Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_8.2276.65ON28725913090.0
Skud_15.3366.65ON28625810151e-139
Smik_15.3526.65ON28826010011e-137
YOR174W (MED4)6.65ON28425910001e-137
NCAS0F003306.65ON2812437011e-91
ZYRO0D14190g6.65ON2952056873e-89
CAGL0L04620g6.65ON2642356573e-85
KNAG0M010206.65ON2792396376e-82
Kpol_1042.116.65ON2922076377e-82
SAKL0A08426g6.65ON2991716161e-78
NDAI0J013206.65ON3342516182e-78
Kwal_56.232426.65ON2562395782e-73
AGR270W6.65ON2941755794e-73
TBLA0G005506.65ON3181715712e-71
KAFR0G025006.65ON2892685663e-71
KLTH0G15444g6.65ON2631695628e-71
TPHA0F025906.65ON3061935414e-67
Ecym_31246.65ON2742195193e-64
TDEL0G040606.65ON2201645083e-63
KLLA0F20185g6.65ON2851895091e-62
KNAG0E024802.467ON49383740.75
KLTH0G13750g8.259ON1399121712.3
Suva_13.1992.590ON84079702.6
KAFR0B021408.140ON896150685.2
KNAG0H011903.278ON21895665.4
Smik_6.468.34ON176065675.9
KAFR0D050305.426ON146278676.0
TBLA0F038408.235ON125698676.6
Ecym_61794.129ON122682677.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_8.227
         (287 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   508   0.0  
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   395   e-139
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   390   e-137
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   389   e-137
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   274   1e-91
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   269   3e-89
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   257   3e-85
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   249   6e-82
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   249   7e-82
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   241   1e-78
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   242   2e-78
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   227   2e-73
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   227   4e-73
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   224   2e-71
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   222   3e-71
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   221   8e-71
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   213   4e-67
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   204   3e-64
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   200   3e-63
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   200   1e-62
KNAG0E02480 Chr5 (492142..493623) [1482 bp, 493 aa] {ON} Anc_2.4...    33   0.75 
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...    32   2.3  
Suva_13.199 Chr13 complement(322643..325165) [2523 bp, 840 aa] {...    32   2.6  
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    31   5.2  
KNAG0H01190 Chr8 complement(201945..202601) [657 bp, 218 aa] {ON...    30   5.4  
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    30   5.9  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...    30   6.0  
TBLA0F03840 Chr6 complement(950528..954298) [3771 bp, 1256 aa] {...    30   6.6  
Ecym_6179 Chr6 complement(330143..333823) [3681 bp, 1226 aa] {ON...    30   7.2  

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/259 (96%), Positives = 251/259 (96%)

Query: 1   MSVQDTKAVEFPMNQIRSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESV 60
           MSVQDTKAVEFPMNQIRSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESV
Sbjct: 1   MSVQDTKAVEFPMNQIRSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESV 60

Query: 61  DRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNE 120
           DRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNE
Sbjct: 61  DRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNE 120

Query: 121 CHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNF 180
           CHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNF
Sbjct: 121 CHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRIPGXXXXXXXXVPTDTLSQPQKEKKESSENSPQNS 240
           IWPAEDALRRGMLAMASLHSKELTRIPG        VPTDTLSQPQKEKKESSENSPQNS
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRIPGEEEQETEEVPTDTLSQPQKEKKESSENSPQNS 240

Query: 241 PTKDSFIFNGIANKDTDQA 259
           PTKDSFIFNGIANKDTDQA
Sbjct: 241 PTKDSFIFNGIANKDTDQA 259

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  395 bits (1015), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 198/258 (76%), Positives = 221/258 (85%), Gaps = 2/258 (0%)

Query: 1   MSVQDTKAVEFPMNQIRSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESV 60
           MSVQ+TKAVEFPM  I+SSSVSLVAEA S+MNSE K SKVQLYEDLCRYE +L KLVESV
Sbjct: 1   MSVQNTKAVEFPMGHIKSSSVSLVAEAASNMNSEDKLSKVQLYEDLCRYEGVLSKLVESV 60

Query: 61  DRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNE 120
           DRFKP+L++A+DLI  DESLFNNVKLLADYD ID NL+KIDKDSEELDSK+RKILEILNE
Sbjct: 61  DRFKPDLDVARDLISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNE 120

Query: 121 CHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNF 180
           CHDELS LP LEQVEFEK TILQQRSKINSTALLDYATKLSKFT+IPPTFDKGTVGPNNF
Sbjct: 121 CHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRIPGXXXXXXXXVPTDTLSQPQKEKKESSENSPQNS 240
           IWPAEDALRRGMLAMASLHSKELTR+PG        VPT  LSQP +++++ ++N   + 
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEDEQETEEVPTAPLSQPGQQEEQEAQNE--DI 238

Query: 241 PTKDSFIFNGIANKDTDQ 258
             KD+FIF G  +KD + 
Sbjct: 239 SDKDTFIFKGTPHKDAEH 256

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  390 bits (1001), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 190/260 (73%), Positives = 218/260 (83%), Gaps = 1/260 (0%)

Query: 1   MSVQDTKAVEFPMNQIRSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESV 60
           MSVQDTKAV+F M  ++SSSVSLV EATS+MNSE K SKVQLYEDLCRYED L KLVESV
Sbjct: 1   MSVQDTKAVDFSMGHMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESV 60

Query: 61  DRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNE 120
           DRFKP++++A+DLIK DESLFNNV LL++YD ID NLRKIDKDSEELDSKT++ILEI+NE
Sbjct: 61  DRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNE 120

Query: 121 CHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNF 180
           CHDEL ALPMLEQVEFEK TILQQRSKINSTALLDYATKLSKFTRIPPTFDKG++GPNNF
Sbjct: 121 CHDELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRIPGXXXXXXXXVPTDTLSQPQKEKKESSENSPQNS 240
           IWPAEDALRRGMLAMASLHSKELTR+PG             +S P +   ++   + +  
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRVPGEEAEEAAETEEVLVSSPSQNGLDNEHKTAKEE 240

Query: 241 -PTKDSFIFNGIANKDTDQA 259
            P+ DSFIFNG ANK++++ 
Sbjct: 241 VPSTDSFIFNGTANKNSEEV 260

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  389 bits (1000), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 197/259 (76%), Positives = 212/259 (81%), Gaps = 3/259 (1%)

Query: 1   MSVQDTKAVEFPMNQIRSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESV 60
           MSVQDTKAVEF M  IRSSSVSLVAEATS+ NSE K SKVQLYEDLCRYED L KLVESV
Sbjct: 1   MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESV 60

Query: 61  DRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNE 120
           DRFKPNL+IAKDLI+TDE+LF NVKLLA+YD I  NL+KIDKDSEELDSKTRKILEILNE
Sbjct: 61  DRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNE 120

Query: 121 CHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNF 180
           CHDEL ALPMLEQVEFEK TILQQRSKINST LLDYATKLSKFT+IPPTFDKG VGPNNF
Sbjct: 121 CHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNF 180

Query: 181 IWPAEDALRRGMLAMASLHSKELTRIPGXXXXXXXXVPTDTLSQPQKEKKESSENSPQNS 240
           IWPAEDALRRGMLAMASLHSKELTRIPG                 Q E+++      + +
Sbjct: 181 IWPAEDALRRGMLAMASLHSKELTRIPGEEVEETEVPTV---PPSQSEEQKGQMAKKEGT 237

Query: 241 PTKDSFIFNGIANKDTDQA 259
           P  DSFIF+G A +  D+A
Sbjct: 238 PKTDSFIFDGTAKEVGDEA 256

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  274 bits (701), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 140/243 (57%), Positives = 174/243 (71%), Gaps = 17/243 (6%)

Query: 13  MNQIRSSSVSLVAEAT--SSMNSEHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIA 70
           M  IRSSSVSL+AE    S  N E   SKVQ+Y DLC YE  L  LV SVD+FKP++  A
Sbjct: 15  MGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAA 74

Query: 71  KDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALPM 130
           ++LI+ D  LF  +    +YDKID +L+K++ +S ELD++T++IL ILNECHDEL+ALPM
Sbjct: 75  RELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALPM 134

Query: 131 LEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRR 190
           L+QVEFE +TILQQRSKINS+ LLDYATKLSKFT+IPPTFDKG++GPNNFIWPAEDALRR
Sbjct: 135 LKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRR 194

Query: 191 GMLAMASLHSKELTRIPGXXXXXXXXVPTDTLSQPQKEKKESSENSPQNSPT---KDSFI 247
           GMLA+ASLH+ ELT+ PG        +P            + SE   Q  P    ++SF 
Sbjct: 195 GMLALASLHADELTKAPGAHEGEEELIP------------KGSEPIAQEEPVTTRRESFT 242

Query: 248 FNG 250
           F+G
Sbjct: 243 FSG 245

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  269 bits (687), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 127/205 (61%), Positives = 169/205 (82%), Gaps = 1/205 (0%)

Query: 5   DTKAVEFPMNQIRSSSVSLVAEATSSMNS-EHKSSKVQLYEDLCRYEDILGKLVESVDRF 63
           DT A       +RSSS SL+++A SS N+ + + SKVQ+Y DL +YE+ L  LVESVD F
Sbjct: 10  DTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNF 69

Query: 64  KPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHD 123
           KP+++I  +LI+ D+SL+ ++   A+YD+ID  L ++DK+S ELD KT+++LE L+EC++
Sbjct: 70  KPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYE 129

Query: 124 ELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWP 183
            L+ LPMLEQVEFEK++IL+QRSK+NS+ LL+YATKLSKFT+IPPTFDKGT+GPNNF+WP
Sbjct: 130 MLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWP 189

Query: 184 AEDALRRGMLAMASLHSKELTRIPG 208
           AEDALRRGMLA+ASLHSKE+TRIPG
Sbjct: 190 AEDALRRGMLAIASLHSKEMTRIPG 214

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  257 bits (657), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 131/235 (55%), Positives = 165/235 (70%), Gaps = 3/235 (1%)

Query: 21  VSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESL 80
           +SLVAE+ S   SE +  KVQLY DLC YE+ L KLV+SVD FKP LEI K LI+ D+ L
Sbjct: 1   MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60

Query: 81  FNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKT 140
           ++ + LL  YD +   LR +D +  ++D +T+ IL ILNECHD+L+ALP+LE+VEFEKK 
Sbjct: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120

Query: 141 ILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHS 200
           IL+QR KI S  LL+YATKL+KFT+IPPTFDKGT+GPNNFIWPAEDALR+GMLAMASLH 
Sbjct: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180

Query: 201 KELTRIPGXXXXXXXXVPTDTLSQPQKEKKESSENSPQNSPTK--DSFIFNGIAN 253
           KELT++PG           +      K+  E +E   +    K  DSF+F   AN
Sbjct: 181 KELTKLPGQEDGEEDGSTANEDKNIVKD-AEGAEGEIRQDDKKEDDSFVFGANAN 234

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  249 bits (637), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 161/239 (67%), Gaps = 8/239 (3%)

Query: 17  RSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKT 76
           R+SSVSL+ E T +        KV++Y  +  YED L  LVESVD +KP++ +A+ L+  
Sbjct: 20  RASSVSLLQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDA 79

Query: 77  DESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEF 136
           D+ LF ++    +YD+I   L ++   S  LD+KTR ILE LNECHDEL+ LP LEQV+F
Sbjct: 80  DKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQF 139

Query: 137 EKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMA 196
           E  TIL+QR KINS+ LLDYATKLSKFTRIPPTFDKG++GPNNFIWPAEDALR+GMLA+A
Sbjct: 140 EMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIA 199

Query: 197 SLHSKELTRIPGXXXXXXXXVPTDTLSQPQKEKKESSENSPQNSPTKDSFIFNGIANKD 255
           +LHS+ELTRIPG               + Q EK +  E +P     + SF+F   +  D
Sbjct: 200 ALHSRELTRIPGQDDAED--------KKKQTEKPDVPEPAPVTEERRSSFVFGDTSTAD 250

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  249 bits (637), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%), Gaps = 12/207 (5%)

Query: 13  MNQIRS-SSVSLVAEATSSM-----------NSEHKSSKVQLYEDLCRYEDILGKLVESV 60
           M  ++S SSVSL+ + T+S+           N  +  SKVQ+Y D+  YE+ L KLVESV
Sbjct: 6   MGHVKSISSVSLMTDNTNSISTNSLNMIDYNNESNDLSKVQIYNDISEYENTLFKLVESV 65

Query: 61  DRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNE 120
           D+FKP++++A  LI  DE LF ++    +YDKI   L + DK++ ELD+KT++IL  LNE
Sbjct: 66  DKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTKLEECDKEAAELDTKTKEILGTLNE 125

Query: 121 CHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNF 180
           CH  L++LPMLEQVEFEK  IL+QRSKINS  LLDYATKLSKFT+IPPTF+KG++GPNNF
Sbjct: 126 CHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDYATKLSKFTKIPPTFNKGSIGPNNF 185

Query: 181 IWPAEDALRRGMLAMASLHSKELTRIP 207
           IWPAEDALRRGMLAMASLHSKELT++P
Sbjct: 186 IWPAEDALRRGMLAMASLHSKELTKLP 212

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  241 bits (616), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 111/171 (64%), Positives = 140/171 (81%)

Query: 38  SKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNL 97
           S+V++Y D+C YE+ LGKLV SVD+FKP+L++A++LI+TD+ LF  ++    YDKID  L
Sbjct: 45  SRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGRL 104

Query: 98  RKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYA 157
             ++K S+E+D KT KILE+LN CH +L++LP LEQV  E+ T+L+QR KI S  LLDYA
Sbjct: 105 NDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDYA 164

Query: 158 TKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPG 208
            KL+KFTR+PPTFDKG VGPNNFIWPAEDA+RRGMLAMASL SKELTRIPG
Sbjct: 165 MKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPG 215

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  242 bits (618), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 175/251 (69%), Gaps = 14/251 (5%)

Query: 14  NQIRSSSVSLVAEA-------TSSMNSEHKS-------SKVQLYEDLCRYEDILGKLVES 59
           N +R+SSVSL+AEA       +S  N  + +       S+V++Y+D+  YE  L +L++S
Sbjct: 39  NHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLIDS 98

Query: 60  VDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILN 119
           VD+FKPNL IA++LI+ D+SLF+ +     YD+IDL+L+ ++  + ++D  T+  L+ LN
Sbjct: 99  VDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQTLN 158

Query: 120 ECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNN 179
           ECHD+L+ LP L Q+EFE  TIL QR+KINST LLDYATKLSKFT+IPPTFDKG++GPNN
Sbjct: 159 ECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGPNN 218

Query: 180 FIWPAEDALRRGMLAMASLHSKELTRIPGXXXXXXXXVPTDTLSQPQKEKKESSENSPQN 239
           FIWPAED+LRRGMLAMASL + +LT IPG            T  Q  +E+ ++ +   + 
Sbjct: 219 FIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSKEKALPTEVQETQEQTQTQQQDQEE 278

Query: 240 SPTKDSFIFNG 250
            P ++SF+F+G
Sbjct: 279 QPRRESFVFSG 289

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  227 bits (578), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 156/239 (65%), Gaps = 6/239 (2%)

Query: 16  IRSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIK 75
           + +SSV    E     N+E + SK Q+Y D+C +E+ LGKLV SVD+F P+L+IA+ LI+
Sbjct: 1   MSTSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIE 60

Query: 76  TDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVE 135
            D+ L   ++ L  YD+IDL  +++D+   E D +  +ILE L EC  +L+ALPMLEQVE
Sbjct: 61  VDKRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVE 120

Query: 136 FEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAM 195
           FE++T+L+QR K+ +  LLDYA KL+KFT +PPTFDKG VGPNNF+WPAEDA+RRGMLA+
Sbjct: 121 FERQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAI 180

Query: 196 ASLHSKELTRIPGXXXXXXXXVPTDTLSQPQKEKKESSENSPQNSPTKDSFIFNGIANK 254
           ASL + E  + P            +T  QPQ   +   E   Q    +DSF FNG   K
Sbjct: 181 ASLQASEDAKKP---ETGAAQTAEETTKQPQSSPQLKVEEPMQR---RDSFEFNGTGTK 233

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  227 bits (579), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 143/175 (81%)

Query: 34  EHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKI 93
           ++K   V +YEDLC+YE+ L +LV SVD+F+P+LE A++LI+ D  L++N+  L  YD I
Sbjct: 44  QNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLI 103

Query: 94  DLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTAL 153
           D  L+K++++S+++D +T KIL IL EC+++L++LPM+EQVEFE  T+ +Q+ K+NS+ L
Sbjct: 104 DSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVL 163

Query: 154 LDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPG 208
           L+YA KLSKFTR+PPTF+K  +GPNNFIWPAEDA+RRGMLAMASL SKELT +PG
Sbjct: 164 LEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPG 218

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  224 bits (571), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 135/171 (78%)

Query: 38  SKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNL 97
           SK+Q Y DL +YE+ L KL  SVD++KP+L+ A DLI  D  L++ +     YD+I   L
Sbjct: 38  SKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDEISTKL 97

Query: 98  RKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYA 157
           +K++ D++ LD KT+ +L+ LN+CH+ L+ LPMLEQVEFEK T+L+QR KINS  LLDYA
Sbjct: 98  KKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKVLLDYA 157

Query: 158 TKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPG 208
           TKL+KFT+IPPTF+K T+GPNNFIWPAEDALRRGMLA+AS H++ELT +PG
Sbjct: 158 TKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPG 208

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  222 bits (566), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 120/268 (44%), Positives = 168/268 (62%), Gaps = 26/268 (9%)

Query: 10  EFPMNQIRSSSVSLVAE--ATSSMNSEHKSS---------KVQLYEDLCRYEDILGKLVE 58
           +  +   +SSS+SL+ E  +TS  NS +  S         KV +Y DL +YE+ L +L++
Sbjct: 3   DLTLGHRKSSSLSLLGEPPSTSITNSNNIDSASGASPAITKVGIYSDLSQYEETLSRLIQ 62

Query: 59  SVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEIL 118
           S+D +KP+ +IA++LI  D  LFN++     YD+I   L+  +K  +E   KT++ILE L
Sbjct: 63  SIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILETL 122

Query: 119 NECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPN 178
           NECH+ L+ LP ++QV FE  T+L+QR KINS+ LLDYATKLSKFT+IPPTFDKG++GPN
Sbjct: 123 NECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIGPN 182

Query: 179 NFIWPAEDALRRGMLAMASLHSKELTRIPGXXXXXX--------XXVPTDTLSQPQKEKK 230
           NF+WPAEDALRRGMLA+A+ H+ ELT+I G                   D    P  EKK
Sbjct: 183 NFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDDNSIALDEIKSVDAGEGPIPEKK 242

Query: 231 ESSENSPQNSPTKDSFIFNGIANKDTDQ 258
           +SS         + S+IF G + K+ + 
Sbjct: 243 DSSSR-------RGSYIFAGQSGKNAEH 263

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  221 bits (562), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 99/169 (58%), Positives = 134/169 (79%)

Query: 34  EHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKI 93
           E+  SK+Q+Y D+C +ED LGKLV SVDRF P+LE+A+ LI+ D+ L+ +++ L  YD+I
Sbjct: 19  ENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEI 78

Query: 94  DLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTAL 153
           D   + +D++  + D KT +ILE L EC  +L+ALPMLEQVEFE++T+L+QR K+ +  L
Sbjct: 79  DTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVL 138

Query: 154 LDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKE 202
           LDYA KL+KFT +PPTFDKGTVGPNNF+WPAEDA+RRGMLA+ASL + E
Sbjct: 139 LDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASE 187

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  213 bits (541), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 146/193 (75%), Gaps = 3/193 (1%)

Query: 19  SSVSLVAEATSS-MNSEHKSS--KVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIK 75
           S+ + +++ T+S MN+    S   V +Y D+  YED L KLV S+D F+P++E+AK LI+
Sbjct: 36  STANNISQGTASNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIE 95

Query: 76  TDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVE 135
            D+ L+ N+    +YD+ID  + KI  DSE+LD +T+ IL+ILN+  + L++LPMLE++ 
Sbjct: 96  VDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIY 155

Query: 136 FEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAM 195
           FE+  + +++ KINS  LLDYATK+SKFT+IPPTF+KG++GPNNFIWPAEDALRRGMLA+
Sbjct: 156 FERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAV 215

Query: 196 ASLHSKELTRIPG 208
           AS+H  ELT++P 
Sbjct: 216 ASIHRSELTKLPN 228

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  204 bits (519), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 111/219 (50%), Positives = 156/219 (71%), Gaps = 6/219 (2%)

Query: 39  KVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLR 98
           +V LY+DLC++E+ L KLV SVD+F P+L+ A+DLI +D  L++ ++ L  YD ID+ L+
Sbjct: 24  QVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQLK 83

Query: 99  KIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYAT 158
           ++D +S+E+D +T KIL IL++C++ L+ LPM+EQVEFE K + +Q+ KI S  LL+YA 
Sbjct: 84  QLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSGVLLEYAM 143

Query: 159 KLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPGXXXXXXXXVP 218
           KL+KFTR+PPTF+K  +GPNNFIWPAEDA+RRGMLAMASL S+ELTRIP          P
Sbjct: 144 KLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEEPQEP 203

Query: 219 TDTLSQPQKEKKES---SENSPQNSP--TKDSFIFNGIA 252
                Q Q+E + +   S ++P + P    +SF F G A
Sbjct: 204 PQK-GQSQEEDEVTPTHSSDTPSSKPDSKSESFEFTGKA 241

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  200 bits (508), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 127/164 (77%), Gaps = 3/164 (1%)

Query: 41  QLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKI 100
           Q+Y DL RYE+ LG+LVESVD+F+P+L  A++L++ D +L  ++     YD++D  L+++
Sbjct: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62

Query: 101 DKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKL 160
           D++SE L+  T + LE L+EC+  LSALPMLEQV+FE++ +L+QR ++NS  LL+YATKL
Sbjct: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122

Query: 161 SKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELT 204
           SKFT+ P       VGPNNF+WPAEDALRRG LA+A+LHS+E+T
Sbjct: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  200 bits (509), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 138/189 (73%), Gaps = 3/189 (1%)

Query: 18  SSSVSLVAEATSSMNSEHKSSKVQ---LYEDLCRYEDILGKLVESVDRFKPNLEIAKDLI 74
           S+SV+ +  +      E  S ++Q   +Y+DL RYE+ + +L +SVD FKP+L +   +I
Sbjct: 10  STSVATLPFSAQDKTQEQVSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVI 69

Query: 75  KTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQV 134
           + D+ L+  ++   +Y KI+  L ++DK+ + +D+KTR+ILE LN C++ L+ LPMLEQV
Sbjct: 70  ECDKKLYETLEEFDEYYKIEEELSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQV 129

Query: 135 EFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLA 194
           EFE+K +L+QR KI+S  +LDYA KL+KFTR PPTFDK  +GPNNFIWPAED+LR+GMLA
Sbjct: 130 EFEQKVMLKQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLA 189

Query: 195 MASLHSKEL 203
           MASL  KEL
Sbjct: 190 MASLKKKEL 198

>KNAG0E02480 Chr5 (492142..493623) [1482 bp, 493 aa] {ON} Anc_2.467
           YMR094W
          Length = 493

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 9/83 (10%)

Query: 129 PMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDAL 188
           P LE  E++ + I+   + +  ++ L Y   +    R+  + D G +GP ++I+  ED L
Sbjct: 66  PYLEMFEYDPELIV---TWLQYSSWLRYDAVILDCLRLNHSLDAGIMGPFDWIYMGEDTL 122

Query: 189 ------RRGMLAMASLHSKELTR 205
                 R G L        E TR
Sbjct: 123 KIGYFQRTGFLLQVWYSKLEYTR 145

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 59/121 (48%), Gaps = 12/121 (9%)

Query: 15   QIRSSSVSLVAEATSSMNSEHKSSKVQLYE---DLCRYEDILGKLVESVDRFKPNLEIAK 71
            Q++ S V  + +  S    + K  K  + +   DL RYE   G+L   +D+    LE  K
Sbjct: 946  QLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNELESIK 1005

Query: 72   DLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALPML 131
            +LI + ++     K+L    +++ ++ K+ K+ EE++ K R+I  ++ E   E     + 
Sbjct: 1006 ELISSSDN-----KIL----ELEASIDKLQKEGEEIEEKVREIERLIEEKSSEGQDFAVF 1056

Query: 132  E 132
            E
Sbjct: 1057 E 1057

>Suva_13.199 Chr13 complement(322643..325165) [2523 bp, 840 aa] {ON}
           YMR031C (REAL)
          Length = 840

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 13/79 (16%)

Query: 92  KIDLNLRKIDKDSEELDSKTRKILE-ILNECHDELSALPMLEQVEFEKKTILQQRSKINS 150
           ++D +L +  KD E+  S  RK  E +L   H++L      E  E E  T+L++R  IN+
Sbjct: 520 RLDQDLEEWGKDCEQDISNARKEQEELLKPYHEDL------ENAEKEHTTLLEERDAINT 573

Query: 151 ------TALLDYATKLSKF 163
                  A++D+ TK+S +
Sbjct: 574 EISRLQGAIVDHKTKISNY 592

>KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.140
           YGL179C
          Length = 896

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 70/150 (46%), Gaps = 36/150 (24%)

Query: 4   QDTKAVEFPMNQ--IRSSSVSLVAEATSSMNSEHKSSKVQLYED-------LCRYEDILG 54
           Q  + +  P++Q  +RS+S +  A +TSS N   +++++ L  D       L  YE I+G
Sbjct: 96  QRLRQLNHPLHQQHLRSTSTNGSASSTSSKNKVKETNQISLTYDPVSKRKVLNTYE-IIG 154

Query: 55  KLVESVDRFKPNLEIAKDLIKTD--------------ESLFNNVKLLADYDKI------- 93
           +L          +++AKDL+  D              +SLF + K +A  DKI       
Sbjct: 155 ELGHGQ---HGKVKLAKDLLTNDLVAIKIVDRHENSSKSLFLSNKKIASNDKIKKEIAIM 211

Query: 94  -DLNLRKIDKDSEELDS-KTRKILEILNEC 121
             L+ + + K  E LD  K+RKI  +L  C
Sbjct: 212 KKLHHKHVVKLIEVLDDLKSRKIYLVLEYC 241

>KNAG0H01190 Chr8 complement(201945..202601) [657 bp, 218 aa] {ON}
           Anc_3.278 YDR041W
          Length = 218

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 9/95 (9%)

Query: 25  AEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNV 84
           A+A S  N E  + K      L R  D   +++E +  +     +A   +K +  +F   
Sbjct: 127 AQAKSKENFERSTHK-----RLLRVWDTNSEVLEMLLAYITKHSVAGVGMKCN--VFKRE 179

Query: 85  KLLADYDKIDLNLRKIDKDSEELDSKTRKILEILN 119
            L AD+D +DL   + D D+ E D   RKI+E+LN
Sbjct: 180 PLKADFDSVDLP--QHDTDAVENDLVNRKIMELLN 212

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
           YFL033C (REAL)
          Length = 1760

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 90  YDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKIN 149
           +D +DL  +K+D     LD+     L+I NE ++ +  L + EQ+E  K TIL     I 
Sbjct: 402 HDTLDLARKKVDA-VLRLDNAMTYSLKIKNEVNNYVVQL-IREQIEINKHTILTHSMNIR 459

Query: 150 STALL 154
           S+++ 
Sbjct: 460 SSSIF 464

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 3/78 (3%)

Query: 110  KTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYA-TKLSKF--TRI 166
            K+R +LE+L+E  +EL +L   E+     ++ + Q  KI   A+L +    LSK+   R+
Sbjct: 1025 KSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYRKARV 1084

Query: 167  PPTFDKGTVGPNNFIWPA 184
             P    G +G  +   P 
Sbjct: 1085 EPGTAVGAIGAQSIGEPG 1102

>TBLA0F03840 Chr6 complement(950528..954298) [3771 bp, 1256 aa] {ON}
           Anc_8.235 YDR097C
          Length = 1256

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 13/98 (13%)

Query: 39  KVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADY-------- 90
           K++L+E + +  +++ +L+E +  F+    +   L +  ESLFN+VK  ++         
Sbjct: 732 KMKLFEKVIQGFEVIVELIEQLKSFELKGALKTFLSQVPESLFNDVKNWSNAFDRRKALE 791

Query: 91  -DKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSA 127
            D I+L+L        E D     IL I NE +D LS 
Sbjct: 792 EDIIELHLGV----EPEFDQSRECILSIENELNDILSG 825

>Ecym_6179 Chr6 complement(330143..333823) [3681 bp, 1226 aa] {ON}
           similar to Ashbya gossypii AFR002C
          Length = 1226

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 10/82 (12%)

Query: 63  FKPNLEIAKDLIKTDESLFNNVKLLADYDKIDL--NLRKIDKDSEELDSKTRKILEILNE 120
           + PN  I + ++   +S F +V L + Y  + L     K+  +S+EL   ++ ILEIL E
Sbjct: 793 YMPN-NIGEFIVYLKDSKFEHV-LFSVYKSLPLPAEYLKLRLESDELRDSSKSILEILKE 850

Query: 121 CHDELSALPMLEQVEFEKKTIL 142
           C      L +LE   FE++ +L
Sbjct: 851 C------LKLLENKPFERERVL 866

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,220,282
Number of extensions: 1131336
Number of successful extensions: 5251
Number of sequences better than 10.0: 179
Number of HSP's gapped: 5447
Number of HSP's successfully gapped: 180
Length of query: 287
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 179
Effective length of database: 41,097,471
Effective search space: 7356447309
Effective search space used: 7356447309
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)