGILDDPT
Sbjct: 181 NPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYAKGILDDPT 240

Query: 240 FSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNV 299
           FSRIP+VEQ+SAWVLRTIYLRAT+RPHVAWLASC+TIHLSEAIGLHHEIDRED+A++NNV
Sbjct: 241 FSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDREDIAISNNV 300

Query: 300 PLKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLA 359
           P KRTT VSEHTRRLFW AWSINTILSYDYGRSSVTLNRITCKPVKETDGN+T +LV+LA
Sbjct: 301 PPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNFTAHLVALA 360

Query: 360 QLVPQESVNANVTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDKSVVS 419
            L+PQ+SVNAN  QLLQALAAVHESP+AHPFLSLTK DICLS YRRLRLLNHILDK+VV 
Sbjct: 361 HLIPQDSVNANAAQLLQALAAVHESPNAHPFLSLTKGDICLSLYRRLRLLNHILDKNVVL 420

Query: 420 QIIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNIT 479
           QIIDIGNTAL+AAYALVK+DQAWWNVLSTSFQYVCVLLAIDTPESLSHVA AM+TLDNIT
Sbjct: 421 QIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVATAMKTLDNIT 480

Query: 480 QVLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDALLDPS 539
           Q+LGT IAFEAQKTAKLLLEDS+KKKRQEIQQLEQATHQRS  ETTHLLDIDWDALLDPS
Sbjct: 481 QILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHLLDIDWDALLDPS 540

Query: 540 DTLSFM 545
           DTL+FM
Sbjct: 541 DTLNFM 546

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/546 (75%), Positives = 476/546 (87%), Gaps = 1/546 (0%)

Query: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSR- 59
           MASS  N   YKRQRVRKACVPCRERKRKCNGKSPCEMC++YGYVCHY ++D   +SS  
Sbjct: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60

Query: 60  MNQVEELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSL 119
           + +++ELPH  +++P+   +I GN   S D+Q VTN +I D  KSRYTIQHSAVAFPR L
Sbjct: 61  VQKLDELPHAPESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAVAFPRCL 120

Query: 120 GLELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIV 179
           GLELRS NPPRLH FAWHCGIRPEE PS HV LS+++TKEEYYR+SKVYFSVVHPIFD+V
Sbjct: 121 GLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVHPIFDVV 180

Query: 180 DPEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPT 239
           DP+QL KNVE+YW G+    EYGAVIAGV+ALGSFFLGS+GHPREMD++QYAKGILDDPT
Sbjct: 181 DPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKGILDDPT 240

Query: 240 FSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNV 299
           FSRIP+VE +SAWVLRTIYLRAT+RPHVAWLASC+TIHLSEAIGLH +ID+ + ++T+ V
Sbjct: 241 FSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEFSMTSGV 300

Query: 300 PLKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLA 359
            L+RT   +EHT+RLFW AWSINTILSYDYGRSSV LNRITCKPV+ET+G+YT++LV+LA
Sbjct: 301 TLRRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTIHLVALA 360

Query: 360 QLVPQESVNANVTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDKSVVS 419
           Q +PQ +VN ++TQLL AL A+H+SP+AHPFL LTK DICLS YRRLRLLNH+LDKSVV 
Sbjct: 361 QTIPQGTVNTDLTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLLNHVLDKSVVL 420

Query: 420 QIIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLDNIT 479
           QIIDIGN AL+AAYALVK+ Q+WWNVLSTSFQYVCVLLAIDTPESLSHVAAAM+TLDNIT
Sbjct: 421 QIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMKTLDNIT 480

Query: 480 QVLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDALLDPS 539
           +VLGTHIA EAQKTAKLLLEDS+KKKRQEIQQLEQATH RS  E T+ LDIDWDAL DPS
Sbjct: 481 EVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLDIDWDALFDPS 540

Query: 540 DTLSFM 545
            TL FM
Sbjct: 541 GTLGFM 546

>Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa]
           {ON} YOR380W (RDR1) - Transcriptional repressor (zinc
           cluster protein) [contig 358] FULL
          Length = 552

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/550 (56%), Positives = 395/550 (71%), Gaps = 10/550 (1%)

Query: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRM 60
           M ++G++    KR RVRKAC+PCR+RKRKC+   PC MC +YGY C Y + DGPL+    
Sbjct: 1   MVATGADVPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSF--- 57

Query: 61  NQVEELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLG 120
              E+ P   ++     +        S  S   +   I D +KSRY   HSAVAFPR LG
Sbjct: 58  --YEKRPSPKQSTSPSTIQKKEVERPSMLSPCSSERGIFDPSKSRYMSLHSAVAFPRYLG 115

Query: 121 LELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIVD 180
           LEL+S NPP LH FAW+CGIRPEE  + H  L++I++K++  R + VYF VVHP+FDI+D
Sbjct: 116 LELQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFDIID 175

Query: 181 PEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPTF 240
           P Q  ++++ YW G    S + AVI GV+ALGSFF  + GH RE+DI+QYAK IL+DPTF
Sbjct: 176 PSQFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQYAKDILEDPTF 235

Query: 241 SRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVP 300
           S  PS+EQISAWVLR+IYLRATARPHVAWLASC+T+HL EA  LHHE+D+ +LA  N+ P
Sbjct: 236 SSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAP 295

Query: 301 L-KRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLA 359
           L  R   V E  RRLFW AW INTI+SY+YGRS VTLN+I+CK +KE+  NYT  +V LA
Sbjct: 296 LPPRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAEMVELA 355

Query: 360 QLVPQESVNAN----VTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDK 415
           +++P  S  ++    V  L++A+  V+++ D HPFLSLTKAD+C SFYRRLRLLNH+LD+
Sbjct: 356 RMIPTTSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLNHVLDR 415

Query: 416 SVVSQIIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTL 475
           SVV QII+IG +AL+AA  LV+ +  WWNVLST F Y CVLLAID+P+SLS+VAAA    
Sbjct: 416 SVVLQIINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAAAKSIF 475

Query: 476 DNITQVLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDAL 535
           D+I ++L THIA EAQ TAKLLL DS+KKK++EI  LE A  +  AP T +  DIDWDAL
Sbjct: 476 DSIVKILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDIDWDAL 535

Query: 536 LDPSDTLSFM 545
           LDPS++L+ M
Sbjct: 536 LDPSNSLNLM 545

>KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} similar
           to uniprot|P23172 Saccharomyces cerevisiae YOR380W RDR1
           Transcriptional repressor involved in the control of
           multidrug resistance negatively regulates expression of
           the PDR5 gene member of the Gal4p family of zinc cluster
           proteins
          Length = 561

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/549 (54%), Positives = 374/549 (68%), Gaps = 21/549 (3%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHDTK 71
           KRQR RKACVPCR+RKR+C+G +PC MCV+Y Y CHY E+  P A+     + E+P  T+
Sbjct: 12  KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDP-ATLPAPLIPEIPDSTR 70

Query: 72  N-----------RPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLG 120
           +            P +   I+ N T     Q      + D  KSRY    SAVAF RSLG
Sbjct: 71  SISPPRTRMVAKPPSIRTKILLNSTQCAADQ-----GVFDAAKSRYMGLSSAVAFARSLG 125

Query: 121 LELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIVD 180
           +EL+S NPP LH FAW+CG+R EEK + H  L D++TKEE +  +++YFS +HP+FD+VD
Sbjct: 126 IELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSAIHPVFDVVD 185

Query: 181 PEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPTF 240
           PE   K+VE YWN   + S +GAV+ G+IALGS F G  GHPRE++I+QYAK +L+DPTF
Sbjct: 186 PEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYAKNVLEDPTF 245

Query: 241 SRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVP 300
           SR+PS EQ+SAWVLRT+YLRAT RPH AWLASC+TIHL+EA  LHHE++  +L   +   
Sbjct: 246 SRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVELTANDKAL 305

Query: 301 LKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLAQ 360
             RT +++E  RRLFW AWSIN+ILSYDYGRSS +L  I+CK   ++DGNYT  LV LA 
Sbjct: 306 PPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNYTAQLVDLAL 365

Query: 361 LVPQESVNAN----VTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDKS 416
           ++P  +  A+    V  LLQAL  V+E+PD H FLSL KAD+C SFYRRLRL N+ LD  
Sbjct: 366 IIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLRLFNYTLDSE 425

Query: 417 VVSQIIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLD 476
           VV Q+  + N AL+AAY LV+    WWNVLS  FQY+CVLLAI+T ESL++VA A    D
Sbjct: 426 VVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLANVAKAKNIFD 485

Query: 477 NITQVLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDALL 536
            I   L TH+A EAQ T KLLL+DS+KKKRQE+  LE A    +A E     +IDWD LL
Sbjct: 486 RIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFTAEIDWDVLL 545

Query: 537 DPSDTLSFM 545
           DPS  L  M
Sbjct: 546 DPSHALHLM 554

>KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 672

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 85/375 (22%), Positives = 141/375 (37%), Gaps = 76/375 (20%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPL---ASSRMNQVEELPHD 69
           R RVRKAC  C+ RK KCNG+ PC  C  +G VCHY  E  P+   AS+ +      P  
Sbjct: 25  RIRVRKACGTCKRRKVKCNGQQPCAGCAKHGSVCHYKVE--PVTRPASAALKAGAPGPAG 82

Query: 70  T---KNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLGLELRST 126
           T    ++   P D       ++  Q  + G      K R+  +H  +  P  LG  L S+
Sbjct: 83  TLPALSQVPAPSDFATGPAPASPWQRFSPG------KYRFHRRHQNLV-PYYLGQALISS 135

Query: 127 NP-----------PRLHCFAWHC--GIRPEEKPSFHVPLSDI--------VTKEEYYRIS 165
            P           PRL  + W+   G   ++  +F  P   +        + ++   + +
Sbjct: 136 LPPALVQKYALRAPRLQFYGWNMSGGHYLKQGSTFGAPQGTVWRWDLAVELQRQILEKCA 195

Query: 166 KVYFSVVHPIFDIVDPEQLGKNVEKYW-------NGDAETSEYGAVIAGVIALGSFFLGS 218
             +F  V+    IV  +   +     +       NG ++  E    +   IAL   + G+
Sbjct: 196 SFFFQHVNRFVSIVHEQAFWQQFRGGFLDGSDGKNGSSDLFEAILNLIAAIALRFSYSGA 255

Query: 219 LG--------------------HPREMD--IIQYAKGILDDPTFSRIPSVEQISAWVLRT 256
                                 H R ++  + + A  +    +F    S E I AW+L  
Sbjct: 256 GASVCEALTAAEVTWLDLHLTRHGRHLEETLFERAYAVTTRLSFE-WESFELIQAWLLAA 314

Query: 257 IYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVPLKRTTEVSEHTRRLFW 316
           +YLR   R    W A    + +   + L+           N  P K T       R  +W
Sbjct: 315 VYLRTCHRQVSCWQALSRAVQMCNGMSLY----------LNRFPEKHTAYDECRARNCYW 364

Query: 317 SAWSINTILSYDYGR 331
           + + ++ ++S+  GR
Sbjct: 365 ACFVLDRLISFQMGR 379

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/342 (22%), Positives = 140/342 (40%), Gaps = 76/342 (22%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGP------LASSRMNQVEEL 66
           R RV KAC+ CR++KR+C+GKSPC  C     +C YT    P       A+   N +  +
Sbjct: 25  RLRVFKACIACRKKKRRCDGKSPCSHCARTSIICEYTNTARPRSHSIAFANDVSNDIHLI 84

Query: 67  PHDTKNRPYVP------------LDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVA 114
              T +R + P            ++ + +G      Q+++   +I    S    ++  ++
Sbjct: 85  DSTTSSRSHSPKLSDKVNPYKTLIERLYSGASLESLQNLSREQLIKTLNSEEVNKNDTIS 144

Query: 115 F-PRSLGLELRSTNPPRLHCFAWHCGI-RPEEKPSFHVPLSDIVTKEEYYRISKVYFSVV 172
             PR + L+L       L  ++  C + R   +PS                         
Sbjct: 145 LPPRDIALKL------ILKTWSSACVLFRFYHRPS------------------------- 173

Query: 173 HPIFDIVDP-EQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLG--SLGHPREMDIIQ 229
             +  I+D   +LG N +      AE     ++I  V+A+G  F    +  + R ++   
Sbjct: 174 --LVKILDSLYELGTNPKTIKQRKAE-----SLIFAVLAVGELFSQEENNSYSRGLNYFN 226

Query: 230 YAKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASC-LTIHLSEAIGLHHEI 288
            AK ++D   F  I  +  I A  + TI+L+ +       L +C   I ++  I +   +
Sbjct: 227 KAKTLID---FKDINDIHSIQAIFMMTIFLQCSGD-----LKACYYYIGIALRIAIRENL 278

Query: 289 DREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYG 330
            R+  +LT    ++  T+     +RLFWS + ++  ++   G
Sbjct: 279 HRKP-SLTGPTAIEDETK-----KRLFWSIYKVDIYMNCTLG 314

>KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {ON}
           Anc_8.283 YLR098C
          Length = 664

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 92/407 (22%), Positives = 157/407 (38%), Gaps = 88/407 (21%)

Query: 17  RKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDG-----------------PLASSR 59
           R AC+ CR+R+RKC+ + PC +C+ +G  C +T ED                   L  S 
Sbjct: 16  RLACITCRQRRRKCDMQEPCSICIKFGTRCVFTGEDLRKSRHSASYVKTLENRIALLESS 75

Query: 60  MNQVEELPHDTKNRPY---VPLDII---------GNGTHSTDSQHVTNG-NIIDRTKSRY 106
             +++E  ++ +       VPLD I         GNGT+  D  ++ N  +    TKS  
Sbjct: 76  FRRLKESTNEEEKMNIINSVPLDDISVPANNETGGNGTYIKDQNYIDNTISFPSSTKSDL 135

Query: 107 TIQHSAVAFPRSLG--------LELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTK 158
               S+  FP            L LR+T+P  L+    H  + P    S +   S  +TK
Sbjct: 136 NKTKSSETFPTKNSVLPITKPDLPLRATSP--LNRNMNHAKLSPIGGSSIYPSNSLSITK 193

Query: 159 EE--------------------YYRISKVYFSVVHPI-FDIVDPEQLGKNVEKYWNGDAE 197
           ++                      R   ++F  ++P  +  +  E     +  ++ GDA 
Sbjct: 194 KKITLGQQQLQLTLKNLSRSPLILRSLSLFFKWLYPAHYMFIHRETF---LSAFF-GDAA 249

Query: 198 TSEYGAVIAGVIALGSFFLGSLGHPREM-----DIIQYAKGI-------LDDPTFSRIPS 245
           T  Y      V A+ +    +     E+     +  Q AK I       L+D + +   S
Sbjct: 250 TKAYYCSEELVFAIAALGCKAATKTEELYGQAENYYQRAKEIVLKKIFQLEDKSLAEATS 309

Query: 246 VEQ---ISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVPLK 302
             +   I   +    Y        +AW  S L   ++  IGLH   +       N+V   
Sbjct: 310 SSKLALIQTLLCLAFYDIGEGENPMAWYLSGLAFRIAHEIGLHLNPEA-----WNHVYED 364

Query: 303 RTTEVSEHTR-RLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETD 348
             +++    R R++W  +  + ++S  +GRS+    R++   V ETD
Sbjct: 365 ELSKIDFEVRSRIYWGCYIADHLISVLFGRSTSL--RVSNSTVPETD 409

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 95/376 (25%), Positives = 153/376 (40%), Gaps = 90/376 (23%)

Query: 4   SGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQV 63
           +G+N     R R  +ACV CR+RK +C+G++PC +C    + C Y  +  P  SS  ++ 
Sbjct: 18  AGTNELKPTRGRAHRACVACRKRKVRCSGQTPCRLCQNNSFECKY--DRPPRNSSAFDK- 74

Query: 64  EELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQ--------HSAVAF 115
            EL  D+      PL      +H   + +    ++ID  K   TI          ++ +F
Sbjct: 75  -ELSDDS------PL-YSQRASHQDHNDNKGRQSVIDYKKITETIFTPEALNQIFTSPSF 126

Query: 116 PRSLGLE----------------LRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTK- 158
              L L+                +R + P      +WH       K S  +P   I  K 
Sbjct: 127 DNQLFLDTIKRYLQQGQLDVNNVIRQSLPKNA---SWHL------KTSVPLPPRGIALKF 177

Query: 159 -EEYYRISKVYFSVVH-----PIFD-IVDPEQLGKNVEKYWNGDAETSEYGAVIAGVIAL 211
            ++ +  + V F   H      I D I + E+LGK         AE  +   +I  V+A+
Sbjct: 178 IQKTWDCACVLFRFYHRPTIISILDSIYEAEKLGKEYT------AEQVKTQPLIYSVLAV 231

Query: 212 GSFF-----LGSLGHPREM---DIIQY---AKGILDDPTFSRIPSVEQISAWVLRTIYLR 260
           G+ F            RE    +  +Y   AK  LD   FS I  +  I A  + TI+L+
Sbjct: 232 GALFSKEDLSKDSNATREFYTDEGYRYFLEAKKSLD---FSNITEIYSIQAIFMMTIFLQ 288

Query: 261 ATARPHVAWLASCLTIHLSEAI--GLHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSA 318
            +A     +  S + I L  A+  GLH +      ++    P++  T+     +RLFWS 
Sbjct: 289 CSANLKACY--SFIGIALRAALKEGLHRKS-----SIVGPTPIQDETK-----KRLFWSV 336

Query: 319 WSI----NTILSYDYG 330
           + +    N IL +  G
Sbjct: 337 YKLDLYMNCILGFPSG 352

>SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 687

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 80/379 (21%), Positives = 142/379 (37%), Gaps = 63/379 (16%)

Query: 5   GSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVE 64
           G +    +R RVRKAC  C++RK KC+G  PC  C      C Y   D     S+     
Sbjct: 13  GKDNGSKQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISKPKPGR 72

Query: 65  ELPHDTKNRPYVPLD---IIGNGTHSTDSQHVTNGNIIDRTKS-------------RYTI 108
            L  ++     + L+   +    +  T +   T  N++  + S             R+  
Sbjct: 73  SLDKESIANALLQLESSLLAKIDSKPTPTPTPTPPNLVHFSSSLPSPWQTFSLDKYRFHR 132

Query: 109 QHSAVAFPRSLGLELRSTNP-----------PRLHCFAWHCG----IRPEEKPSFH-VPL 152
           ++  +  P  LG  L  + P           PR+  + W+      ++     S   +  
Sbjct: 133 RYQNL-LPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHYLKNGSDSSLDIINF 191

Query: 153 SDIVTKEEYYRISKVYFSVVHPIFDIVDPEQLGKNVEK-YWNGDAETSEYGAVIAGVIAL 211
            D V  +   ++ + YF  ++P+F IV  +   +     + N    +S+    +  +I  
Sbjct: 192 DDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILA 251

Query: 212 GS--FFLG-SLGHP-----REMDIIQYAKGILDDPTF-------SRIP----SVEQISAW 252
            S  F+ G S   P      ++D +      L++  F       SR+     S E I +W
Sbjct: 252 TSLRFYEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSW 311

Query: 253 VLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVPLKRTTEVSEHTR 312
           +L   YLR   R    W A    I + + + L+           N  P + T       +
Sbjct: 312 LLIAFYLRTCHRQTSCWNALGSAIRMCKGMALY----------LNRFPQRHTLYEETKVK 361

Query: 313 RLFWSAWSINTILSYDYGR 331
             FWS + ++ ++S+  GR
Sbjct: 362 NCFWSCFIMDKVISFQMGR 380

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHDTK 71
           KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y +   P   S  +     P  T 
Sbjct: 31  KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ---PTKRSLQHLTTYAPSKTN 87

Query: 72  NRPYVPLDIIGNGTHSTDS 90
           N    PL    N   ST S
Sbjct: 88  NSSSSPLKQTTNQVKSTSS 106

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 5  GSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          GS+ QP KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y +
Sbjct: 22 GSSQQP-KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYNCTYNQ 66

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa]
          {ON} Anc_2.231 YIL130W
          Length = 1000

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%)

Query: 2  ASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          +++  NP   KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y +
Sbjct: 48 SNTQGNPIQLKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ 96

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.565
           YMR019W
          Length = 707

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 86/421 (20%), Positives = 147/421 (34%), Gaps = 117/421 (27%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSR-----MNQVEEL 66
           +R RV+KAC  C+ RK KC+G SPC  C+ +   C Y   D    +SR     +  V   
Sbjct: 8   QRLRVQKACDICKRRKVKCDGLSPCSNCIRHNVDCTY---DYRTFASRKKPRFITNVLSS 64

Query: 67  PHDTKNRPYVP------------------LDIIGNGTHSTDS---------------QHV 93
             ++     +P                  L++  N  HS++S                ++
Sbjct: 65  SRESSVASSIPLSSNGKSVFIEDQTAKLLLELSSNREHSSNSSLYVNDEKQLSSIRRDYI 124

Query: 94  TNGNIIDRTKS-RYTIQHSAVAF--------PRSLGLELRSTNP-----------PRLHC 133
            +G  ID  KS  +T       F        P  LG  L S  P           PR+  
Sbjct: 125 IHGPEIDNQKSPWFTFSRDKYRFHRRYQNVLPYYLGRSLLSQLPPDSIKSFNLEVPRIQN 184

Query: 134 FAWHCGIRPEEKPSFHVPLSDIVTKEEYY-------------RISKVYFSVVHPIFDIVD 180
           + W+       K S     +D     + +             ++   +F+ ++    I+D
Sbjct: 185 YGWNLSGGHYIKASTFSDSNDSNNNGDLFFNFDNSMHLSIVNKLLNFFFNEINKSLSILD 244

Query: 181 PEQLGKNVEKYWNG--------DAETSEYGAVIAGVIALG-SFFLGSLGHP--------- 222
                K   +Y NG        +  T  + +++  V+A+   F  G L  P         
Sbjct: 245 YSTFWK---QYNNGFLQQGKQNNNSTKLFTSILYLVLAIALRFKDGELQAPNVEEPFFSE 301

Query: 223 -----------REMDIIQYAKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLA 271
                      +E  +  Y+  I+   TF    S E + +W+L T YLR   R    W A
Sbjct: 302 EELLFLNKTHDKEGKLFNYSYSIVSKLTF-EWESFELLQSWLLITFYLRTCHRQIACWSA 360

Query: 272 SCLTIHLSEAIGLHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYGR 331
               + + + + LH           N +P   +          FW+ + ++ ++S+  GR
Sbjct: 361 LGKAVTMCKGMSLH----------LNQLPEIHSENDRIKAWNCFWAVFIMDKLISFQIGR 410

Query: 332 S 332
           +
Sbjct: 411 A 411

>KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2.565
           YMR019W
          Length = 608

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/332 (20%), Positives = 128/332 (38%), Gaps = 41/332 (12%)

Query: 14  QRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHDTKNR 73
           +RVR AC  C+ RK KC+GK PC  C     +C Y         +++    ++P      
Sbjct: 7   RRVRAACAVCQRRKLKCDGKQPCSRCARTDRICRY---------AKVQVQTQMPARASVV 57

Query: 74  PYVPLDI-IGNG------THSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLGLELRST 126
           P   + + +G G      + S    H    +++      Y  +      P S+ +     
Sbjct: 58  PRANVPVGLGRGSPWLGFSFSKFRFHRRYQDVL----PFYFCESVLAQLPESV-VAAEDL 112

Query: 127 NPPRLHCFAWHCG----IRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIVDPE 182
             P +  + W+      +    +PS   P        E   + + YF  V+P+F IV+  
Sbjct: 113 QLPSVQNYGWNLAGGAFLAFALQPSATRP-----PLRELRPLVQHYFDHVNPLFSIVNER 167

Query: 183 QLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPR--EMDIIQYAKGILDDPTF 240
                    W+  A+ +     I  ++A+ +        PR  E  +  ++  ++ + +F
Sbjct: 168 VFWSQ----WDSAADANSLFNAIGYLMAITAERYRCGPPPRVDETALFNHSYAVVSEFSF 223

Query: 241 SRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDL-ALTNNV 299
               SVE I +W+L   YLR   R    + A    + +   + L+ E   E + A     
Sbjct: 224 E-WESVELIQSWLLIAAYLRCCYRQTSCYAALARAVAMCRGMSLNLEAKPEQVDAEGEQT 282

Query: 300 PLKRTTEVSEHTRRLFWSAWSINTILSYDYGR 331
               +T    H    FW+ ++++ I S+  G+
Sbjct: 283 GALHSTGKYYHC---FWTVYTVDKIFSHQLGK 311

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 94/364 (25%), Positives = 149/364 (40%), Gaps = 66/364 (18%)

Query: 4   SGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQV 63
           +G+N     R R  +ACV CR+RK +C+G++PC +C    + C Y  +  P  SS  ++ 
Sbjct: 42  AGTNELKPTRGRAHRACVACRKRKVRCSGQTPCRLCQNNSFECKY--DRPPRNSSVFDR- 98

Query: 64  EELPHDTKNRPY-VPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAV---AFPRSL 119
            E+  D+ + P  +P      G     S    N   I  T     I H  V   +F    
Sbjct: 99  -EVSDDSSSYPQSIPHQ---EGEDKRSSTCTINYKNIVETIFPPEILHQIVTSPSFNNQF 154

Query: 120 GLELRSTNPPRLHCFAWHCGIR---PEEKP-----SFHVPLSDIVTK--EEYYRISKVYF 169
            L+   T   +      H  IR   P++ P     S  +P  +I  K  ++ +  + V F
Sbjct: 155 FLDTIKTYLLQGQLNVNHV-IRQSLPKDAPWHMKTSVPLPPREIALKFIQKTWDCACVLF 213

Query: 170 SVVH-----PIFD-IVDPEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPR 223
              H      I D I + E+LGK   KY     +T     +I  V+A+G+ F        
Sbjct: 214 RFYHRPTIISILDSIYEAEKLGK---KYTPEQVKTQ---PLIYSVLAVGALFSKEDLSKD 267

Query: 224 EMDIIQY-----------AKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLAS 272
                ++           AK  LD   FS I  +  I A  + TI+L+ +A     +  S
Sbjct: 268 SRATREFYTDEGYRYFLEAKKSLD---FSNITDIYSIQAIFMMTIFLQCSANLKACY--S 322

Query: 273 CLTIHLSEAI--GLHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSI----NTILS 326
            + I L  A+  GLH +      ++    P++  T+     +RLFWS + +    N IL 
Sbjct: 323 FIGIALRAALKDGLHRKS-----SIVGPTPIEDETK-----KRLFWSVYKLDLYMNCILG 372

Query: 327 YDYG 330
           +  G
Sbjct: 373 FPSG 376

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 85/374 (22%), Positives = 141/374 (37%), Gaps = 78/374 (20%)

Query: 16  VRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE--DGPLASSRMNQV-------EE 65
           V++AC  CR+RK +C+ + P C  C+ + + C Y+ +    PL    +N V       E 
Sbjct: 5   VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTRVHLNYVEKKLATLER 64

Query: 66  LPHDTKNRPYVPLDIIGNGTHSTDSQHV---TNGNIIDRTKSRYTIQHSAVAFPRSLGLE 122
           L H+    P +  +    G  S + + +      N I   K   T   + V       L 
Sbjct: 65  LFHEL--FPGIDPEKALQGKSSQNLRELIGSATSNSIPGNKDEITTAKTLVKPMHQPQLP 122

Query: 123 LRSTNPPRLHCFAW------------HCG--IRPEEKPSFHVPLSDI------------- 155
                   L+ F W             C   I P  K  F +  S +             
Sbjct: 123 QDEIPDDPLYGFDWIEEDDSVHKDDGMCALNINPNHKGYFGLGSSTVLLRSLKVNDIAPK 182

Query: 156 ------VTKEEY-----YRISK---VYFSVVHPIFDIVDPEQLGKNVEKYWNGDAETSE- 200
                 + KE Y     Y  SK    YFS  H  +  +  E     + +Y +    +S  
Sbjct: 183 LQRVPSIVKETYSLSAKYVTSKFIDAYFSQYHTTYPFIHKETF---MAQYKDQLRPSSMD 239

Query: 201 -YGAVIAGVIALGSFFLGSLGHPREMDIIQY--AKGILDDPTFSRIPSVEQISAWVLRTI 257
            +  ++  V+ALG + +   G   ++DI  Y  AK  L    F    SV  + A  L + 
Sbjct: 240 IWQILLNTVLALGCWCIN--GESSDIDIYYYQNAKSYLSSVVF-ETGSVSLVVALTLLSS 296

Query: 258 YLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWS 317
           Y++   +P+  W    L   ++ ++GLHHE  + +  L             E  RR++W 
Sbjct: 297 YVQKRNKPNSGWNYLGLATRMAISLGLHHEFPKMEETLL------------EQRRRVWWG 344

Query: 318 AWSINTILSYDYGR 331
            ++++  +S  YGR
Sbjct: 345 TYTLDCAVSITYGR 358

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (66%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          KR+RV +AC  CR++K KC+GK PC  C  Y Y C Y +
Sbjct: 6  KRRRVTRACDECRKKKVKCDGKQPCIHCTVYNYECTYNQ 44

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 8/78 (10%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHD-T 70
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y +   P   S  +   + P    
Sbjct: 12 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ---PTKRSNTSASTQSPQSAN 68

Query: 71 KNRPYVPLDIIGNGTHST 88
          + RP+ P     NG+ S+
Sbjct: 69 QQRPHGP----SNGSGSS 82

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMN 61
           KR+RV +AC  CR++K KC+G++PC  C  Y Y C Y   D P+  +  N
Sbjct: 64  KRRRVTRACDECRKKKVKCDGQNPCIHCTVYSYKCSY---DQPVKKNNTN 110

>Smik_5.9 Chr5 complement(10186..10212,10216..10227,10231..10359)
          [168 bp, 56 aa] {OFF} YOR380W (HSP)
          Length = 56

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 25/37 (67%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          +RV+  CV  RERK+  N +  CEMC  +GYVC+Y +
Sbjct: 1  ERVQNICVQIRERKKTYNDRFSCEMCFGHGYVCNYID 37

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 27/42 (64%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          Q  KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y +
Sbjct: 10 QSVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYKK 51

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
           PUT3Transcriptional activator of proline utilization
           genes, constitutively binds PUT1 and PUT2 promoter
           sequences as a dimer and undergoes a conformational
           change to form the active state; differentially
           phosphorylated in the presence of different nitrogen
           sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 11/101 (10%)

Query: 7   NPQPYKRQ-RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSR--MNQV 63
           N QP KRQ R   AC+ CR+R  KC G +PC+ CV    +C Y E    +  S   + Q+
Sbjct: 20  NKQPQKRQQRSSVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQL 79

Query: 64  EELPHDT---KNRPYV-----PLDIIGNGTHSTDSQHVTNG 96
           ++  +D     NR        P+ + G      D +H+ N 
Sbjct: 80  QKDLNDKTEENNRLKALLLERPVSVRGKDNSDDDERHINNA 120

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 27/42 (64%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          Q  KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y +
Sbjct: 10 QSVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYKK 51

>KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}
           Anc_1.128 YJL206C
          Length = 663

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 84/355 (23%), Positives = 137/355 (38%), Gaps = 57/355 (16%)

Query: 2   ASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMN 61
           A+S +     K QRVR AC  CR +KRKC+G+ PC  C    Y C Y             
Sbjct: 17  ANSVTRQLQLKEQRVRTACSMCRRKKRKCDGRVPCSFCTKNHYQCIY------------- 63

Query: 62  QVEELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTI-QHSAVAFPRSLG 120
             +   H +  R         +  ++ DS      NI D+    Y    H+ +    SL 
Sbjct: 64  --KNASHGSTTRE--AFSAKSSSLYALDSTVAPIENITDQKDQNYNRPPHTNL----SLN 115

Query: 121 LELRST---------NPPRLHCFAWHCGIRPEEKPSFHVPLSDIVT----------KEEY 161
            +LR T            + +  AW      E+ P   VP   + T          ++  
Sbjct: 116 SQLRQTLEKCITSKDETVKKNLLAWM-----EKSPDREVPAGLVNTDPRLEHILPPRDVA 170

Query: 162 YRISKVYFSVVHPIFDIVDPEQLGKNVEKYWNGDAE---TSEYGAVIAGVIALGSFFLGS 218
            ++  + ++    +F       + K ++  ++ D+    +S   A+I  V+A+GS F  +
Sbjct: 171 LKLIILAWNKACVLFRFYHRPTIVKILDSLYDEDSSVAWSSANEALIYSVLAVGSLFSHT 230

Query: 219 LGHPREMDIIQYAKGILDDPTFS---RIPSVEQISAWVLRTIYLRATARPHVAWLASCLT 275
             +  E+ I+Q   G      FS   R+  +  +S   LRTI        ++ + A    
Sbjct: 231 SSNT-ELTILQRYCGDHGGSFFSYSKRLIDLYCVSD--LRTIQTVFMMSLYLQFCADLSA 287

Query: 276 IHLSEAIGLHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYG 330
            H    I L   I RE   L +++      E  E  +RLFWS + +N  L+   G
Sbjct: 288 AHNLIGIALRSSI-REGYHLKSSLVGPTVIE-DEVKKRLFWSIYKMNAYLTSLLG 340

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 6  SNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          S PQ  KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y +
Sbjct: 2  SEPQS-KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ 45

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 27/42 (64%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          Q  KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y +
Sbjct: 10 QSVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYKK 51

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 26/39 (66%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y +
Sbjct: 10 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ 48

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 27/42 (64%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          Q  KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y +
Sbjct: 10 QSVKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYKK 51

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa]
          {ON} YGL013C (REAL)
          Length = 1080

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 1  MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDG 53
          M+ SG   +P  R +V KAC  CR+RK KCNGK PC  C  Y   C +T   G
Sbjct: 26 MSLSGRVRKP--RSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFTSRQG 76

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON}
          Anc_2.654 YKL015W
          Length = 1037

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 31/46 (67%)

Query: 5  GSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          G++ Q  K++++ +AC+ CRER  KC G  PC+ C+   ++C ++E
Sbjct: 44 GNSQQLGKKRKITRACIRCRERHIKCPGNDPCQKCLEANHICKFSE 89

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar
          to uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor
          Length = 1107

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 29/55 (52%), Gaps = 7/55 (12%)

Query: 3  SSGSNPQPYK-------RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          +S SNP   K       R +V KAC  CR RK KCNG  PC  C  YG  C YT+
Sbjct: 7  TSKSNPGEVKAQKPSTRRTKVGKACDSCRRRKIKCNGLKPCPSCTIYGCECTYTD 61

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 26/39 (66%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y +
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ 45

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 65

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 26/39 (66%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y +
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ 45

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa]
          {ON} Anc_4.113 YGL013C
          Length = 995

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 4/52 (7%)

Query: 3  SSGSNPQPYK----RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          ++ +N Q +K    R +VR+AC  CR+RK KC GK PC  C AY   C Y+E
Sbjct: 2  NTTNNQQEHKVTKPRIKVRQACDNCRKRKLKCTGKQPCSTCEAYSCDCIYSE 53

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          KR+RV +AC  CR++K KC+G+ PC  C  Y Y C Y
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 65

>TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1192

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%)

Query: 7  NPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEEL 66
          N    +R +V KAC  CR RK KCNG +PC  C  Y   C Y+  D    + ++ +   +
Sbjct: 15 NTAKKQRNKVSKACQSCRRRKIKCNGINPCSNCTTYECECIYSIPDSNSQTDKLGRANTI 74

Query: 67 PHDTKNRP 74
            +   +P
Sbjct: 75 KKNKVKKP 82

>TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.283
           YLR098C
          Length = 591

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 76/358 (21%), Positives = 138/358 (38%), Gaps = 44/358 (12%)

Query: 19  ACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED---GPLASSRMNQVEE---------L 66
           AC  CR+R+RKCN   PC  C+ +   C    ED       +S +  +EE          
Sbjct: 16  ACQNCRKRRRKCNFLIPCSNCIKFQTDCVAVNEDLRKTRYTASYVKSLEEKIAYLESNLT 75

Query: 67  PHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLGLELRST 126
             DTK +    + ++ +      +   +  N+  R K     +++ V  P      LRS+
Sbjct: 76  ESDTKEKTIDDIKLLNSSISLATASSASLLNVPKRDKKEVKNEYNLVENP------LRSS 129

Query: 127 NPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPI-FDIVDPEQLG 185
           +   +H  +        E       L ++       R    +F  ++P  +  +  E   
Sbjct: 130 SIYPMHSLSISKPFTSIEFKQTQTNLKNLTRSTAIMRSLSFFFKWLYPAHYFFIHRETFL 189

Query: 186 KNVEKYWNGDAETSEY---GAVIAGVIALGSFFLGSLG--HPREMDIIQYAKGI------ 234
            +    + GD  T  Y     ++  + ALG+  + S    + R  +  Q +K I      
Sbjct: 190 SS----FFGDTNTKSYYCSEELVFAMSALGAKLVKSDDELYGRSTEFYQTSKSIVLKKVF 245

Query: 235 -LDDPTFS-RIPS--VEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDR 290
            L+D +F+   PS  +  I   +    Y        +AW  S L   ++  IGL  + D 
Sbjct: 246 QLEDSSFADSTPSSKLAIIQTLLCLAFYDIGNGENPMAWYLSGLAFRIAHEIGLQLDPDA 305

Query: 291 EDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETD 348
                 N++  K   EV     R++W  +  + ++S  +GR++    +++   V ETD
Sbjct: 306 WSNVYENDLS-KIDFEVRS---RIYWGCYIADHMISILFGRTTTL--KLSNSTVPETD 357

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 38/80 (47%), Gaps = 8/80 (10%)

Query: 2  ASSGSNPQPYKRQ---RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASS 58
           SS + P  Y ++   RV +AC  CR+RK KCNG  PC  C+     CHY   DG     
Sbjct: 3  GSSITKPYTYNKRSSHRVSRACNSCRKRKVKCNGVQPCSKCITSNLRCHY---DGIQVDM 59

Query: 59 RMNQVEELPHDTKN--RPYV 76
            N + +   D +   RP V
Sbjct: 60 VKNNLYKDEEDVRKCLRPLV 79

>KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conserved
           hypothetical protein
          Length = 632

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 77/194 (39%), Gaps = 38/194 (19%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGY--VCHYTEEDGPLASSRMNQVEEL-PH 68
           KR+R  K+C  C E K KCN +SPC  C   G    C Y  +   + +  ++  E   P 
Sbjct: 5   KRRRSIKSCKYCYEHKLKCNKQSPCNNCARLGITNFCVYGFKKDEVDAKPLSSTETFKPK 64

Query: 69  DT---------KNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSL 119
           D          K +PY P     N      ++H  + N  D    R              
Sbjct: 65  DQVLKTSSTHPKTKPYYPYLSGANAEEVLSNRHQAHKNPTDACMKRN------------- 111

Query: 120 GLELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIV 179
             E+ + N   + C +       EE  S  +P S   T    + +  VYF  +HPI  ++
Sbjct: 112 --EVTNFNKFDVKCMSV------EEVASL-IPPSQAST----FLVVDVYFHKIHPIIPVL 158

Query: 180 DPEQLGKNVEKYWN 193
           D E++ + +E+ ++
Sbjct: 159 DREEVFRQIEEVYS 172

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa]
          {ON} weakly similar to uniprot|P40467 Saccharomyces
          cerevisiae YIL130W ASG1 Proposed transcriptional
          activator member of the Gal4p family of zinc cluster
          proteins and to YJL206C uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 780

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          QP KR RV +AC  CR+RK +C+G+ PC  C  Y Y C Y
Sbjct: 22 QP-KRLRVSRACDVCRQRKVRCDGRQPCIHCTVYSYNCTY 60

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa]
          {ON} YGL013C (REAL)
          Length = 1069

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 4  SGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDG 53
          SG   +P  R +V KAC  CR+RK KCNGK PC  C  Y   C +T   G
Sbjct: 29 SGKVRKP--RSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFTTRQG 76

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 878

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          + R+RV KAC  CR +K KCNG+  C  C+ YG  C YT
Sbjct: 7  HSRRRVSKACDSCRSKKIKCNGEQTCSNCLKYGCPCTYT 45

>ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595
          aa] {ON} similar to uniprot|P43634 Saccharomyces
          cerevisiae YLR098C CHA4 Zinc-finger protein with
          Zn[2]-Cys[6] fungal- type binuclear cluster domain
          DNA-binding transcriptional activator or CHA1
          Length = 595

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 1  MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          M  SGS+P      R + AC  CR+R+RKCN + PC  CV YG  C   ++D
Sbjct: 1  MKRSGSSPDEPSNSR-KLACQNCRKRRRKCNSEIPCSNCVKYGIECVPVDQD 51

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 69/171 (40%), Gaps = 23/171 (13%)

Query: 194 GDAETSEY---GAVIAGVIALGSFFLGSLGH--PREMDIIQYAKGI-------LDDPTFS 241
           GD     Y     ++  + ALGS    S G    +  +  Q AK         LD  +F+
Sbjct: 192 GDESAKSYYCSEELLYAIAALGSKLSSSDGELFGKSEEYYQTAKNKALKLVFQLDGNSFA 251

Query: 242 RIPSVEQ---ISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNN 298
            + S  +   I   +    Y  A     +AW  S L   ++  IGLH   +       N+
Sbjct: 252 ELTSSNKLAFIQTLLCLAFYDVAAGENAMAWYLSGLAFRIAHEIGLHLNPNA-----WND 306

Query: 299 VPLKRTTEVSEHTR-RLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETD 348
           V     +++    R R++W  +  + ++S  +GRS+    R++   V ETD
Sbjct: 307 VYEDELSDLDFEVRSRIYWGCYIADHLISVLFGRSTTL--RLSNSTVPETD 355

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
          similar to uniprot|P50104 Saccharomyces cerevisiae
          YMR019W STB4 Protein that binds Sin3p in a two- hybrid
          assay
          Length = 912

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 23/37 (62%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
           R RVRKAC  C+ RK KC+G  PC  CV +G  C Y
Sbjct: 9  NRLRVRKACEICKRRKVKCDGSQPCANCVKHGQECKY 45

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 44/109 (40%), Gaps = 11/109 (10%)

Query: 223 REMDIIQYAKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAI 282
           RE  + +YA  ++   TF    S E I +W+L T Y R   R    W A    I++   +
Sbjct: 342 REEAMFKYAYSVITQLTF-EWESFELIQSWLLITFYFRTCYRQTACWNALGQAINMCNGM 400

Query: 283 GLHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYGR 331
            L+           N  P   +          FW+ + ++ ++S+  GR
Sbjct: 401 SLY----------LNRFPRTHSKYDESRAWHCFWACFIMDKLISFQMGR 439

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130w
          Length = 847

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%)

Query: 9  QPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          Q  KR++V +AC  CR++K KC+G  PC  C  Y Y C Y 
Sbjct: 9  QEGKRRKVTRACDDCRKKKVKCDGNQPCIHCTVYSYECTYN 49

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa]
          {ON} Anc_4.113
          Length = 1118

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 7/59 (11%)

Query: 2  ASSGSNPQPYKRQRVRK-------ACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDG 53
          A+S S   P K +++RK       AC  CR RK KC GK+PC  C AY  +C Y+ + G
Sbjct: 38 ATSTSLHVPTKEKKIRKPSNKVTKACDNCRRRKIKCTGKTPCATCEAYQCLCIYSTQRG 96

>YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}
           PDR3Transcriptional activator of the pleiotropic drug
           resistance network, regulates expression of ATP-binding
           cassette (ABC) transporters through binding to
           cis-acting sites known as PDREs (PDR responsive
           elements); post-translationally up-regulated in cells
           lacking a functional mitochondrial genome
          Length = 976

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 38/88 (43%), Gaps = 7/88 (7%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHDTKN 72
           R +V  ACV CR+RK KC GK PC  C++Y   C + ++  P       Q E+       
Sbjct: 8   RSKVSTACVNCRKRKIKCTGKYPCTNCISYDCTCVFLKKHLP-------QKEDSSQSLPT 60

Query: 73  RPYVPLDIIGNGTHSTDSQHVTNGNIID 100
               P     N   S D QH+     +D
Sbjct: 61  TAVAPPSSHANVEASADVQHLDTAIKLD 88

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa]
          {ON} similar to uniprot|P39529 Saccharomyces cerevisiae
          YJL206C and some similarities with YIL130W
          uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
          Proposed transcriptional activator member of the Gal4p
          family of zinc cluster proteins
          Length = 650

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSR 59
          R +V+ AC  C+ERK +C+G+SPC  C+     C Y     PL   R
Sbjct: 29 RHKVKHACSSCKERKVRCDGQSPCASCINARVKCEYVMNMKPLKKKR 75

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
          PDR1Zinc cluster protein that is a master regulator
          involved in recruiting other zinc cluster proteins to
          pleiotropic drug response elements (PDREs) to fine tune
          the regulation of multidrug resistance genes
          Length = 1068

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 24/41 (58%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDG 53
          R +V KAC  CR+RK KCNGK PC  C  Y   C ++   G
Sbjct: 39 RSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTFSTRQG 79

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa]
          {ON} YGL013C (REAL)
          Length = 1000

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 1  MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDG 53
          M+ +G   +P  R +V KAC  CR+RK KCNGK PC  C  Y   C +T   G
Sbjct: 26 MSLTGRVRKP--RSKVSKACDNCRKRKIKCNGKFPCASCEIYLCECTFTTRHG 76

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 90/370 (24%), Positives = 140/370 (37%), Gaps = 78/370 (21%)

Query: 4   SGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE------------- 50
           +G+N     R R  +AC+ CR+RK +C+G+ PC  C      C Y               
Sbjct: 51  AGTNELKPTRGRAHRACMACRKRKVRCSGQIPCRFCHTNKLECTYDRPPRKPPVFGRELS 110

Query: 51  EDGPLASSRMNQVEELPHDTKN-----RPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSR 105
           +D  L S   +Q  ++   +       R  V   I     H   +    N  I   T   
Sbjct: 111 DDNSLYSQGTSQQGDVRTTSSQSTIDYRSIVEAIIPPEALHQIVTSPSFNNEIFLETVKA 170

Query: 106 YTIQHSAVAFPRSLGLELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTK--EEYYR 163
           Y++Q        S+  E    N P      W        K +  +P  DI  K  ++ + 
Sbjct: 171 YSLQGQLDV--NSIIRESLPKNTP------WRI------KTNIPLPPRDIALKFIQKTWD 216

Query: 164 ISKVYFSVVH--PIFDIVD----PEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFF-- 215
            + V F   H   I  I+D     E+LGK          E  +   +I  V+A+G+ F  
Sbjct: 217 CACVLFRFYHRPTIISILDSIYAAEKLGKEYT------PEQVKTKPLIYSVLAVGALFSK 270

Query: 216 ---LGSLGHPREM---DIIQY---AKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPH 266
                     RE    +  +Y   AK  LD   FS I  +  I A  + TI+L+ +A   
Sbjct: 271 DDLSKDSNATREFYTDEGYRYFLEAKRSLD---FSNITDIYSIQAIFMMTIFLQCSANLK 327

Query: 267 VAWLASCLTIHLSEAI--GLHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSI--- 321
             +  S + I L  A+  GLH +      ++T    ++  T+     +RLFWS + +   
Sbjct: 328 ACY--SFIGIALRAALKEGLHRKS-----SITGPTAIQDETK-----KRLFWSVYKLDLY 375

Query: 322 -NTILSYDYG 330
            N IL +  G
Sbjct: 376 MNCILGFPSG 385

>KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar to
           uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
           Positive regulator of PUT (proline utilization) genes
           zinc-finger transcription factor of the Zn(2)-Cys(6)
           binuclear cluster domain type
          Length = 834

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 13  RQRVRK---ACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHD 69
           ++R+++   ACV CR R  KC+G+ PC  CVA    C Y E +  L  S M  +++L  D
Sbjct: 43  KRRIKRSGLACVRCRRRHAKCSGEKPCSTCVAANIACEYMEPNKKLVVS-MKYLQKLQSD 101

>Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W
          (REAL)
          Length = 1010

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGP 54
          R +V  ACV CR+RK KC GK PC  C++Y   C + +   P
Sbjct: 49 RSKVSTACVNCRKRKIKCTGKHPCTNCISYDCTCVFLKRYLP 90

>KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa]
          {ON} 
          Length = 968

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%)

Query: 3  SSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEE 51
          + G     ++R++   AC  CR RK KC GK PC  C AY  VC Y ++
Sbjct: 11 ADGVQKPAHRRRKTVLACTNCRRRKIKCTGKWPCSNCEAYSCVCEYVDK 59

>Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R +V  AC+ CR+RK KC GK PC  C++Y   C +
Sbjct: 8  RSKVSTACINCRKRKIKCTGKHPCTNCISYNCTCVF 43

>Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          R +V  ACV CR+RK KC GK PC  C++Y   C + +++
Sbjct: 8  RSKVPTACVNCRKRKIKCTGKYPCTNCISYDCTCVFLKKN 47

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976
          aa] {ON} YKL015W (REAL)
          Length = 976

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          ++QR   AC+ CR+R  KC G +PC+ CVA   +C Y E
Sbjct: 26 RQQRSSIACLSCRKRHIKCPGGNPCQKCVASNAICEYLE 64

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          KR+RV +AC  CR++K KC+ + PC  C  Y Y C Y +
Sbjct: 10 KRRRVTRACDECRKKKVKCDSRHPCIHCTVYSYECTYNQ 48

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          KR+R+ +AC  CR++K KC+ + PC  C  Y Y C Y +
Sbjct: 14 KRRRITRACDECRKKKVKCDNRHPCIHCTVYSYECTYNQ 52

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
          uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 4  SGSNPQPYKRQRVRKACVPCRERKRKCN-GKSPCEMCV--AYGYVCHYTEE 51
          +G+  Q  KR RV  +C  CR+RK KC+ G+  C+ CV    G++CHY E+
Sbjct: 9  TGTPQQKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLCHYMEQ 59

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (60%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          R++V KAC+ CR RK KC G  PC  C AY   C + E
Sbjct: 10 RKKVVKACLNCRRRKIKCTGTFPCSNCAAYQCECVFDE 47

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1030

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (64%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          R +VR+AC  CR+RK KC G  PC  C AYG  C ++
Sbjct: 28 RNKVRRACNNCRKRKIKCTGLHPCASCEAYGCPCIFS 64

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
          Putative protein of unknown function; similar to
          transcriptional regulators from the Zn[2]-Cys[6]
          binuclear cluster protein family; mRNA is weakly cell
          cycle regulated, peaking in S phase; induced rapidly
          upon MMS treatment
          Length = 758

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 4  SGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          +G+N     + R  +AC+ CR+RK +C+G  PC +C    Y C Y
Sbjct: 31 AGTNELKPTKGRAHRACIACRKRKVRCSGNIPCRLCQTNSYECKY 75

>SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]
          {ON} similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 831

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 9  QPYKRQ-RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELP 67
          Q  KRQ R   ACV CR R  KC G +PC  C+A    C Y E +  L  S M  +++L 
Sbjct: 36 QLRKRQKRSSMACVRCRRRHVKCPGGNPCSKCIAANIACEYIEPNKKLIVS-MKYLQKLQ 94

Query: 68 HD 69
           D
Sbjct: 95 SD 96

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 26/37 (70%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          ++RV KAC  CR+ K KC+G+ PC+ C++   +C Y+
Sbjct: 4  KKRVSKACDTCRKSKTKCDGERPCQRCLSENKICTYS 40

>Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]
          {ON} complement(116430..119819) [3390 nt, 1130 aa]
          Length = 1129

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDG 53
          R +V +AC  CR RK KC+G  PC  C+ Y   C +T  D 
Sbjct: 33 RSKVSRACEGCRRRKIKCSGNWPCSSCITYDCECIFTSSDS 73

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
          similar to Ashbya gossypii AER183C
          Length = 898

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          R+RV KAC  CR +K KCNG+ PC  C  +   C YT
Sbjct: 20 RKRVSKACDTCRAKKIKCNGEEPCSNCGKHDLECAYT 56

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa]
          {ON} 
          Length = 632

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          R AC+ CR +++KCN KSPC  C   G  C +T ED
Sbjct: 18 RLACLHCRHKRKKCNMKSPCSNCQRAGMKCIFTHED 53

>KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654
           YKL015W
          Length = 896

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
           R R+  ACV CR R  KC G +PC  C+A    C Y E
Sbjct: 69  RSRLPVACVACRRRHSKCPGGNPCSKCIAANLTCEYIE 106

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981
          aa] {ON} YKL015W (REAL)
          Length = 981

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 3  SSGSNPQPYKRQ-RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          S+  N Q  +RQ R   AC+ CR+R  KC G SPC+ C+    +C Y E
Sbjct: 16 SACVNKQRQRRQPRSAVACLSCRKRHIKCPGGSPCQKCITSNAICEYLE 64

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 10 PYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSR 59
          P  ++RV KAC  CR+ K KC+G+ PC  C+    +C Y+  +   A S+
Sbjct: 12 PTIKRRVSKACDACRKSKTKCDGERPCSRCLKENKLCTYSNSNIGYAESK 61

>ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON}
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 1036

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 21/36 (58%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R +V +AC  CR RK KC GK PC  C AY   C Y
Sbjct: 10 RNKVNRACYNCRRRKIKCTGKYPCSSCEAYQCECLY 45

>KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON}
          similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 865

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 7  NPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEEL 66
          N +  K +R   AC  CR R  KC G +PC  C+  G  C Y E +  L  S M+ ++ L
Sbjct: 33 NDKKKKVKRSSLACTRCRRRHIKCPGGNPCSKCLKAGVACEYVEPNKKLIVS-MSYLQRL 91

Query: 67 PHD 69
           +D
Sbjct: 92 QND 94

>Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar to
           Ashbya gossypii ACL096W
          Length = 847

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 4   SGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQV 63
            G N +  +++R   AC+ CR+R  +C G +PC  CV+    C Y E    L  S M  +
Sbjct: 43  GGGNKE--RKKRAPLACLRCRKRHVRCPGGNPCSKCVSANIACEYLEPSKKLIVS-MKYL 99

Query: 64  EELPHD 69
           ++L HD
Sbjct: 100 QKLQHD 105

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDG----PLASSRMNQVEEL 66
          + +V++AC  CR RK +C+G  PC  CV+    C+Y +  G    PL S ++    EL
Sbjct: 6  KAKVKRACQICRRRKIRCDGYLPCSSCVSLKKECNYHDSAGIKKPPLNSKKIQMYREL 63

>NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa]
          {ON} Anc_2.565
          Length = 803

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          +R RV++AC  C++RK KC+G  PC  C+     C YT
Sbjct: 17 QRLRVQRACAICKKRKVKCDGMKPCSNCIKRSKDCTYT 54

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 43/108 (39%), Gaps = 11/108 (10%)

Query: 224 EMDIIQYAKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIG 283
           E  +  Y+  I+   TF    S E I +W+L T YLR   R   +W A    I+L   + 
Sbjct: 380 EDSMFNYSYSIISKLTF-EWESFELIQSWLLITFYLRTCYRQTSSWHALGQAINLCNGMS 438

Query: 284 LHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYGR 331
           LH           N  P   +          FW+ + I+  +S+  GR
Sbjct: 439 LH----------LNEFPHIHSKYEESKLFHCFWACFIIDKFISFQLGR 476

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
          {ON} weakly similar to uniprot|P12383 Saccharomyces
          cerevisiae YGL013C PDR1 Zinc cluster protein that is a
          master regulator involved in recruiting other zinc
          cluster proteins to pleiotropic drug response elements
          (PDREs) to fine tune the regulation of multidrug
          resistance genes
          Length = 1082

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%)

Query: 4  SGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          S  N     R++V +AC  CR++K KC+G  PC+ C  YG  C Y+
Sbjct: 39 SNGNGTGKPRRKVSRACDSCRKKKIKCSGTLPCKSCETYGCECVYS 84

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {ON}
           Anc_4.113
          Length = 1043

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 4/90 (4%)

Query: 15  RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHDTKNRP 74
           +V KAC  CR+RK KC GK PC  C AY   C Y+ +     +S+ N   ++  +    P
Sbjct: 43  KVSKACDNCRKRKIKCTGKQPCATCEAYQCPCIYSTQKR--KTSKRNNTAKM--EQPEIP 98

Query: 75  YVPLDIIGNGTHSTDSQHVTNGNIIDRTKS 104
             P  +  N ++++ S    NG   D   S
Sbjct: 99  NGPNSVETNSSYTSCSSICLNGAKQDSVSS 128

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa]
          {ON} 
          Length = 1113

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (57%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          R++V KAC  CR RK KC G  PC  C AY   C + +
Sbjct: 30 RKKVSKACANCRRRKIKCTGTYPCSNCAAYQCECIFDD 67

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 14/91 (15%)

Query: 10  PYKRQRVRKACVPCRERKRKCNG----KSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEE 65
           PYKR RV KAC  CR RK KC+     K+ C  C+    +C ++E D    ++  N    
Sbjct: 154 PYKR-RVVKACYNCRRRKIKCDAIDPSKNKCSNCLKLNKICSFSENDE--INTPFNISHN 210

Query: 66  LPHDTKNRPYVPLDIIGNGTHSTDSQHVTNG 96
             ++ K +   P+       HS++ QH  +G
Sbjct: 211 STNNKKQKSNPPI-------HSSNIQHSISG 234

>KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON}
          some similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 688

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 24/28 (85%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCV 40
          R+++ KAC+ C++RK+KC+G+ PC+ CV
Sbjct: 3  RKKMMKACIKCKQRKKKCSGQLPCDYCV 30

>KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some
          similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 688

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 24/28 (85%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCV 40
          R+++ KAC+ C++RK+KC+G+ PC+ CV
Sbjct: 3  RKKMMKACIKCKQRKKKCSGQLPCDYCV 30

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
          (REAL)
          Length = 894

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%)

Query: 3  SSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          ++ SN     R RV+KAC  C++RK KC+G  PC  C  +   C Y
Sbjct: 15 TAASNENSKTRLRVQKACELCKKRKVKCDGNKPCLNCSKHQKECRY 60

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 46/114 (40%), Gaps = 14/114 (12%)

Query: 220 GHP--REMDIIQYAKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIH 277
           G P   EM + +YA  I++  TF    S E I +W+L   Y R   R    W A    ++
Sbjct: 430 GKPFIEEM-MFEYAYSIINTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNALSQAVN 487

Query: 278 LSEAIGLHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYGR 331
           +   + L+           N  P   +T         FW  + ++ ++S+  GR
Sbjct: 488 MCNGMTLY----------LNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQTGR 531

>KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 938

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 23/43 (53%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGP 54
          KR +V +AC  CR RK KC G +PC  C  Y   C Y  +  P
Sbjct: 15 KRSKVSRACNNCRRRKIKCTGANPCLNCQTYKCECTYNLQSPP 57

>Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W
          (PUT3) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 245]
          FULL
          Length = 822

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 1  MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRM 60
          M   GS       +R   ACV CR R  KC+G +PC  C A    C Y E +  L  S M
Sbjct: 30 MEEIGSKGVKRSIKRSGLACVRCRRRHAKCSGDNPCTTCRAANIACEYLEPNKKLVVS-M 88

Query: 61 NQVEELPHD 69
            +++L  D
Sbjct: 89 KYLQKLQSD 97

>KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 820

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 22/35 (62%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          +R  +AC+ CR RK KC+G+SPC  C  Y   C Y
Sbjct: 12 ERAARACLNCRRRKVKCSGQSPCANCRNYNCACTY 46

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
           R+RV KAC  CR +K +CNG+ PC  C  +   C YT
Sbjct: 74  RKRVSKACDICRAKKIRCNGEEPCVNCEKFNLGCTYT 110

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 13/91 (14%)

Query: 246 VEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVPLKRTT 305
           V  + A +L ++YL  +  P   +L     I L + +GLH    RE              
Sbjct: 379 VGYMQAIILLSVYLENSPVPQTTYLQLSFAIRLGQTLGLHQ---RESYM--------HIK 427

Query: 306 EVSEHTRRL--FWSAWSINTILSYDYGRSSV 334
           +++E  RRL  +W  +  + +LS   GR S+
Sbjct: 428 DIAERNRRLNVWWWCYRYDKVLSVCTGRPSL 458

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985
          aa] {ON} YKL015W (REAL)
          Length = 985

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 6/44 (13%)

Query: 13 RQRVRK------ACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          +QR RK      AC+ CR+R  KC G +PC+ C+    +C Y E
Sbjct: 21 KQRQRKQPRSAVACLSCRKRHIKCPGGNPCQKCITSNAICEYLE 64

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
           KR R+  +C  CR+RK KC+ K P C  C   G  ++CHY E+
Sbjct: 110 KRNRIPLSCTICRKRKVKCDKKRPHCNQCTKTGVSHLCHYMEQ 152

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
          (PDR1) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
          FULL
          Length = 924

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 25/47 (53%)

Query: 3  SSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          +SG+     KR +V +AC  CR RK KC G  PC  C  Y   C Y+
Sbjct: 2  NSGNRVVKKKRSKVSRACNNCRRRKIKCTGAQPCLNCQTYRCECTYS 48

>TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1429

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 1  MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          ++ S  N    KR R+  +C  CR+RK KC+   P C  CV  G  ++CHY E+
Sbjct: 26 ISESAKNKIKRKRNRIPLSCTICRKRKVKCDKTHPHCNQCVKTGVQHLCHYMEQ 79

>TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {ON} 
          Length = 696

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHDTK 71
           K  R  KAC  CR RK KC+  SPC  CVA    C +++E   L +S      +L HD  
Sbjct: 20  KAPRTPKACDNCRRRKIKCSNISPCLNCVASALKCVHSQEPKRLNTSFFESPFKLNHDLS 79

Query: 72  NRPYVPLDIIGNGTHSTDSQHVTN 95
           +     L  + N   S +SQ V N
Sbjct: 80  SLKD-SLAGLSNRLLSANSQEVKN 102

>Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar to
          Saccharomyces cerevisiae YBL005W
          Length = 943

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 22/35 (62%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          ++++AC  CR RK KC G  PC  CVAY   C Y+
Sbjct: 11 KIKRACDNCRRRKIKCTGTQPCACCVAYQCGCVYS 45

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa]
          {ON} 
          Length = 1107

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 22/35 (62%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          +V KAC  CR+RK KC GK PC  C AY   C Y+
Sbjct: 39 KVSKACDNCRKRKIKCTGKMPCPTCEAYQCPCIYS 73

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
          weakly similar to uniprot|P33200 Saccharomyces
          cerevisiae YBL005W PDR3 Transcriptional activator of
          the pleiotropic drug resistance network regulates
          expression of ATP-binding cassette (ABC) transporters
          through binding to cis-acting sites known as PDREs (PDR
          responsive elements)
          Length = 940

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 22/39 (56%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDG 53
          +V +AC  CR RK KC GK PC  C AY   C Y+   G
Sbjct: 23 KVSRACDNCRRRKIKCTGKQPCSNCQAYQCHCEYSIRRG 61

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 3   SSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
           ++  N +  KR RV   C  CR RK +C+  +PC  CVA    C Y+
Sbjct: 58  NNAGNKRVMKRNRVSYVCYACRRRKTRCDRGNPCSKCVALSTECVYS 104

>TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1086

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLAS 57
          R +V +AC  CR RK KC G  PC  CV Y   C +++  G L+S
Sbjct: 13 RSKVSRACENCRRRKIKCTGNQPCNNCVTYQCECIFSK--GTLSS 55

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
          [3870 nt, 1290 aa]
          Length = 1289

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 4  SGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          S SN    KR R+  +C  CR+RK KC+   P C  C   G  ++CHY E+
Sbjct: 11 SASNKVKRKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQ 61

>NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56
          Length = 718

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          +R R AC  CR R++KC+   PC  C+  G  C+  EED
Sbjct: 31 KRKRLACSNCRRRRKKCDLNFPCANCIRLGLNCNVNEED 69

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa]
          {ON} Anc_2.654
          Length = 902

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 6  SNPQPYKRQRVRK-ACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          +N +P  ++R +  AC+ CR+R  KC+G +PC  C+ +   C Y E
Sbjct: 14 NNTEPSSKRRPKSLACILCRKRHIKCSGGNPCARCIKHDLKCEYIE 59

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
           similar to uniprot|P39961 Saccharomyces cerevisiae
           YER184C Hypothetical ORF
          Length = 817

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 43/92 (46%), Gaps = 17/92 (18%)

Query: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRM 60
           MA+     + Y  ++  +AC+ CR RK KCNG  PC  C   G  C Y   D P     +
Sbjct: 32  MATPRVTKRAYTIRKTPQACISCRRRKVKCNGCRPCSSCKTNGLECAY---DTP----SL 84

Query: 61  NQVEELPHDTKNRPYV----PLDIIGNGTHST 88
            QV     + K +P++     L +I N  HST
Sbjct: 85  EQV-----NIKGKPHIDTSEALRLISN-LHST 110

>KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conserved
           hypothetical protein
          Length = 946

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/243 (20%), Positives = 98/243 (40%), Gaps = 43/243 (17%)

Query: 11  YKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEED------GPLASSRMNQV 63
           ++RQR   +CVPC +RK KC  + P C  C+   + C Y   D       P A +R    
Sbjct: 26  HRRQRKILSCVPCHKRKIKCTREQPSCSKCLKRNWDCSYFLNDRVSRGGQPTAETRTEGS 85

Query: 64  EELP-------HDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRY---------- 106
            +LP       HD + +  + + I    +   D +++   N   + K  Y          
Sbjct: 86  AQLPTNIVSGKHDPQKKKQLLMAIEKAKSMINDERNLLELN--RKQKREYPRRKQAWETD 143

Query: 107 ---------TIQHSAVAFPRSLGLELRSTNPPRLHCFAWHCGIRPEEKP---SFHVPLSD 154
                    +  H+   +P +      S + P +     +  ++   +P      +P+  
Sbjct: 144 QPVSGTVTPSGGHNQHEYPVASVTSGTSQSTPTISPPMSYSSMQDSPRPLSGENSLPMY- 202

Query: 155 IVTKEEYYRISKVYFSVVHPIFDIVDPEQLGKNVEKYWN----GDAETSEYGAVIAGVIA 210
           + T++    + +VY + VHPI  ++D  +   + E +WN    G++  +++  ++  V+ 
Sbjct: 203 LPTRQRAVELFEVYRNTVHPIIPLLDFSKFMSDQETFWNEVDQGESGNTDFLLILFPVLY 262

Query: 211 LGS 213
             S
Sbjct: 263 AAS 265

>Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785
          bp, 594 aa] {ON} complement(32885..34586,34699..34781)
          [1785 nt, 595 aa]
          Length = 594

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 5  GSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVC 46
          GS+    KR   + AC  CR+R+RKCN + PC  C+ +G  C
Sbjct: 17 GSDSSGLKR---KLACQGCRKRRRKCNFEVPCSNCIKFGSEC 55

>Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa]
          {ON} YLR098C (REAL)
          Length = 644

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 1  MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          MA++  N     R+R + AC  CR R+RKC+ + PC  C+ +   C + ++D
Sbjct: 26 MANNEENNDNVPRKR-KLACQSCRRRRRKCDMEKPCSNCIKFQTDCVFAQQD 76

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1233

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 51/119 (42%), Gaps = 15/119 (12%)

Query: 9   QPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTE----EDGPLASSRMN 61
           Q  KR R+  +C  CR+RK KC+   P C  C   G  ++CHY E    E+     S+ N
Sbjct: 27  QKRKRNRIPLSCTICRKRKVKCDKIRPHCNQCTKTGVAHLCHYMEQSWAEEAEKELSKEN 86

Query: 62  QVEELPHDTKNRPYVPLDIIGN--------GTHSTDSQHVTNGNIIDRTKSRYTIQHSA 112
           +++ L    K+     L +  N         T S  S H T  N+     + Y  ++ A
Sbjct: 87  EIKNLKERIKHLEKSLLKVSSNLNTPENISNTMSPLSNHSTVENLSSSANNNYKDKYDA 145

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          R +V KAC  CR RK KC+G+ PC  C  Y   C ++
Sbjct: 10 RSKVSKACDNCRRRKIKCSGERPCAGCKTYNCECIFS 46

>NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa]
          {ON} 
          Length = 978

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDG 53
          K+ R  +AC  CR RK KC+G  PC  C  YG +C +   +G
Sbjct: 10 KKLRSSRACSNCRRRKIKCSGIQPCPNCEIYGCLCVFEPVNG 51

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 79/184 (42%), Gaps = 20/184 (10%)

Query: 163 RISKVYFSVVHPIFDIVDPEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHP 222
           R    YF   HP F ++  E L        N  A+  ++  +   V+A+G++ L   G  
Sbjct: 268 RFIDSYFQNFHPFFPLLHSETLLMLYNNQINSVAK-DQWQILFNTVLAIGAWCLE--GDS 324

Query: 223 REMDIIQY--AKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSE 280
            ++D+  Y  AK  L         SV  + A  L + Y +   +P+ ++     +I ++ 
Sbjct: 325 TDIDLFYYQNAKSHLTGAKIFETGSVTLVIALHLLSQYTQWRQKPNTSFNFHGHSIRMAI 384

Query: 281 AIGLHHEIDREDLALTNNVPLK-RTTEVSEHTRRLFWSAWSINTILSYDYGRS---SVTL 336
           ++GLH E+           PL  +   V E  RR++W  +S    L+  YGR     + L
Sbjct: 385 SLGLHKEL-----------PLNFKDNSVKEQRRRIWWYIYSQEFHLALSYGRPLQFLMDL 433

Query: 337 NRIT 340
           N IT
Sbjct: 434 NEIT 437

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 18 KACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEED--GPLASSRMNQVEE 65
          +AC  CR +K KC+ + P C  C+   + C Y+ +    PL  + + +VE+
Sbjct: 11 QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAHLTKVED 61

>TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.56
           YOR337W
          Length = 840

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 17  RKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
           R AC  CR R++KC+ + PC  CV Y   C+  EED
Sbjct: 91  RLACSSCRRRRKKCDMQYPCGNCVHYKDSCNINEED 126

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1581

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 2   ASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
           +++ SN    KR RV  +C  CR+RK KC+   P C+ C   G  ++CHY E+
Sbjct: 48  STNTSNKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYMEQ 100

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
           {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
           ABL121Cp and similar to YMR280C uniprot|P39113
           Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
           transcriptional activator
          Length = 1250

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 50/118 (42%), Gaps = 12/118 (10%)

Query: 2   ASSGSNPQPYKRQ--RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEEDGPLASS 58
             +GS   P   Q  RV +AC  CR +K +C+GK P C  C A G+ C  ++     A  
Sbjct: 84  GGNGSIASPAGSQNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFP 143

Query: 59  R------MNQVEELPHDTKNRPYVPL-DIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQ 109
           R        +V EL  + +NR  V L DI     H    QH   G   D  +    +Q
Sbjct: 144 RGYTETLEERVREL--EAENRRLVALCDIKEQQIHLFSQQHSPGGRRKDDERMLRELQ 199

>SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 833

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 5/52 (9%)

Query: 2  ASSGSNPQPYKRQR-----VRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          +S+ ++ +  KRQ+     V +AC  CR+RK KC+G  PC  C  Y  VC Y
Sbjct: 3  SSAPTSSKVLKRQKKQPDKVFRACKSCRKRKIKCSGFQPCSNCEVYKCVCEY 54

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1270

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           + S    P      RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 72  VTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 123

>NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {ON}
           Anc_4.121
          Length = 708

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 67/330 (20%), Positives = 127/330 (38%), Gaps = 44/330 (13%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYV--CHYTEEDGPLASSRMNQVEELPHD 69
           KR+R+ K+C  C   K KCN + PC  C+A G +  C Y  + G L +       E    
Sbjct: 13  KRKRLIKSCKYCYTHKLKCNKEKPCSKCIAVGLIDECIYGFDKGELQNHDSTSHSE---S 69

Query: 70  TKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLGLE----LRS 125
           T   P +PL        S++S  V      ++T S    ++    F  S+  E    + S
Sbjct: 70  TTPSPKLPL--------SSNSGKVRKIKTTNKTSSPLKSKYLYPFFTNSVNDENISSVAS 121

Query: 126 TNPPRLHCFAWHCGIRPEEKPS---FHVPLSDIV-----TKEEYYRISKVYFSVVHPIFD 177
            +   L        I   ++     F + L DI+     + E        YF  +HPI  
Sbjct: 122 NDTEELSSKMSKNAITTFDRFVPHLFAITLEDIINLIPDSLEVALSQIDTYFETIHPIIP 181

Query: 178 IVDPEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDII--------- 228
           ++D   + + +   +N     ++    I+ ++ + S F  S        II         
Sbjct: 182 VLDRSLVRQKLIGIYNSIQSGTDLS--ISNLLLIMSIFFCSSYSIVASSIIPDLLLCNKY 239

Query: 229 -QYAKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHE 287
            Q  K +L+   F   P++E + ++++            + +  S + + +++ +G+  +
Sbjct: 240 YQSHKYLLELSVFPTRPTLESLQSFLIVNFIQDPNMTEAIGY--SVMLVRIAQQLGVEKK 297

Query: 288 IDREDLALTNNVPLKRTTEVSEHTRRLFWS 317
           +        +N+      E  +H  +L WS
Sbjct: 298 LMEHSTKQEDNI----QEEEYQHL-KLLWS 322

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 83/410 (20%), Positives = 150/410 (36%), Gaps = 111/410 (27%)

Query: 16  VRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEED--GPLA-------SSRMNQVEE 65
           + +AC  CR +K KC+ + P C  C+   + C Y+ +    PL         SR+ ++E+
Sbjct: 7   MEQACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTRVHLTEVESRLEKLEQ 66

Query: 66  L------------------PHDTK-----------------NRPYVPLDIIGNGTHSTDS 90
           L                   HD K                 +    P+    N  +    
Sbjct: 67  LFLLMFPRENLDHVLKMDSLHDIKVLLTQLFVQNYANTNAASDKLTPVGSADNDVYRGQE 126

Query: 91  QHVTN--GNIIDRTKSRYTIQHSAVAFPRSLGLELRSTNPPRLHCFAWH----------- 137
           QHV++  G+  DR + + TI   +VA      + L S     LH F W            
Sbjct: 127 QHVSSPEGDD-DRDQRQLTISFGSVALHDDSTIPLNSVPRDALHGFDWSEDDVASDSLRL 185

Query: 138 ----------------------CGIRPEEK--------PSFHVPLSDIVTKEEYYRISKV 167
                                  G  PE+         P+  +    + ++    R  + 
Sbjct: 186 LKTDPNNNGFFGDGSLISTLRSIGFSPEKYINSTVNRLPTVVIDRYSLASRSTTSRFIQS 245

Query: 168 YFSVVHPIFDIVDPEQLGKNVEKYWNGDAETS---EYGAVIAGVIALGSFFLGSLGHPRE 224
           Y    HP   IV  + L       +N   E +   ++  +   V+++G++ +   G   +
Sbjct: 246 YLDNFHPYCPIVHSQTL----MMLYNNQIEIASKDQWQILFNSVLSIGAWCVE--GESTD 299

Query: 225 MDIIQY--AKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAI 282
           +D+  Y  AK  L    F    S+  + A  L + Y +   RP+ ++     ++ ++ ++
Sbjct: 300 IDLFYYQNAKSHLTSKVF-EAGSITLVIALHLLSRYTQWRQRPNTSYSYHGFSMRMAISL 358

Query: 283 GLHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYGRS 332
           GL+     +DL  + N      T + E  RR++WS ++    L+  YGRS
Sbjct: 359 GLN-----KDLPSSFN-----DTSILEQRRRIWWSLYNWEFHLTLLYGRS 398

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
           {ON} Anc_7.17
          Length = 1022

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 3/73 (4%)

Query: 2   ASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY--TEEDGPLASS 58
           A+ GSN Q  KR R+   C  CR+ K KC+ + P C  CV     C Y   ++  P   S
Sbjct: 28  AAGGSNRQIKKRNRISFVCQECRKAKTKCDKEKPACTRCVKQNLACVYDVAKQPPPRIPS 87

Query: 59  RMNQVEELPHDTK 71
           +  ++  L +D +
Sbjct: 88  KDAKITRLENDVE 100

>ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]
          {ON} conserved hypothetical protein
          Length = 707

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKS--PCEMCVAYGYVCHYTEED 52
          Y+ +R  K C  C++R+ KC  +   PCE CV +G  C Y +E+
Sbjct: 4  YESRRRTKPCASCKQRRLKCQYQETLPCERCVKHGIACFYPDEN 47

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 12/112 (10%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTE----EDGPLASSRMNQVE 64
           KR R+  +C  CR+RK KC+   P C+ C   G  ++CHY E    E+     S+ N+++
Sbjct: 74  KRNRIPLSCTICRKRKVKCDKTRPHCDPCSKTGVAHLCHYMEQTWAEEAEKELSKENELQ 133

Query: 65  ELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFP 116
           +L    K+     + +     H   + ++ N NI D+     T++  ++  P
Sbjct: 134 QLKERVKSLEKTIVKL--RNQHEMINDNMDNDNIKDK---EITVKRESLHIP 180

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 2   ASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
           +++ S      R RV+KAC  C++RK KC+G +PC  C  +   C Y
Sbjct: 69  STAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRY 115

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 45/108 (41%), Gaps = 11/108 (10%)

Query: 224 EMDIIQYAKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIG 283
           E ++ +YA  I++  TF    S E I +W+L T Y R   R    W A    +++   + 
Sbjct: 492 EENLFKYAYLIINTLTF-EWESFELIQSWLLITFYFRTCYRQTACWNALSQAVNMCNGMS 550

Query: 284 LHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYGR 331
           L+           N  P   +T         FW  + ++ ++S+  GR
Sbjct: 551 LY----------LNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGR 588

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920
          aa] {ON} YMR019W (REAL)
          Length = 920

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 3  SSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          ++ S      R RV+KAC  C++RK KC+G  PC  C  +   C Y
Sbjct: 40 AAASKENSRGRLRVQKACELCKKRKVKCDGNKPCLNCFKHQKECRY 85

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 42/108 (38%), Gaps = 11/108 (10%)

Query: 224 EMDIIQYAKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIG 283
           E  + +YA  I+   TF    S E I +W+L   Y R   R    W A    +++   + 
Sbjct: 460 EERMFKYAYSIISTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNALSQAVNMCNGMS 518

Query: 284 LHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYGR 331
           L+           N  P   +T         FW  + ++ ++S+  GR
Sbjct: 519 LY----------LNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGR 556

>NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa]
          {ON} 
          Length = 980

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          K+ R  +AC  CR RK KC+G  PC  C  Y   C +T
Sbjct: 10 KKTRSSRACENCRARKIKCSGNQPCSNCEIYNCPCAFT 47

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 13  RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYV-CHY 48
           + RV +AC  CR +K+KC+G+ PC++C   G V C Y
Sbjct: 123 KGRVSRACEFCRSKKKKCDGQQPCDLCKLVGKVPCVY 159

>KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp,
          566 aa] {ON} highly similar to uniprot|Q04176
          Saccharomyces cerevisiae YDR397C NCB2 Beta subunit of
          the NC2 dimeric histone-fold complex represses RNA
          polymerase II transcription through binding to TBP and
          inhibition of TFIIA and TFIIB homologous to the Dr1
          subunit of the mammalian NC2 (negative
          cofactor2)[INTRON]
          Length = 566

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 19 ACVPCRERKRKCNGKSPCEMCVAYGYVC 46
          AC  CR+R+RKCN +SPC  C  YG  C
Sbjct: 17 ACQSCRKRRRKCNLESPCSNCQKYGVEC 44

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar
           to uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8
           Zinc cluster transcriptional activator
          Length = 1206

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 10  PYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           P    RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 64  PSSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257
           bp, 1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           R+ +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 101

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
           (CAT8) - Zinc-cluster protein involved in activating
           gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 10  PYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           P    RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 64  PTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
          similarities with uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 571

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 1  MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          M +S    +P KR RV  AC  CR +K+KC+G+ PC++C      C Y++
Sbjct: 10 MDNSTKKLRP-KRLRVSHACDNCRLKKKKCDGQQPCKLCKNSENECIYSD 58

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger;
          overexpression increases salt tolerance through
          increased expression of the ENA1(Na+/Li+ extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 902

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 21/37 (56%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          R+RV KAC  CR +K KC+G  PC  C      C YT
Sbjct: 7  RKRVSKACDACRAKKIKCDGCDPCSNCKKVSQECGYT 43

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184c
          Length = 835

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          + RV +AC  CR+RK KC+G  PC  C+    VC Y
Sbjct: 14 KDRVIRACDVCRKRKVKCDGDQPCSSCMTASTVCIY 49

>ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar to
           uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
           Positive regulator of PUT (proline utilization) genes
           zinc-finger transcription factor of the Zn(2)-Cys(6)
           binuclear cluster domain type
          Length = 838

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 46/102 (45%), Gaps = 9/102 (8%)

Query: 2   ASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSR-- 59
            S+G   +P +R  +  ACV CR +  KC G  PC  C A    C Y E +  L  S   
Sbjct: 26  GSAGYVRKPPRRSTL--ACVRCRRKHVKCPGGDPCSKCSAARIACEYLEPNKKLTVSMKY 83

Query: 60  MNQVEELPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDR 101
           + Q++E   D K R  V L  I N  +S     VT   I +R
Sbjct: 84  LQQLQENLADLK-RENVKLQSIVNTVNS----DVTESKIKER 120

>Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON}
          (69833..73657) [3825 nt, 1275 aa]
          Length = 1274

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          KR R+  +C  CR+RK KC+   P C  C+  G  ++CHY E+
Sbjct: 12 KRNRIPLSCTICRKRKVKCDKTHPHCNQCIKTGVHHLCHYMEQ 54

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
          KR+++ KACV CR+RK KC+   P C+ C +    C YT +
Sbjct: 6  KRRKIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNCIYTNQ 46

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
           YMR280C
          Length = 1301

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 134

>TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1247

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          KR R+  +C  CR+RK KC+   P C+ CV  G  ++CHY E+
Sbjct: 24 KRNRIPLSCTICRKRKVKCDKTRPHCDQCVKTGVAHLCHYMEQ 66

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP----CEMCVAYGYVCHYTEEDGPLA 56
           + +SG N     ++RV KAC  CR+RK +C+   P    C  CV +  VC +   D  L 
Sbjct: 121 LGASGKNS----KKRVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVCTFKHRDEILQ 176

Query: 57  SSRMNQVEE 65
             R  ++++
Sbjct: 177 KKRKLEIKQ 185

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa]
           {ON} YMR280C (REAL)
          Length = 1433

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           R+ +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 102

>YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON}
          PDR8Transcription factor; targets include ATP-binding
          cassette (ABC) transporters, major facilitator
          superfamily transporters, and other genes involved in
          the pleiotropic drug resistance (PDR) phenomenon
          Length = 701

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 5/66 (7%)

Query: 6  SNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGY-VCHYTEE-DGPLASSRMNQ 62
          S+ +  KR++V K+C  CR+RK KC+   P C+ CV      C YTEE + PL+++ +  
Sbjct: 17 SSGKKGKRRKVIKSCAFCRKRKLKCSQARPMCQQCVIRKLPQCVYTEEFNYPLSNTEL-- 74

Query: 63 VEELPH 68
           E++P+
Sbjct: 75 FEQVPN 80

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
           similar to Ashbya gossypii ABL121C
          Length = 1577

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 161

>ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON}
          similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1244

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 4  SGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          + +N    KR R+  +C  CR+RK KC+   P CE C   G  ++CHY E+
Sbjct: 19 AAANKMKRKRNRIPLSCTICRKRKVKCDKTRPNCEQCSKTGVAHLCHYMEQ 69

>KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some
          similarities with uniprot|P35995 Saccharomyces
          cerevisiae YKL222C Hypothetical ORF
          Length = 655

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 10 PYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY 48
          P  R +  ++C+ C+ RK+KC+ K+P C  C+  GY C Y
Sbjct: 2  PKSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYECIY 41

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 1  MASSGSNPQPYK-RQRVRKACVPCRERKRKCN-GKSPCEMCVAYGYVCHYTEEDGPLASS 58
          M     +P P K R R    C+ CR RK KC+ GK  C  C+  G  C Y+E+    AS 
Sbjct: 1  MVYEMLSPVPVKKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYSEDTDENASK 60

Query: 59 RM 60
          ++
Sbjct: 61 KV 62

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
          to Ashbya gossypii AFR117C
          Length = 1198

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 1  MASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYV--CHYTEE 51
          M+S G   +  KR R+  +C  CR+RK +C+   P C  CV  G V  CHY E+
Sbjct: 1  MSSPGGTAK-RKRNRIPLSCTICRKRKVRCDKTKPHCTQCVKTGVVHLCHYMEQ 53

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           R+ +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 101

>KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.56
          YOR337W
          Length = 691

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          + R AC  CR+R++KCN   PC+ CV     C+  EED
Sbjct: 42 KKRLACNNCRKRRKKCNLAYPCDGCVRLKLKCNINEED 79

>TBLA0J00370 Chr10 complement(67871..69286) [1416 bp, 471 aa] {ON}
           Anc_8.642 YPL133C
          Length = 471

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 15/122 (12%)

Query: 11  YKRQRVRKACVPCRERKRKCNGKSPCEMCVAYG--YVCHYTEED---GPLASSRMNQVEE 65
           +K+++  K+C+ CR     C+G++PC+ C+  G  ++C   +E    G +  ++++   +
Sbjct: 14  HKKRKTGKSCIFCRRSHLVCSGQTPCQRCIRRGISHLCTPNDESQITGTVTRNKVHYASK 73

Query: 66  LPHDTKNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLGLELRS 125
           LP   K+  +       N  HST   + T+  I         +Q + +   +++G E  S
Sbjct: 74  LPTSRKDNKHR----TSNSEHSTSDTNGTSNTI------NSLLQQTPMFISQNVGSEFGS 123

Query: 126 TN 127
            N
Sbjct: 124 LN 125

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           R+ +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDK 102

>SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 912

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 32/82 (39%), Gaps = 1/82 (1%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHD 69
          +KR R    C  CR+RK KC+   P C  C+  G  C Y  E  P   +     E +   
Sbjct: 9  HKRNRFSFVCTACRKRKSKCDKTKPICNKCLEQGTKCVYDFEQQPTPKNPTKSSETIAFL 68

Query: 70 TKNRPYVPLDIIGNGTHSTDSQ 91
           K   Y      G G   T S+
Sbjct: 69 QKELEYWKAKAQGTGEQVTRSE 90

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
          YER184C (REAL)
          Length = 170

 Score = 41.2 bits (95), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 12 KRQ--RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEE 51
          +RQ  RV KAC  CR +K KC+ K PC  C+     C Y  +
Sbjct: 8  RRQGSRVSKACERCRRKKVKCDSKKPCFGCIGSQSKCRYKNQ 49

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256w HAP1 transcription factor
          Length = 1355

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 5  GSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEED 52
          G+ P+  KR R+  +C  CR+RK KC+   P C  C   G  ++CHY E++
Sbjct: 9  GAAPK-KKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQN 58

>Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa]
          {ON} YLR266C (REAL)
          Length = 694

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGY-VCHYTEE-DGPLASSRM 60
          KR+++ K+C  CR+RK KCN   P C+ CV      C YTEE + PL+++ +
Sbjct: 16 KRRKIIKSCAFCRKRKLKCNQVRPMCQQCVLRKLPQCIYTEEFNYPLSNTEL 67

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
          Anc_1.380
          Length = 1478

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          KR RV  +C  CR+RK KC+   P C+ C   G  ++CHY E+
Sbjct: 35 KRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYMEQ 77

>SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} similar
          to uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
          Mutants are defective in Ty1 Enhancer- mediated
          Activation Ty1 enhancer activator and to YLR098C
          uniprot|P43634 Saccharomyces cerevisiae YLR098C CHA4
          Zinc- finger protein with Zn[2]-Cys[6] fungal-type
          binuclear cluster domain DNA-binding transcriptional
          activator or CHA1
          Length = 701

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 5/50 (10%)

Query: 8  PQPYKRQ-----RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          P P  +Q     R R AC  CR R++KC+   PC  CV     C+  EED
Sbjct: 38 PDPADKQIKMGERKRLACSNCRRRRKKCDLNYPCSSCVRLRLQCNVNEED 87

>TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON} 
          Length = 647

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYG 43
          K +RV KAC  C+ RK++C G+ PC+ C   G
Sbjct: 2  KEKRVSKACDVCKHRKKRCTGELPCDYCTRIG 33

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR280C
           (CAT8)
          Length = 1285

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDK 110

>NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56
          Length = 768

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          +R R AC  CR+R++KC+   PC  CV     C+  EED
Sbjct: 53 KRKRLACTNCRKRRKKCDLSYPCASCVRLRIDCNVNEED 91

>YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc
          finger transcription factor involved in the complex
          regulation of gene expression in response to levels of
          heme and oxygen; the S288C sequence differs from other
          strain backgrounds due to a Ty1 insertion in the
          carboxy terminus
          Length = 1502

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 3  SSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          SS S+    KR R+  +C  CR+RK KC+   P C+ C   G  ++CHY E+
Sbjct: 47 SSDSSKIKRKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQ 98

>NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON}
          Anc_2.565
          Length = 759

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYT 49
          +R RV++AC  C+ RK KC+G  PC  C+     C Y 
Sbjct: 26 QRIRVQRACNICKRRKVKCDGNKPCLNCIKKEIDCEYN 63

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 42/105 (40%), Gaps = 11/105 (10%)

Query: 227 IIQYAKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHH 286
           +  +A  I+   TF    S E I +W+L   YLR   R    W A    I++   + L+ 
Sbjct: 324 MFGHAYSIVSKLTF-EWESFELIQSWLLIAFYLRTCYRQISCWNALSRAINMCNGMSLY- 381

Query: 287 EIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYGR 331
                     N  P   +T         FWS + ++ ++S+  GR
Sbjct: 382 ---------LNRFPEVHSTYDEVKAWHCFWSCFIMDKLISFQLGR 417

>Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON}
          YLR256W (REAL)
          Length = 1503

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 3  SSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          SS S+    KR R+  +C  CR+RK KC+   P C+ C   G  ++CHY E+
Sbjct: 46 SSDSSKIKRKRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTGVAHLCHYMEQ 97

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
          {ON} some similarities with uniprot|P46954
          Saccharomyces cerevisiae YJL089w SIP4 interacts with
          SNF1 protein kinase
          Length = 1209

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVC 46
          ++R  +AC  CR +K KC+G  PC  C   GY C
Sbjct: 22 KKRHSQACDRCRSKKIKCDGLQPCSNCAKIGYNC 55

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa]
          {ON} Anc_8.845 YMR280C
          Length = 1246

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 15 RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
          RV +AC  CR +K +C+G+ P C  C A G+ C  +++
Sbjct: 27 RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDK 64

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911
          aa] {ON} YMR019W (REAL)
          Length = 911

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 13 RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          R RV+KAC  C+ RK KC+G  PC  C  +   C Y
Sbjct: 39 RLRVQKACEICKRRKVKCDGNRPCLNCSKHKKECRY 74

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 43/108 (39%), Gaps = 11/108 (10%)

Query: 224 EMDIIQYAKGILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIG 283
           E  + +YA  I++  TF    S E I +W+L   Y R   R    W A    +++   + 
Sbjct: 453 EEKMFKYAYSIINTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNALSQAVNMCNGMS 511

Query: 284 LHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYGR 331
           L+           N  P   ++         FW  + ++ ++S+  GR
Sbjct: 512 LY----------LNKFPEIHSSYDESKAWHCFWCCFIMDKLISFQMGR 549

>KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa]
          {ON} Anc_1.199 YKR064W
          Length = 862

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGY--VCHYTEEDGPLASS-RMNQVEELPH 68
          +R+R    C  CR+RK +C+ + PC  C+  G    C Y  +  P  SS R++   ++  
Sbjct: 10 RRKRGTVVCTNCRKRKSRCDRQLPCNTCMRLGNSETCEYENKLNPNTSSIRVSFAPKIER 69

Query: 69 DTKNRPYVPLDIIGNGT 85
            K   ++P  + G+ +
Sbjct: 70 VKKQDKFIPSTLFGSSS 86

>ZYRO0G10450g Chr7 (842921..844840) [1920 bp, 639 aa] {ON} conserved
           hypothetical protein
          Length = 639

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 71/315 (22%), Positives = 112/315 (35%), Gaps = 68/315 (21%)

Query: 9   QPYKRQRVRKACVPCRERKRKCNGKSPCEMC--------VAYGYVCHYTEEDGPLASSRM 60
           Q  +R R  K+C  C   K KCN   PC  C          YG+  +    +   A ++ 
Sbjct: 4   QKIRRHRAIKSCRYCYVHKLKCNKALPCYTCSTMNTTSECIYGFNKNDNNSEEIKADNKS 63

Query: 61  NQVEELPHDTKNRPYVPLDIIGNGTHSTDSQH---VTNGNIIDRTKSR--YTIQHSAVAF 115
           N+    P  T+      +D    GT    S++       +I DR  S   Y +   +  F
Sbjct: 64  NEKSSRPLTTRG-----IDKTPKGTLVYRSKYFYPFFANSINDRVLSSHAYGLLSPSQKF 118

Query: 116 PRSLGLEL-RSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHP 174
            R+   +  R TNP  L        + P   PS    LS + T          YF  VHP
Sbjct: 119 KRNEITKFNRFTNP--LDSIEDALALLP---PSRETALSQVET----------YFDSVHP 163

Query: 175 IFDIVDPEQLGKNVEKYWNGDAET-----------------SEYGAVIAGVIALGSFFLG 217
           I  I+   ++   ++   N D +                  S Y AV +GVI        
Sbjct: 164 IIPILSKSKIMNALQTIKNTDNDQENINVPNLLLIMALFFCSSYAAVASGVI-------- 215

Query: 218 SLGHPREMDIIQYAKG---ILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCL 274
               P  +   +Y  G   +L+   F   P +E + A+ +    +        A+  S +
Sbjct: 216 ----PDLLLCNKYYAGYRLLLEISEFPLRPQLESLKAFTIVNFVIDPNMVDATAY--SSM 269

Query: 275 TIHLSEAIGLHHEID 289
            + + + +GLH   D
Sbjct: 270 LVRMGQQLGLHKMED 284

>Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON}
          YLR256W (REAL)
          Length = 1479

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 3  SSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          SS S+    KR R+  +C  CR+RK KC+   P C+ C   G  ++CHY E+
Sbjct: 48 SSDSSKIKRKRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTGVAHLCHYMEQ 99

>TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa]
          {ON} Anc_1.380 YLR256W
          Length = 1486

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          KR R+  +C  CR+RK KC+   P C  C   G  ++CHY E+
Sbjct: 11 KRNRIPLSCTICRKRKVKCDKTHPYCVQCTKTGMSHLCHYMEQ 53

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          KR R+  +C  CR+RK KC+   P C  C   G  ++CHY E+
Sbjct: 44 KRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQ 86

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 13  RQRVRKACVPCRERKRKCN----GKSPCEMCVAYGYVCHYTEE 51
           ++RV KAC  CR+RK KC      K+ C+ C+ Y   C +T +
Sbjct: 96  KRRVSKACDHCRKRKIKCGPINPAKNKCDNCIKYSSACTFTHQ 138

>CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly
          similar to uniprot|P39529 Saccharomyces cerevisiae
          YJL206c
          Length = 832

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          + QR+ +AC  C++RK KC G +PC+ C      C Y E
Sbjct: 28 RTQRLSRACDLCKKRKTKCQGGNPCQSCRKANIQCIYRE 66

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 93/391 (23%), Positives = 148/391 (37%), Gaps = 71/391 (18%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE--DGPL-------ASSRMNQ 62
           R  V +AC  CR RK KC+   P C  C     VC Y+ +    PL         +R+ Q
Sbjct: 2   RPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTRAHLTEVETRLGQ 61

Query: 63  VEELPHDTKNRPYVPLDIIGNGTHSTDSQ--HVTNGNIIDRTKSRYTIQHSAVAFP---- 116
           +E+L  +     +V LD      H  D Q   +  G  +D      T ++ A   P    
Sbjct: 62  MEQLLRNA----FVDLDADTLLKHRHDPQLREILFGRTVDIGALSRTDEYMASPLPPLRQ 117

Query: 117 --------RSL----GLELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRI 164
                   R L    G  ++ +    L   A   G+         + L +  T   Y   
Sbjct: 118 AEFQWYERRDLLTGTGFNMKQSPLHSLVAEAQQEGLMARPSKYERMQLEEQSTTLRYM-- 175

Query: 165 SKVYFSVVHPIFDIVDPEQLGKNVEKYWNGDAETSEYGAVIAG----VIALGSFFLGSLG 220
            + YF   H ++ +VD  +     E     D  T+    +  G    V+ALG++  G+  
Sbjct: 176 -QAYFEHFHWLYPVVDEHEFYLLYE-----DPSTAPDACLWTGLVNVVLALGAWCAGA-- 227

Query: 221 HPREMDIIQYAKG---ILDD--PTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLT 275
            P    +  Y K    +L     T  R+ ++    A +L   Y   T   + AW+   L 
Sbjct: 228 -PPAAHVFYYDKAESHVLGRMLRTGDRVLAI----ALLLMAHYNYMTHHRNTAWMLLGLA 282

Query: 276 IHLSEAIGLHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVT 335
             L+ ++GLH ++          +P K+ T      + L+W  +S  T ++ + GR S  
Sbjct: 283 SQLATSLGLHRDL--------QGLPPKQRTLA----QILWWGIYSTTTQVALELGRPS-P 329

Query: 336 LNRI--TCKPVKETDGNYTVNLVSLAQLVPQ 364
           L RI  T  PV +       +L +   LV Q
Sbjct: 330 LPRIGHTDVPVPDMTNPLYSHLANEVNLVIQ 360

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1445

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDK 215

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 14  QRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           +R+ +AC  CR +K +C+GK P C  C   G+ C  +++
Sbjct: 102 KRISQACDRCRSKKTRCDGKRPQCSQCAIVGFECKVSDK 140

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
          MAL33MAL-activator protein, part of complex locus MAL3;
          nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 8/62 (12%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHDTKNRPY 75
          V+ AC  CR R+ KC+GK PC  C+ + + C Y +   PL           P  T++  Y
Sbjct: 4  VKYACDYCRVRRVKCDGKKPCSRCIEHNFDCTYQQ---PLKKRGSK-----PIGTRSLKY 55

Query: 76 VP 77
          +P
Sbjct: 56 IP 57

>Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064W
          (REAL)
          Length = 889

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYV--CHY-TEEDGPLASS 58
          KR R+   C  C++RK KCN   PC  C+  G    C Y TE  G L SS
Sbjct: 36 KRHRITLVCTNCKKRKSKCNRTKPCGTCIRLGDTESCVYLTESLGNLESS 85

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR256W
          (HAP1)
          Length = 1152

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          KR RV  +C  CR+RK KC+   P C  C   G  ++CHY E+
Sbjct: 11 KRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQ 53

>NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa]
          {ON} Anc_8.283
          Length = 710

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          K QR + AC  CR+ +RKC+  +PC  C+ +   C Y E+D
Sbjct: 38 KSQR-KIACQHCRKIRRKCDMINPCSNCIKFDTTCVYAEKD 77

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
          (REAL)
          Length = 469

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          V+ AC  CR R+ KC+GK PC  C+ + + C Y +
Sbjct: 4  VKYACDFCRVRRVKCDGKKPCSRCIQHDFECTYQQ 38

>Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723
          bp, 1240 aa] {ON} ANNOTATED BY YGOB -
          Length = 1240

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          KR RV  +C  CR+RK KC+   P C+ C   G  ++CHY E+
Sbjct: 8  KRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYMEQ 50

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256w HAP1
           transcription factor
          Length = 1372

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
           R RV  +C  CR RK KC+   P C  CV  G  ++CHY E+
Sbjct: 64  RNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGVAHLCHYMEQ 105

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa]
          {ON} 
          Length = 1136

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 7  NPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEEDGP 54
          N Q  KR R+   C  CR+ K KC+ + P C  C+  G  C Y EE  P
Sbjct: 37 NIQLKKRNRISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVYDEERQP 85

>NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59
          Length = 776

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 80/185 (43%), Gaps = 22/185 (11%)

Query: 163 RISKVYFSVVHPIFDIVDPEQLGKNVEKYWNGDA------ETSEYGAVIAGV---IALGS 213
           R    YF   H +F ++D      +V K  + ++        SEY  +I  +   +A+G 
Sbjct: 329 RFIAAYFKHNHRLFPMIDKIAFLNDVSKISDFESLEKNIDTGSEYNILIFKIYMIMAIGC 388

Query: 214 FFLGSLG--HPREMDIIQYAKGILDDPTFS---RIPSVEQISAWVLRTIYLRATARPHVA 268
             L   G  +  E D+ ++    L    FS   ++ ++E +   +L  IY     R   +
Sbjct: 389 TTLRRAGMLNVEEEDLSEHL-SYLAMKKFSYVIQLQNIETVRCLLLLGIYSFFEPRGSSS 447

Query: 269 WLASCLTIHLSEAIGLHHEIDREDLALTNNVPLKRTTEVSEHTRRLFWSAWSINTILSYD 328
           W  S L + L+ A+GL+  +  + + L + + +       E   R+FWSA+    ++S  
Sbjct: 448 WTISGLIMRLTIALGLNKALTPKKMKLLSAIEM-------EARNRVFWSAYCFERLVSTS 500

Query: 329 YGRSS 333
            GR S
Sbjct: 501 LGRFS 505

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1244

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          KR RV  +C  CR+RK KC+   P C+ C   G  ++CHY E+
Sbjct: 8  KRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYMEQ 50

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain DNA-binding
          transcriptional activator or CHA1 and some similarities
          to YOR337W uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1
          Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEEL 66
          ++++   AC  CR ++RKC+ + PC  C+ YG  C     D     +    VE+L
Sbjct: 9  RKRKAHLACQNCRIKRRKCDMERPCSNCLKYGIECITVNNDKRTKRTTHEYVEKL 63

>CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} similar
           to uniprot|P47988 Saccharomyces cerevisiae YOR337w TEA1
           TY1 enhancer activator
          Length = 816

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 2   ASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
           +S+    +P K+   R AC  CR R++KC+ + PC  C   G  C+  EED
Sbjct: 61  SSANVTSRPTKK---RLACSNCRRRRKKCDLQYPCFTCDKLGLECNINEED 108

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 60/145 (41%), Gaps = 7/145 (4%)

Query: 193 NGDAETSEYGA--VIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPTFSR--IPSVEQ 248
           N + + S+Y +  +I  + A+GS     + H  E    +  K +LD   F    +P +  
Sbjct: 332 NDNYKNSQYCSEELIYAMSAIGSRLSPEIMHLSESYYEKSKKALLD-IVFDEKSVPRITT 390

Query: 249 ISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVPLKRTTEVS 308
           + A      Y        +AW  S L I +  A+G   ++D +   + ++   K T    
Sbjct: 391 VQALFCLAFYELGKGNMQMAWYFSGLAIRVGYAMGF--QLDPKVWHVDDDTDEKLTQSEL 448

Query: 309 EHTRRLFWSAWSINTILSYDYGRSS 333
           E   R++W  +  +  +    GR+S
Sbjct: 449 EIRSRIYWGCYIADHFICLMLGRNS 473

>TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON}
          Anc_7.56 YOR337W
          Length = 757

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          R AC  CR+R++KC+ + PC  C   G  C+  EED
Sbjct: 48 RLACSNCRKRRKKCDVEYPCGGCSRLGLECNINEED 83

>Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa]
          {ON} YOR337W (TEA1) - 1:1 [contig 46] FULL
          Length = 654

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          R R AC  CR R++KCN + PC  CV     C+   ED
Sbjct: 30 RKRLACSNCRRRRKKCNMEYPCASCVKLKVDCNVNMED 67

>Kpol_1059.26 s1059 complement(57391..58653) [1263 bp, 420 aa]
          {ON} complement(57391..58653) [1263 nt, 421 aa]
          Length = 420

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVA--YGYVCHYTEEDGPLAS 57
          +R++  KACV CR     CNG+ PCE C+     ++C+Y EE G  AS
Sbjct: 7  ERRKSYKACVFCRRSHLVCNGQRPCERCIKRDISHLCNY-EERGNSAS 53

>Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W
          (REAL)
          Length = 324

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 3  SSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          SS S+    KR R+  +C  CR+RK KC+   P C+ C   G  ++CHY E+
Sbjct: 48 SSESSKIKRKRNRIPLSCTICRKRKVKCDKFRPHCQQCTKTGVAHLCHYMEQ 99

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
          similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 703

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCVAYG 43
          + ++AC  C+ RK++C+G  PCE CV  G
Sbjct: 13 KSKRACETCKRRKKRCSGGLPCEYCVKIG 41

>ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa]
          {ON} similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W Hypothetical ORF
          Length = 842

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGY--VCHYTE 50
          +R R    C  C+ RK KC+ ++PC  CV +G    CHY +
Sbjct: 14 RRNRPTVVCTNCKRRKSKCDRQNPCSNCVRFGNKDTCHYVQ 54

>Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON}
           (44110..46518) [2409 nt, 803 aa]
          Length = 802

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 6/100 (6%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGY--VCHYTEEDGPLASSRMNQVEELPHD 69
           KR R+   C  C++RK KC+   PC  C   G    C Y ++   L    +  V +L   
Sbjct: 11  KRHRITVVCTNCKKRKSKCDRGKPCSNCTRIGIENSCLYIKDTPSLPIDSIGSVADLTAS 70

Query: 70  TKNRP-YVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTI 108
               P ++P+    N  +     ++ NG   +  +S YT+
Sbjct: 71  ELQIPNFIPIHPSYNKEYVN---YIPNGRFFEIKRSAYTM 107

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEM-CVAYGYVCHYTEED--GPLASSRMNQVEEL 66
          KR R+   C+ CR RK KC+ + PC + C   G  C Y  E    P  SS++++  EL
Sbjct: 17 KRNRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTCVYDIERQPAPRKSSKVSETIEL 74

>KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1237

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          KR RV  +C  CR+RK KC+   P C+ C   G  ++CHY E+
Sbjct: 8  KRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYMEQ 50

>Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF}
          YLR256W (HAP1) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          78] PARTIAL
          Length = 629

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG--YVCHYTEE 51
          KR RV  +C  CR+RK KC+   P C+ C   G  ++CHY E+
Sbjct: 8  KRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYMEQ 50

>Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%)

Query: 8   PQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
           P      R R AC  CR R++KC+   PC  C     VC+  +ED
Sbjct: 58  PDNASNTRKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDED 102

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 1/44 (2%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEEDGP 54
           KR R+   C  CR+ K KCN   P C  C   G  C Y  E  P
Sbjct: 66  KRNRISFVCQSCRKSKTKCNKDKPSCSRCKKLGIFCVYDVETQP 109

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
          homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHD 69
          +KRQR    C+PC +RK KCN   P C+ C    Y C Y   D     SR  Q  ++P +
Sbjct: 29 HKRQRRVLNCMPCHKRKVKCNRARPVCDHCEKNRYACAYFVND---RVSRGGQ-NKVPRE 84

Query: 70 TKNR 73
          +K R
Sbjct: 85 SKLR 88

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 3   SSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYV-CHYTE 50
           +S SN +  KR++V K+C  CR+RK KC+ K P C  C   G   C YT+
Sbjct: 73  ASTSNGKVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTD 122

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 85/258 (32%), Gaps = 96/258 (37%)

Query: 1   MASSGSNPQPYKRQRVRKACVPCRERKRKCN-------GKSPCEMC-------------- 39
           M S  +     K +R  +AC  CRERK KCN        K PCE C              
Sbjct: 1   MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60

Query: 40  ---------VAYG--------YVCHYTEEDGPLA-------------------SSRMNQV 63
                    + YG           HY + D   A                   SS  N +
Sbjct: 61  KSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESDVSSMQNAL 120

Query: 64  EELPHDTKN----RPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSL 119
           E L    K+      + P   + +  +S     +T  NII     +  +++ A +    L
Sbjct: 121 EYLASAAKSVSQFENHKPTSKLSDMVNSYSKDDMTQENIIKELFEKTELKNPASSLIAQL 180

Query: 120 GLELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIV--------TKEEYYRISKVYFSV 171
                                R   KP  H  LSDIV        T+EE  R+ +V+F  
Sbjct: 181 S--------------------RIRTKP--HKKLSDIVYIGDDKLLTEEEARRLIEVFFQK 218

Query: 172 VHPIFDIV-----DPEQL 184
           +HP F  +     +PEQL
Sbjct: 219 LHPFFPYIPLQLHNPEQL 236

>Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098C
          (REAL)
          Length = 644

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 21/34 (61%), Gaps = 4/34 (11%)

Query: 6  SNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMC 39
          SN  PY    V  AC  CR+RKRKC+G+ PC  C
Sbjct: 2  SNRSPY----VTLACNTCRKRKRKCDGRKPCYYC 31

>TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKS--PCEMCVAYGYVCHY 48
          Y+ ++  + CV C+ +K KC  K   PCE C+ +G  C++
Sbjct: 4  YESKKRTRPCVSCKRQKLKCQYKESLPCERCIKHGMACYF 43

>ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL015W (PUT3)
          Length = 835

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 3/63 (4%)

Query: 7   NPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEEL 66
           N +P KR  +  AC+ CR R  +C G +PC  C      C Y E    L  S M  ++ L
Sbjct: 50  NKRPAKRAPL--ACLRCRRRHVRCPGGTPCAKCAVANIACEYLEPSKKLIVS-MKYLQRL 106

Query: 67  PHD 69
             D
Sbjct: 107 QED 109

>TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa]
           {ON} Anc_2.654 YKL015W
          Length = 865

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 1/54 (1%)

Query: 19  ACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHDTKN 72
           ACV CR R  KC G  PC  C +    C Y E +  L  S M  +++L     N
Sbjct: 75  ACVRCRRRHVKCPGGQPCAKCASANIACEYLEPNKKLIVS-MKYLQDLQESLAN 127

>Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 15  RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
           R R AC  CR R++KC+   PC  C     VC+  +ED
Sbjct: 65  RKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDED 102

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
          similar to uniprot|P35995 Saccharomyces cerevisiae
          YKL222C Hypothetical ORF and similar to uniprot|Q12340
          Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 6/49 (12%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYG-----YVCHYTEEDGP 54
          KR++V K+C+ CR+RK KC+ K P C  C A       YV  +T E  P
Sbjct: 11 KRRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDP 59

>YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1
           enhancer activator required for full levels of Ty
           enhancer-mediated transcription; C6 zinc cluster
           DNA-binding protein
          Length = 759

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 15  RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
           R R AC  CR R++KC+   PC  C     VC+  +ED
Sbjct: 65  RKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDED 102

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYV-CHYTEEDG-PLA 56
           KR+ + K C+ CRE+K KC+ + P C  C+A  +  C Y + +G PL 
Sbjct: 74  KRKTIIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVDANGNPLV 121

>YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON}
          Putative zinc cluster protein; deletion confers
          sensitivity to Calcufluor white, and prevents growth on
          glycerol or lactate as sole carbon source
          Length = 794

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHDTK 71
          ++ RV KAC  C  +K KCN K PC  C+     C Y  +      +  N    L +D  
Sbjct: 10 QKSRVTKACDRCHRKKIKCNSKKPCFGCIGSQSKCTYRNQFREPIEAFFNYTGSLSNDLD 69

Query: 72 N 72
          N
Sbjct: 70 N 70

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51
           R+ +AC  CR +K +C+GK P C  C   G+ C  +++
Sbjct: 76  RIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDK 113

>YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}
          OAF3Putative transcriptional repressor with
          Zn(2)-Cys(6) finger; negatively regulates transcription
          in response to oleate levels, based on mutant phenotype
          and localization to oleate-responsive promoters; the
          authentic, non-tagged protein is detected in highly
          purified mitochondria in high-throughput studies
          Length = 863

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYV--CHY-TEEDG-PLASSRMNQVEEL 66
          KR R+   C  C++RK KC+   PC  CV  G V  C Y T+  G P +S  +N  + L
Sbjct: 11 KRHRITVVCTNCKKRKSKCDRTKPCGTCVRLGDVDSCVYLTDSSGQPESSPSLNDADPL 69

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
          YGR288W (REAL)
          Length = 143

 Score = 38.9 bits (89), Expect = 0.008,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 16 VRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          V++AC  CR R+ KC+GK PC  C+     C Y +
Sbjct: 37 VKQACDCCRVRRVKCDGKGPCGRCLQRDLNCTYLQ 71

>KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co- inducer
          Length = 775

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 2   ASSGSNPQPYKRQRVRKACVPCRERKRKCN-GKSPCEMCVAYGYVCHY 48
           ASS SN +  KR+  R  C  C+ R+ KC+ GK  C  C      C Y
Sbjct: 131 ASSNSNGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCARLNRECVY 178

>Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%)

Query: 15  RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
           R R AC  CR R++KC+   PC  C     VC+  +ED
Sbjct: 65  RKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDED 102

>KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa]
          {ON} weakly similar to uniprot|Q12180 Saccharomyces
          cerevisiae YOL089C HAL9 Putative transcription factor
          containing a zinc finger overexpression increases salt
          tolerance through increased expression of the ENA1 (Na
          /Li extrusion pump) gene while gene disruption
          decreases both salt tolerance and ENA1 expression
          Length = 866

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 13 RQRVRKACVPCRERKRKCNGKSP----CEMCVAYGYVCHYTEED 52
          R+RV KAC  CR+RK KC   +P    C+ C  +  VC +   D
Sbjct: 15 RKRVPKACDHCRKRKIKCGAVNPITGTCDNCTKFNTVCTFKHHD 58

>KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON}
          similar to uniprot|P53749 Saccharomyces cerevisiae
          YNR063W Hypothetical ORF
          Length = 591

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 19 ACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          AC+ C++RK+KC+G+ PC  C      C Y
Sbjct: 2  ACLECKKRKQKCDGQKPCRRCTKLNVKCIY 31

>Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297W
          (REAL)
          Length = 474

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE---EDGP--LASSRMNQVEEL 66
          K+   ++AC  CR R+ KC+GK PC  C+ +   C Y +   + GP  + S  + ++ E+
Sbjct: 5  KQTCAKQACDCCRVRRVKCDGKGPCSSCLQHNLDCTYLQPFRKRGPKSIRSRSLRRIAEV 64

Query: 67 PHDTKNR 73
              +N+
Sbjct: 65 QMTCENK 71

>NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884
          bp, 627 aa] {ON} Anc_7.56 YOR337W
          Length = 627

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 5/45 (11%)

Query: 13 RQRVRK-----ACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          ++R+RK     AC  CR+ +RKC+  SPC  C+ +   C YT  D
Sbjct: 17 QKRLRKILKKLACQHCRKIRRKCDTGSPCANCMKFETECVYTGHD 61

>Kwal_47.17565 s47 (457523..459409) [1887 bp, 628 aa] {ON} [contig
          206] FULL
          Length = 628

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 19/36 (52%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCH 47
          KR R  K C  C E K KCN +SPC+ C   G   H
Sbjct: 5  KRHRSIKTCKYCYEHKLKCNKQSPCDNCTRLGITSH 40

>TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa]
          {ON} Anc_1.199 YKR064W
          Length = 827

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYG--YVCHYTEE-DGPLASSRMNQVEELP 67
          KR R+   C  CR RK KC+ ++PC  CV  G    C Y +E  G   S  +   ++LP
Sbjct: 14 KRNRLTVVCSNCRRRKSKCDRQTPCGNCVRLGDKDTCVYIKEAKGDRNSMDLRITKKLP 72

>Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089C
          (HAL9) - 1:1 [contig 184] FULL
          Length = 865

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 7/68 (10%)

Query: 13 RQRVRKACVPCRERKRKCNGKSP----CEMCVAYGYVCHYTEEDGPLASSRMNQVEELPH 68
          R+RV KAC  CR+RK KC   +P    CE C  +   C +   D     SR  +  +L  
Sbjct: 22 RKRVPKACDHCRKRKIKCGPVNPITGTCENCNKFNTSCTFRHHD---EISRHRKFTDLKR 78

Query: 69 DTKNRPYV 76
           + N P V
Sbjct: 79 ASDNEPKV 86

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 1148

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 7/55 (12%)

Query: 3  SSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP----CEMCVAYGYVC--HYTEE 51
          + G   +P K+ RV KAC  CR RK KC+   P    C  C+ Y   C  HY EE
Sbjct: 18 AEGVTTKPAKK-RVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPCTFHYHEE 71

>SAKL0H22374g Chr8 (1947498..1949420) [1923 bp, 640 aa] {ON}
           conserved hypothetical protein
          Length = 640

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 58/296 (19%), Positives = 115/296 (38%), Gaps = 50/296 (16%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYV--CHYTEEDGPLASSRMNQVEELPHD 69
           KR+RV K C  C   K KC+   PC  C     V  C Y  ++      R N  + +   
Sbjct: 8   KRRRVIKTCKYCYLHKLKCDKNMPCSTCSRLQVVDQCIYGFQESDENEWRGNNEKGIDGK 67

Query: 70  T------------KNRPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPR 117
           T            K+R + P       T++ +++ +T       +K  +T Q  +  F R
Sbjct: 68  TQRIDLSSEATVFKSRSFFPF-----FTNTINNRLLT-------SKDGHTAQLDSTVFKR 115

Query: 118 SLGLELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFD 177
           +     + TN  +         + P +  +    L D  TK     +  VYF+ VHP+  
Sbjct: 116 N-----QLTNFDKF-------TVEPLQLENIFKLLPD--TKTSMLLLLDVYFNQVHPVIP 161

Query: 178 IVDPEQLGKNVEKYWNGDAETSEYGA----VIAGVIALGSFFLGSLGHPREMDII-QYAK 232
           +++  ++  ++ + ++   E          +I  ++   S+   S G    + +  +Y  
Sbjct: 162 LLNQSKISSSIVRIYDDLEEFRPLDISKLLLIFAILFSVSYSNMSAGKSSSLTLCKKYYS 221

Query: 233 G---ILDDPTFSRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLH 285
               ++D   F  +PS+E +  + +    +        A   S + + +++ +GLH
Sbjct: 222 AFSVLMDKFRFPTVPSLESLQGFTIVNFVMDPNMVDATA--HSVMLLKIAQQLGLH 275

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
          {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
          YMR280c CAT8 transcription factor involved in
          gluconeogenesis
          Length = 1254

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 5/50 (10%)

Query: 2  ASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTE 50
           S GS P      RV +AC  CR +K KC+GK P C  C   G+ C  ++
Sbjct: 46 GSRGSTPT----YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISD 91

>Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [contig
          211] FULL
          Length = 948

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEED 52
          ++RQR   +CVPC +RK KC  ++P C  C+   + C Y   D
Sbjct: 26 HRRQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWECSYFLND 68

>AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR098C
          (CHA4)
          Length = 612

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          ++++ AC  CR+R+RKC+ + PC  C  +G  C   ++D
Sbjct: 8  KKLKLACQTCRKRRRKCDLQVPCVNCQKFGVECLPVDQD 46

>KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa]
          {ON} 
          Length = 860

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEEDG 53
          ++QR    C+ CR RK KC+   P C  C   G VC Y  E+ 
Sbjct: 7  RKQRPSYVCLECRSRKLKCDKARPYCNRCKKDGKVCAYESENA 49

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 12  KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEED--GPLASSRMNQVEELPH 68
           KR R+   C  CR+ K KC+ K P C  C+ +G  C Y  E    P   S+   ++ L  
Sbjct: 44  KRNRISFVCQHCRKSKTKCDKKQPHCARCIKHGIQCVYDIEFQVKPKTPSKTAIIKRLEA 103

Query: 69  DTKN 72
           D +N
Sbjct: 104 DLQN 107

>Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {ON}
           YDR034C (LYS14) - 1:1 [contig 183] FULL
          Length = 775

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 51/128 (39%), Gaps = 24/128 (18%)

Query: 2   ASSGSNPQPYKRQRVRKACVPCRERKRKCN-GKSPCEMCVAYGYVCHYTEEDGPLASSRM 60
           +SSG++ +  KR+  R  C  C+ R+ KC+ GK  C  C      C Y            
Sbjct: 131 SSSGADGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCARLNRECVYVIR--------- 181

Query: 61  NQVEELPHDTKNRPYVPLDIIGNGTHSTDSQHV--TNGNIIDRTKSRYTIQHSAVAFPRS 118
                    TKNR   P     +   S   Q V  +   I+ RT    T+   A+A P S
Sbjct: 182 ---------TKNRKRRPKSTDNSKDTSKPGQRVQKSEKGILPRTN---TVVEKAIASPVS 229

Query: 119 LGLELRST 126
           L   L+++
Sbjct: 230 LQATLQNS 237

>CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa]
          {ON} some similarities with uniprot|P25502
          Saccharomyces cerevisiae YKL015w PUT3 positive
          activator of the proline utilisation pathway
          Length = 824

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 2  ASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          +S+ S+P   KR     AC+ CR++  KC G +PC  CV     C Y
Sbjct: 14 SSTSSDPPTEKR----VACLRCRQKHIKCPGGNPCAKCVISSATCEY 56

>ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar
          to gnl|GLV|KLLA0C18953g Kluyveromyces lactis
          KLLA0C18953g and some similarites with YKL015W
          uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc- finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 649

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 20/27 (74%)

Query: 14 QRVRKACVPCRERKRKCNGKSPCEMCV 40
          ++ +KAC  C+ RK++C+G  PCE CV
Sbjct: 4  KKSKKACEICKRRKKRCSGGLPCEYCV 30

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          K++R + AC+ CR+R  KC   +PC  C+     C Y E
Sbjct: 26 KQKRQQIACLECRKRHIKCPNGNPCFKCLKNNLKCEYIE 64

>KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} similar
          to uniprot|P26370 Saccharomyces cerevisiae YDL170W UGA3
          Transcriptional activator necessary for gamma-
          aminobutyrate (GABA)-dependent induction of GABA genes
          (such as UGA1 UGA2 UGA4) zinc- finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type localized to the nucleus
          Length = 623

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEEDGP 54
          KR   +  CVPC+ RK++C+   P C  C   G+ C Y  E  P
Sbjct: 19 KRTHRKTGCVPCKIRKKRCSEHKPVCTDCQRLGFYCVYLPEKCP 62

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
          {ON} conserved hypothetical protein
          Length = 971

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEED 52
          +KRQR   +CVPC +RK KC+   P C  C+   + C Y   D
Sbjct: 26 HKRQRKILSCVPCHQRKIKCSRDQPACSNCLKNNWDCVYFLND 68

>KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON}
          conserved hypothetical protein
          Length = 955

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 11 YKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY 48
          +KRQR   +CV C +RK KC+   P CE C   G+ C Y
Sbjct: 37 HKRQRQILSCVACHKRKIKCDRAKPVCESCGKNGWECLY 75

>Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar to
          Ashbya gossypii AGR061C
          Length = 627

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 15 RVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEED 52
          +++ AC  CR+R+RKC+ + PC  C  +G  C   ++D
Sbjct: 9  KLKLACQSCRKRRRKCDLQMPCLNCQKFGVECLPIDQD 46

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY 48
          K +R    C+PC+ +K +CN   P C  C   G  CHY
Sbjct: 27 KSKRTVSVCIPCKSQKLRCNKARPICSRCQRLGKHCHY 64

>Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON}
          YOR162C (REAL)
          Length = 781

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 2  ASSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYV-CHYTEE 51
           SS SN    KR ++ K+C  CR RK +C+ + P C  C++   V C Y EE
Sbjct: 44 TSSNSNK---KRNKLIKSCGFCRRRKLRCDQQKPMCSTCISRNLVACQYAEE 92

>KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa]
          {ON} Anc_4.113 YGL013C
          Length = 997

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          +R++V +AC  CR+RK KC+  +PC  C  Y   C +
Sbjct: 15 RRRKVNRACDNCRKRKIKCSETTPCTNCQIYQCKCVF 51

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
          (REAL)
          Length = 473

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTE 50
          ++AC  CR R+ KC+GK PC  C+ +   C Y +
Sbjct: 10 KQACDCCRVRRVKCDGKKPCNRCLQHDLKCTYLQ 43

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
          (REAL)
          Length = 468

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 17 RKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEE-----DGPLASSRMNQVEELP 67
          + AC  CR R+ KC+GK PC  C+ + + C + +        P+++  +  V E P
Sbjct: 5  KYACDYCRVRRVKCDGKKPCRRCLQHNFECTHQQPLKKRGPKPISARNLGNVTEAP 60

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 4/51 (7%)

Query: 13  RQRVRKACVPCRERKRKCNGKSP----CEMCVAYGYVCHYTEEDGPLASSR 59
           ++RV KAC  CR+RK +C+   P    C  CV +   C +   D  L   R
Sbjct: 126 KKRVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHRDEILRKKR 176

>Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)
          Length = 117

 Score = 37.0 bits (84), Expect = 0.020,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHY 48
          K  RV +AC  C++RK KC+   PC  CV     C Y
Sbjct: 9  KSSRVSRACERCKKRKIKCDTLKPCFNCVGSQSKCTY 45

>NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]
           {ON} Anc_8.416 YDR207C
          Length = 1033

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 14  QRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTE 50
           QR R  C  CR RK+KC  + P C+ C      CHY E
Sbjct: 803 QRSRSGCWICRLRKKKCTEERPTCQNCERLQLTCHYEE 840

>TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa]
           {ON} Anc_5.59 YHR178W
          Length = 767

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 84/205 (40%), Gaps = 27/205 (13%)

Query: 144 EKPSFHVPLSDI----VTKEEYYRISKVYFSVVHPIFDIVDPEQLGKNVEKYWNGDAETS 199
           EKP +   ++D     + K  Y +    YF   H  F ++D       V    + + + S
Sbjct: 300 EKPDWEDDVADSPLQKLDKSLYDKFIAAYFQHNHRTFPMIDKRAFLGTVSTVRDFN-DMS 358

Query: 200 EYGAVIA----GVIALGSFFLGSLGHPREMDIIQYAKGILDDPTFS---RIPSVEQISAW 252
           E+    A     ++A+G   L   G  ++    +     +    FS   R+ ++E I   
Sbjct: 359 EFDDTFAFKLNMIMAIGCTTLHRAGLLKKEHDFREHFAFVAMSKFSKVLRLQNMETIKCL 418

Query: 253 VLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVPLKRTTEVS---- 308
           +L  IY     R   +W  S LT+ L+ ++GL+  +           PL +  +VS    
Sbjct: 419 LLLGIYSFFEPRGVSSWTISGLTMRLTISLGLNRAL-----------PLSKMQKVSAIEV 467

Query: 309 EHTRRLFWSAWSINTILSYDYGRSS 333
           E   R+FWSA+    +++   GR S
Sbjct: 468 ELRSRVFWSAYCYERLVATSLGRIS 492

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 12 KRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYT 49
          K+ R  K C+ CR RK KC+ + P C  C+    +C YT
Sbjct: 7  KKPRPSKVCLTCRRRKVKCDQQHPSCMRCIKSSTLCTYT 45

>KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON}
          Anc_6.154 YBR240C
          Length = 459

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 3  SSGSNPQPYKRQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHY 48
          SS ++ +   R R    C  CR +KR+CN + P C +CV +G  C Y
Sbjct: 9  SSTTDMKKASRARTFTGCWACRLKKRRCNLEKPICSLCVRHGDHCSY 55

>AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YKL222C and YOR172W (YRM1)
          Length = 872

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 13 RQRVRKACVPCRERKRKCNGKSP-CEMCVAYGYV-CHYTEE 51
          R++V K+CV CR+R+ KCN   P C  C+  G   C Y  E
Sbjct: 12 RRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGLPECVYLSE 52

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
           cerevisiae YBR150c TBS1
          Length = 1049

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 9   QPYKRQRVRKACVPCRERKRKCNGKSP----CEMCVAYGYVCHYT-EEDGPLASSRMNQ- 62
           Q YKR R  KAC  CR+RK +C+  +P    C  CV +   C +   E+      RM + 
Sbjct: 31  QHYKR-RSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVECTFKFHEELQTKKKRMYEL 89

Query: 63  --VEELPHDTKNRPY 75
             +E+     K RPY
Sbjct: 90  KAIEKANKKAKKRPY 104

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,054,928
Number of extensions: 2456071
Number of successful extensions: 7866
Number of sequences better than 10.0: 628
Number of HSP's gapped: 8039
Number of HSP's successfully gapped: 656
Length of query: 545
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 430
Effective length of database: 40,294,809
Effective search space: 17326767870
Effective search space used: 17326767870
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)