Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_8.2336.69ON46546523440.0
YOR177C (MPC54)6.69ON46446518480.0
Smik_15.3626.69ON46546518340.0
Skud_15.3446.69ON46546518280.0
Kpol_1008.29singletonON538161880.033
ZYRO0C17270g3.401ON2287172820.25
AFR561W8.752ON267119770.51
ZYRO0A11242gsingletonON28560770.52
KLTH0E01650g7.488ON139694760.96
ZYRO0F11044g8.618ON231112731.4
ZYRO0G08250g6.188ON654187741.7
KNAG0F006501.110ON1306189714.1
SAKL0A08206g6.69ON64546704.5
ZYRO0E04708gsingletonON611276696.4
Ecym_45285.596ON308166687.3
NOTE: 6 genes in the same pillar as Suva_8.233 were not hit in these BLAST results
LIST: KLTH0G15334g AGR274C Kwal_56.23256 TDEL0G04560 Ecym_3119 TPHA0K01150

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_8.233
         (465 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON...   907   0.0  
YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON} ...   716   0.0  
Smik_15.362 Chr15 complement(622220..623617) [1398 bp, 465 aa] {...   711   0.0  
Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {...   708   0.0  
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    39   0.033
ZYRO0C17270g Chr3 (1345022..1351885) [6864 bp, 2287 aa] {ON} sim...    36   0.25 
AFR561W Chr6 (1439423..1440226) [804 bp, 267 aa] {ON} Syntenic h...    34   0.51 
ZYRO0A11242g Chr1 complement(901859..902716) [858 bp, 285 aa] {O...    34   0.52 
KLTH0E01650g Chr5 complement(159757..163947) [4191 bp, 1396 aa] ...    34   0.96 
ZYRO0F11044g Chr6 (901768..902463) [696 bp, 231 aa] {ON} similar...    33   1.4  
ZYRO0G08250g Chr7 (671493..673457) [1965 bp, 654 aa] {ON} simila...    33   1.7  
KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1....    32   4.1  
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    32   4.5  
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    31   6.4  
Ecym_4528 Chr4 complement(1048079..1049005) [927 bp, 308 aa] {ON...    31   7.3  

>Suva_8.233 Chr8 complement(415017..416414) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/465 (96%), Positives = 447/465 (96%)

Query: 1   MPEDPHYSDSYGENNNSNPNMVSPYKDSFFKEVTPSKPNVRFGDDDVNIFDQRKKVNEIN 60
           MPEDPHYSDSYGENNNSNPNMVSPYKDSFFKEVTPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPEDPHYSDSYGENNNSNPNMVSPYKDSFFKEVTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 61  KSSYIKKSIXXXXXXXXXXXXXXXXXXRSDSTSKPGFDYIDQLESNDETFKDVNDAVNRC 120
           KSSYIKKSI                  RSDSTSKPGFDYIDQLESNDETFKDVNDAVNRC
Sbjct: 61  KSSYIKKSIPLSTNTNSTPNKSSLKSPRSDSTSKPGFDYIDQLESNDETFKDVNDAVNRC 120

Query: 121 YALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180
           YALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE
Sbjct: 121 YALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180

Query: 181 LNEKSLQMAIDHLLKVTKQNLRQADDTNKLKETEVLKSFFEEIEEVDDNKISINNLEQQL 240
           LNEKSLQMAIDHLLKVTKQNLRQADDTNKLKETEVLKSFFEEIEEVDDNKISINNLEQQL
Sbjct: 181 LNEKSLQMAIDHLLKVTKQNLRQADDTNKLKETEVLKSFFEEIEEVDDNKISINNLEQQL 240

Query: 241 LEEKKANNILRRDYYKLQERGRRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMN 300
           LEEKKANNILRRDYYKLQERGRRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMN
Sbjct: 241 LEEKKANNILRRDYYKLQERGRRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMN 300

Query: 301 NNLKADKTQFSQMEKQYFQKYTYIEKYMTHVKEEYNKKEDECDKLKFIIDNNLKKIDHLE 360
           NNLKADKTQFSQMEKQYFQKYTYIEKYMTHVKEEYNKKEDECDKLKFIIDNNLKKIDHLE
Sbjct: 301 NNLKADKTQFSQMEKQYFQKYTYIEKYMTHVKEEYNKKEDECDKLKFIIDNNLKKIDHLE 360

Query: 361 RALQSQIATQNSFSTAAIQEEDPDDAHLEDRYQKVKEFMEQKLQTSKIDDPMKSETEALD 420
           RALQSQIATQNSFSTAAIQEEDPDDAHLEDRYQKVKEFMEQKLQTSKIDDPMKSETEALD
Sbjct: 361 RALQSQIATQNSFSTAAIQEEDPDDAHLEDRYQKVKEFMEQKLQTSKIDDPMKSETEALD 420

Query: 421 NVLGLIENTMKTLDRNSKYQPTTTKKCIKYVIGSSRLKENEHITN 465
           NVLGLIENTMKTLDRNSKYQPTTTKKCIKYVIGSSRLKENEHITN
Sbjct: 421 NVLGLIENTMKTLDRNSKYQPTTTKKCIKYVIGSSRLKENEHITN 465

>YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON}
           MPC54Component of the meiotic outer plaque, a
           membrane-organizing center which is assembled on the
           cytoplasmic face of the spindle pole body during meiosis
           II and triggers the formation of the prospore membrane;
           potential Cdc28p substrate
          Length = 464

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/465 (76%), Positives = 396/465 (85%), Gaps = 1/465 (0%)

Query: 1   MPEDPHYSDSYGENNNSNPNMVSPYKDSFFKEVTPSKPNVRFGDDDVNIFDQRKKVNEIN 60
           MPED  YS+S+ E+  +N + +SPYKDSF+KE+TPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPEDTSYSNSF-EDYYNNSHAISPYKDSFYKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 59

Query: 61  KSSYIKKSIXXXXXXXXXXXXXXXXXXRSDSTSKPGFDYIDQLESNDETFKDVNDAVNRC 120
           K++ +K+SI                  R    SK  FD   +LES +ET K+VNDAVNRC
Sbjct: 60  KNNTVKRSIPSSISTTITPNKSSLKSPRGKRASKNSFDNETKLESKNETLKEVNDAVNRC 119

Query: 121 YALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180
           YALCNIPTKHVSI SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE
Sbjct: 120 YALCNIPTKHVSINSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 179

Query: 181 LNEKSLQMAIDHLLKVTKQNLRQADDTNKLKETEVLKSFFEEIEEVDDNKISINNLEQQL 240
           LNEKSLQMAIDHLLKVTKQNLRQADD NKLKETE LKSF EEIEEVDDNKISIN+L+QQL
Sbjct: 180 LNEKSLQMAIDHLLKVTKQNLRQADDGNKLKETEALKSFIEEIEEVDDNKISINSLQQQL 239

Query: 241 LEEKKANNILRRDYYKLQERGRRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMN 300
           LEEK ANNILRRDYYKLQERGRRLCHEFQ+LQ+DY++Q+K KEYE+QKLKNEIK LLNMN
Sbjct: 240 LEEKTANNILRRDYYKLQERGRRLCHEFQELQDDYSKQMKQKEYEVQKLKNEIKVLLNMN 299

Query: 301 NNLKADKTQFSQMEKQYFQKYTYIEKYMTHVKEEYNKKEDECDKLKFIIDNNLKKIDHLE 360
           +NLKA+K  +SQ EKQYFQKYTYIEKYM HVKEEYN+KEDEC KL FIID ++KKI+HLE
Sbjct: 300 DNLKAEKAHYSQKEKQYFQKYTYIEKYMNHVKEEYNRKEDECKKLNFIIDKSMKKIEHLE 359

Query: 361 RALQSQIATQNSFSTAAIQEEDPDDAHLEDRYQKVKEFMEQKLQTSKIDDPMKSETEALD 420
           R+LQ+Q   QNSFSTA IQEE P DAHL+DRY KVKEFMEQKLQTSKI+DP  SE EALD
Sbjct: 360 RSLQTQFTAQNSFSTAMIQEEGPKDAHLKDRYHKVKEFMEQKLQTSKINDPSCSEAEALD 419

Query: 421 NVLGLIENTMKTLDRNSKYQPTTTKKCIKYVIGSSRLKENEHITN 465
           NVL LIE++MKTLD+NSK  P  TKKCIKYV  S RLKENEH+TN
Sbjct: 420 NVLCLIESSMKTLDKNSKCYPIATKKCIKYVTDSPRLKENEHVTN 464

>Smik_15.362 Chr15 complement(622220..623617) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/465 (78%), Positives = 397/465 (85%)

Query: 1   MPEDPHYSDSYGENNNSNPNMVSPYKDSFFKEVTPSKPNVRFGDDDVNIFDQRKKVNEIN 60
           MP+D  YSDS+ E NNSN   VSPYKD FFKE+TPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPKDITYSDSFEEFNNSNTLAVSPYKDIFFKEMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 61  KSSYIKKSIXXXXXXXXXXXXXXXXXXRSDSTSKPGFDYIDQLESNDETFKDVNDAVNRC 120
           K+S IK++                   +S  TSK  F+Y ++ E+ +ETFKDVNDAVNRC
Sbjct: 61  KNSSIKRTFQTSTSTTTTPNKSSLKSPKSKKTSKDIFNYGNKSETREETFKDVNDAVNRC 120

Query: 121 YALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180
           YALCNIPTKH+SIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE
Sbjct: 121 YALCNIPTKHISIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180

Query: 181 LNEKSLQMAIDHLLKVTKQNLRQADDTNKLKETEVLKSFFEEIEEVDDNKISINNLEQQL 240
           LNEKSLQMAIDHLLKVTKQNLRQADD NKLK+TEVLKSF EEIEEVDDNKISIN+LEQQL
Sbjct: 181 LNEKSLQMAIDHLLKVTKQNLRQADDNNKLKDTEVLKSFIEEIEEVDDNKISINSLEQQL 240

Query: 241 LEEKKANNILRRDYYKLQERGRRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMN 300
            EEK ANNILRRDYYKLQERGRRLCH+FQDLQ+DY++Q+K KEYE+QKLKNEIKTLL MN
Sbjct: 241 FEEKTANNILRRDYYKLQERGRRLCHDFQDLQDDYSKQMKQKEYEVQKLKNEIKTLLCMN 300

Query: 301 NNLKADKTQFSQMEKQYFQKYTYIEKYMTHVKEEYNKKEDECDKLKFIIDNNLKKIDHLE 360
           +NLKAD+T  SQ EKQYFQK TYIEKYM HVKEEYN+KE+EC+KLK+IID ++K+I+HLE
Sbjct: 301 DNLKADRTLLSQKEKQYFQKCTYIEKYMNHVKEEYNRKENECNKLKYIIDKSMKRIEHLE 360

Query: 361 RALQSQIATQNSFSTAAIQEEDPDDAHLEDRYQKVKEFMEQKLQTSKIDDPMKSETEALD 420
           R+LQSQ   QNSFSTA I EE   D  LEDRY KVKEFMEQKLQTSKI D   SETEALD
Sbjct: 361 RSLQSQSTVQNSFSTATILEEGSKDIDLEDRYHKVKEFMEQKLQTSKIHDSSCSETEALD 420

Query: 421 NVLGLIENTMKTLDRNSKYQPTTTKKCIKYVIGSSRLKENEHITN 465
           NVLGLIENTMK LD+N+KY PTT KKCIKYV GSSR  ENEHITN
Sbjct: 421 NVLGLIENTMKKLDKNNKYVPTTAKKCIKYVTGSSRFDENEHITN 465

>Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {ON}
           YOR177C (REAL)
          Length = 465

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/465 (75%), Positives = 398/465 (85%)

Query: 1   MPEDPHYSDSYGENNNSNPNMVSPYKDSFFKEVTPSKPNVRFGDDDVNIFDQRKKVNEIN 60
           MPED  Y+  + E +N+N + +SP+KDS+FK++TPSKPNVRFGDDDVNIFDQRKKVNEIN
Sbjct: 1   MPEDISYTGPFEEFSNNNSHGISPFKDSYFKDMTPSKPNVRFGDDDVNIFDQRKKVNEIN 60

Query: 61  KSSYIKKSIXXXXXXXXXXXXXXXXXXRSDSTSKPGFDYIDQLESNDETFKDVNDAVNRC 120
           K+S I++ I                  +S++ S  GFDY  + E+ D+TFK+VNDAVNRC
Sbjct: 61  KNSSIRRGIPPSININNTPNKSSLKSPKSNNLSDCGFDYERRFETRDDTFKEVNDAVNRC 120

Query: 121 YALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKE 180
           YALCNIPTKH+SI SISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKK+
Sbjct: 121 YALCNIPTKHISISSISDLAQTFETLAVGITHETNRKAECERSKNAIDSLYYHEQLEKKD 180

Query: 181 LNEKSLQMAIDHLLKVTKQNLRQADDTNKLKETEVLKSFFEEIEEVDDNKISINNLEQQL 240
           LNEKSLQMAIDHLLKVTKQN RQ D  +KL+ETEVLKSF +EIEEV+DNKISIN+LEQQL
Sbjct: 181 LNEKSLQMAIDHLLKVTKQNQRQVDGRDKLEETEVLKSFIKEIEEVEDNKISINSLEQQL 240

Query: 241 LEEKKANNILRRDYYKLQERGRRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMN 300
           LEEK ANNILRRDYYKLQERG+RLCHEFQDLQ+DY++++K KEYE+QKLKNE+K L NMN
Sbjct: 241 LEEKTANNILRRDYYKLQERGKRLCHEFQDLQDDYSKKMKQKEYEVQKLKNEVKFLTNMN 300

Query: 301 NNLKADKTQFSQMEKQYFQKYTYIEKYMTHVKEEYNKKEDECDKLKFIIDNNLKKIDHLE 360
            NLKADKTQFSQ EKQY QKY YIEKYM+HVK+EYNKKEDEC++LKF++D N+KKIDHLE
Sbjct: 301 TNLKADKTQFSQKEKQYSQKYIYIEKYMSHVKQEYNKKEDECNRLKFVVDKNMKKIDHLE 360

Query: 361 RALQSQIATQNSFSTAAIQEEDPDDAHLEDRYQKVKEFMEQKLQTSKIDDPMKSETEALD 420
           R+LQ+Q   QNSFS   +Q+ED  DAHLEDRY KVKEFMEQKLQTSK +DP  SE EALD
Sbjct: 361 RSLQAQTNAQNSFSAVTVQDEDQKDAHLEDRYHKVKEFMEQKLQTSKNNDPSCSEAEALD 420

Query: 421 NVLGLIENTMKTLDRNSKYQPTTTKKCIKYVIGSSRLKENEHITN 465
           NVLGLIENTMKTL+ NSKY  TTTKKC+KYV GSSRLKENEHITN
Sbjct: 421 NVLGLIENTMKTLEGNSKYYSTTTKKCLKYVTGSSRLKENEHITN 465

>Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {ON}
           complement(62595..64211) [1617 nt, 539 aa]
          Length = 538

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 70/161 (43%), Gaps = 43/161 (26%)

Query: 33  VTPSKPNVRFGDDDVNIFDQRKKVNE------INKSSYIKKSIXXXXXXXXXXXXXXXXX 86
           V    P +RF  + + IFDQ K+V++      + KSS  +KSI                 
Sbjct: 67  VKEKNPKIRFDCNRILIFDQDKEVSKSGIQKILTKSSSSQKSI---------------LK 111

Query: 87  XRSDSTSKPGFDYIDQLESNDETFKDVNDAVNRCYALCNIPTKHVSIKSISDLAQTFETL 146
            R D       D  D+L   D+   ++   V R + LC +  KH  I+ IS   +  E L
Sbjct: 112 KRED-------DIEDKLYPQDD---EITQIVKRMFTLCGVNLKH--IEGIS-FKEQLERL 158

Query: 147 AVGITHETNRKAECERSKNAIDSLYYHEQLEKKELNEKSLQ 187
           +V IT+  N K  C +        Y  ++LE  +LN+K L+
Sbjct: 159 SVSITNAFNTKEMCSK--------YIKQKLE-SQLNDKILE 190

>ZYRO0C17270g Chr3 (1345022..1351885) [6864 bp, 2287 aa] {ON} similar
            to uniprot|P38111 Saccharomyces cerevisiae YBR136W MEC1
            Central regulator of the Mec1p/Tel1p signaling network;
            required for mitotic growth, DNA repair and mitotic
            recombination, regulates phosphorylation of Rad53p,
            required for dmc1 arrest and meiotic recombination;
            similar to phosphatidylinositol (PI)3- kinases required
            for DNA damage induced checkpoint responses in G1, S/M,
            intra S, and G2/M in mitosis
          Length = 2287

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 74/172 (43%), Gaps = 35/172 (20%)

Query: 301  NNLKADKTQFSQMEKQYFQKYTYIEKYMTHVKEEYNKKEDECDKLKFII-----DNNLKK 355
            N+L+ D  +     +  F+ + Y +K+MTH K+ YN          FII     +N L++
Sbjct: 1254 NHLQIDSLKMCY--QSIFRVFEYCKKWMTHFKQSYNNNHG-----TFIIKEAKYNNMLRR 1306

Query: 356  IDHLERALQSQIATQ-----NSFSTAAI-------QEEDPDD------AHLEDRYQKVKE 397
            +D    A  S +  Q     NSF  +A+       QE D +         L   Y+++ +
Sbjct: 1307 VDDFLGAFPSALLAQRSLETNSFERSALYLEQCYRQESDKEIQPFSILGSLHRTYEEIGD 1366

Query: 398  F--MEQKLQTSKIDDPMKS--ETEALDNVLGLIENTMKTLDRNSKYQPTTTK 445
               ++  L+T   +D M    E +  DN   + +N   TL   +   P+TTK
Sbjct: 1367 IDSIDGLLKTFSTEDLMSKIEELQYSDN-WQMAQNCFTTLGTFTMDSPSTTK 1417

>AFR561W Chr6 (1439423..1440226) [804 bp, 267 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR226C
          Length = 267

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 53/119 (44%), Gaps = 2/119 (1%)

Query: 103 LESNDETFKDVNDAVNRCYALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAECER 162
           LE   E F+D++  +N   A   + T+ V   S+ D+ + F T  +G+ H T       +
Sbjct: 86  LEGLPEEFRDIDILINN--AGKALGTERVGEISMDDIQEVFNTNVIGLVHLTQEVLPIMK 143

Query: 163 SKNAIDSLYYHEQLEKKELNEKSLQMAIDHLLKVTKQNLRQADDTNKLKETEVLKSFFE 221
           +KN+ D +       ++     S+  A  H +K   + +R+   + K++  E+     E
Sbjct: 144 AKNSGDIVNVGSIAGREAYPGGSIYCATKHAVKAFTRAMRKELISTKIRVFEIAPGSVE 202

>ZYRO0A11242g Chr1 complement(901859..902716) [858 bp, 285 aa] {ON}
           no similarity
          Length = 285

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 171 YYHEQLEKKELNE--KSLQMAIDHLLKVTKQNLRQADDTNKLK-ETEVLKSFFEEIEEVD 227
           +YH+ LE  EL++    L M I +LL  T       DD  K+K ET+VL+   +E+ EVD
Sbjct: 75  FYHDPLES-ELSDFLSPLWMIIHYLLCFTFSIFSFIDDRKKVKIETKVLQKLLKEVAEVD 133

>KLTH0E01650g Chr5 complement(159757..163947) [4191 bp, 1396 aa]
           {ON} similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1396

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 2/94 (2%)

Query: 272 QND--YTQQIKHKEYELQKLKNEIKTLLNMNNNLKADKTQFSQMEKQYFQKYTYIEKYMT 329
           QND   + Q+     EL  L N++ +L N    +   KT+  Q  K+     + IE  MT
Sbjct: 593 QNDGNASLQLSQATTELANLSNQVGSLTNQATLVNERKTRAQQELKRINNLKSSIETKMT 652

Query: 330 HVKEEYNKKEDECDKLKFIIDNNLKKIDHLERAL 363
            ++  Y K+  E ++L+ I+  + ++ + L+R L
Sbjct: 653 TLRGSYEKELSETEQLESILTKSRQESEELKREL 686

>ZYRO0F11044g Chr6 (901768..902463) [696 bp, 231 aa] {ON} similar to
           uniprot|P32489 Saccharomyces cerevisiae YPL121C MEI5
           Meiosis specific protein involved in DMC1- dependent
           meiotic recombination forms heterodimer with Sae3p
           proposed to be an assembly factor for Dmc1p
          Length = 231

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 9/112 (8%)

Query: 262 RRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMNNNLKADKT-----QFSQMEKQ 316
           RRL +E + L N++T+QI   + E  +L   IK L N     K  +        SQ    
Sbjct: 56  RRLAYELKLLNNEFTRQINSYKIENNQLNQSIKVLKNYEKEEKVMRLIEKWRSISQAGMS 115

Query: 317 YFQKYTYIEKYMTHVKEEYNKKEDECD--KLKFIIDNNLKKIDHLERALQSQ 366
           Y    T ++       EE  +KE E +  K+++ +D+NL+  D ++  L+S+
Sbjct: 116 YMLNSTMLKITKIGGYEELKRKEMEAEKRKIEYQVDDNLQ--DEMDNVLESE 165

>ZYRO0G08250g Chr7 (671493..673457) [1965 bp, 654 aa] {ON} similar
           to uniprot|P40957 Saccharomyces cerevisiae YGL086W MAD1
           Coiled-coil protein involved in the spindle- assembly
           checkpoint phosphorylated by Mps1p upon checkpoint
           activation which leads to inhibition of the activity of
           the anaphase promoting complex forms a complex with
           Mad2p
          Length = 654

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 83/187 (44%), Gaps = 32/187 (17%)

Query: 257 LQERGRRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMNNNLKADKTQFSQMEKQ 316
           L E   RL  E  DL+N   Q    ++ EL++L++E          L+A   +  ++E  
Sbjct: 79  LYETNGRLEQELSDLKNSSNQNDDTRDEELRRLRSE----------LRAKDYRIDELESN 128

Query: 317 YFQKYTYIEKYMTHVKEE-------YNKKEDECDK----LKFIIDNNLKKIDHLERALQS 365
           Y  K + +E+ + + + E         + E+E  K    +K +   N +K D L     S
Sbjct: 129 YQSKLSKLERKLENNQVESQSSQTLLKRYEEEISKQSGQIKMLQRANSEKDDELATLKAS 188

Query: 366 QIATQN-SFSTAAIQEEDPDDAHLEDRYQKVKEFMEQKLQ----------TSKIDDPMKS 414
            + TQ+ ++ST  +QE    +  L+D+ Q  KE  E  +Q          TS+  +  KS
Sbjct: 189 NVVTQHHNYSTEDLQELTVTNKMLQDQLQYSKELEEANMQQAGELKRLRMTSESQNFWKS 248

Query: 415 ETEALDN 421
           E E L N
Sbjct: 249 ENEKLQN 255

>KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1.110
           YNL250W
          Length = 1306

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 94/189 (49%), Gaps = 24/189 (12%)

Query: 131 VSIKSISDLAQTFETLAVGITHE-TNRKAECERSKNAIDSLYYHEQLEKKELNEKSLQMA 189
           +S+++I +  +  E L   +  E T+ KA  E  +N+   L      EK+E+ EK+L+  
Sbjct: 734 ISLRNIKEQVKKLEELKPCLVEEHTSTKASLEEIENSNRKLK-----EKREVCEKTLRRT 788

Query: 190 IDHLLKVTKQ-NLRQADDTNKLKETEVLKSFFEEIEEVDDNKISINNLEQQLLEEKKANN 248
           I+ ++  +K+ NL +A+           K   +++E  +++  ++  +++   E+K+ N+
Sbjct: 789 IEQIVDNSKELNLLEAE----------FKGLSKQLEMYNNSSGTLQTVDELRAEQKQKND 838

Query: 249 ILRR---DYYKLQERGRRLCHEFQDLQNDYTQQIKHKEYELQKLKNEIKTLLNMNNNLKA 305
           +LR+   D   LQE   R   E   L N     +K K   ++++++ + +  N+     A
Sbjct: 839 LLRKLRKDINDLQEERERKTKEHNSLIN----MVKEKTLSIREMESSVASEKNIQREYSA 894

Query: 306 DKTQFSQME 314
            KT+ + +E
Sbjct: 895 KKTELNDIE 903

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
           hypothetical protein
          Length = 645

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 115 DAVNRCYALCNIPTKHVSIKSISDLAQTFETLAVGITHETNRKAEC 160
           +A+ RC+ LCN+P + +      DL  + + L+ GI      +  C
Sbjct: 217 EAITRCFNLCNVPLEDL---DEDDLVMSLQRLSFGIVSAFKTQEMC 259

>ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {ON}
           conserved hypothetical protein
          Length = 611

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 59/276 (21%), Positives = 113/276 (40%), Gaps = 45/276 (16%)

Query: 30  FKEVTPSKPNVRFGDDDVNIFDQRKKVNEINKS-SYIKKSIXXXXXXXXXXXXXXXXXXR 88
           F ++   K NV+FGD ++ IF++ +++    K+ S +   I                   
Sbjct: 68  FSKLQAPKGNVKFGDKEIVIFNEDERIGHSMKANSSVDNVILPLPILK------------ 115

Query: 89  SDSTSKPGFDYIDQLESNDETF---KDVNDAVNRCYALCNIPTKHV----SIKSISDLAQ 141
               S+ G   I  +E +++     + + +   RCY LCN+P          KS+  L +
Sbjct: 116 ---ISQKGASDIKYMEPDNKMATQQERLFEVFRRCYTLCNLPMSQFDENNPFKSLKKLCE 172

Query: 142 TFETLAVG-------ITHETNRKA--ECERSKNAIDSLY--YHEQLEKKELNEKSLQM-- 188
             +            I +E NR+   E  + K+ I  L    H  L   ++N+  LQ   
Sbjct: 173 GIKKSFKAKDECYKYIRYEENRRLSQEIRKLKDTIQELKDDRHNSLVLLQINK--LQKHN 230

Query: 189 ------AIDHLLKVTKQNLRQADDTNKLKETEVLKS-FFEEIEEVDDNKISINNLEQQLL 241
                   D   +VT  N   ++  + + E +  K+   E++       + + N +++ +
Sbjct: 231 NEYRNEIKDLTAQVTSTNYENSELRSNISELQTTKNQLMEKLGTALARSVELENNQEEKI 290

Query: 242 EEKKANNILRRDYYKLQERGRRLCHEFQDLQNDYTQ 277
           E  K N  L  D+ KL +   RL  +++ L+ +YT+
Sbjct: 291 ELTKQNTKLNNDHGKLNDEHERLTKKYESLEEEYTK 326

>Ecym_4528 Chr4 complement(1048079..1049005) [927 bp, 308 aa] {ON}
           similar to KLLA0E03377g - Kluyveromyces lactis
          Length = 308

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 83/166 (50%), Gaps = 14/166 (8%)

Query: 217 KSFFEEIEEVDDNKISINNLEQQLLEEKKANNILR-RDYYKLQERGRRLCHEFQDLQNDY 275
           KSF E+I+ VD+ ++    +E + L  + ANN    +D        R+L H  + L    
Sbjct: 57  KSFKEDIKLVDE-QVRHTQVELESLVARSANNNRHLKDLLLSTNDVRKLQHLLEGLTQQQ 115

Query: 276 TQQIKHKEYELQKLKNEIKTLLN-MNNNLKADKTQFSQMEKQYFQKYTYIEKYMTHVKEE 334
               K+ E+EL+KL   +   L+ +  +L+ D+ ++++ EK+  Q+Y      +  + + 
Sbjct: 116 EAIKKNSEHELEKLSGMLDGKLSRIVESLRRDEGKYAEQEKE-LQEYRLKHGELQDLSKC 174

Query: 335 YNKKEDECDKLK--FIIDNNLKKI-----DHLE---RALQSQIATQ 370
             KK+DE  +LK  F     L K+     D LE   +AL++Q++ Q
Sbjct: 175 IAKKKDELFELKVDFTTTMELLKVRSEALDSLETRYKALEAQLSEQ 220

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,665,276
Number of extensions: 2663868
Number of successful extensions: 16698
Number of sequences better than 10.0: 1359
Number of HSP's gapped: 16796
Number of HSP's successfully gapped: 1902
Length of query: 465
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 352
Effective length of database: 40,524,141
Effective search space: 14264497632
Effective search space used: 14264497632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)