Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_8.1915.476ON75875832190.0
Skud_15.3035.476ON74873625780.0
YOR140W (SFL1)5.476ON76673425090.0
Smik_15.3195.476ON76273824260.0
ZYRO0D11286g5.476ON7171454141e-41
NDAI0C013805.476ON7671504124e-41
NCAS0H022805.476ON6571434085e-41
TDEL0A034005.476ON8101454108e-41
KNAG0B040405.476ON8521533841e-37
Kwal_55.212545.476ON8531393761e-36
CAGL0I07183g5.476ON7711423724e-36
KLTH0F14982g5.476ON8281423628e-35
KLLA0E03191g5.476ON7701653573e-34
Ecym_23125.476ON7561393546e-34
AFR136C5.476ON6951423501e-33
SAKL0G03586g5.476ON8532783362e-31
TPHA0A052505.77ON6011491976e-15
Skud_7.2086.209ON836641889e-14
TDEL0G010105.77ON3981431822e-13
NDAI0D034304.385ON597801842e-13
Kpol_1062.85.77ON4331431823e-13
KAFR0B044105.77ON465711804e-13
KAFR0C022506.209ON613641815e-13
YGL073W (HSF1)6.209ON833641817e-13
Smik_7.2096.209ON837641791e-12
Suva_7.1976.209ON846641772e-12
KNAG0F020206.209ON771641762e-12
KLLA0A05368g5.77ON4121431732e-12
TDEL0E051706.209ON546641744e-12
Kpol_1033.466.209ON717641735e-12
ZYRO0G08734g6.209ON572651735e-12
Skud_8.2734.385ON623781735e-12
Suva_7.5445.77ON469681715e-12
TBLA0A020006.209ON627771735e-12
SAKL0A04576g6.209ON557641726e-12
KLLA0D03322g6.209ON677831719e-12
SAKL0H02354g5.77ON385711689e-12
Smik_16.585.77ON453681699e-12
YHR206W (SKN7)4.385ON622731701e-11
NCAS0A064504.385ON609711701e-11
Kwal_56.240366.209ON567641691e-11
NCAS0E038705.77ON393741671e-11
KLTH0H04290g6.209ON569641691e-11
Smik_8.2964.385ON625731682e-11
KNAG0M001804.385ON615711672e-11
YGR249W (MGA1)5.77ON456721662e-11
CAGL0F08195g5.77ON325741632e-11
TPHA0H011305.77ON439681653e-11
KNAG0K004705.77ON4141441653e-11
NCAS0D037806.209ON760641664e-11
NDAI0B009405.77ON526671654e-11
KAFR0B069904.385ON545641654e-11
TBLA0G02700singletonON445771644e-11
Skud_7.5825.77ON452681635e-11
Ecym_22086.209ON529641636e-11
KLTH0D17182g4.385ON464641628e-11
Suva_15.4124.385ON617641621e-10
ZYRO0C11506g5.77ON334681581e-10
CAGL0H03443g6.209ON706641621e-10
NDAI0I011106.209ON905641621e-10
AFL085C6.209ON569641611e-10
Kwal_47.167704.385ON461641591e-10
Kpol_265.24.385ON549691592e-10
SAKL0B12408g4.385ON465641573e-10
TDEL0D003204.385ON547641583e-10
CAGL0F09097g4.385ON630641583e-10
KLLA0A10219g4.385ON475641573e-10
KLTH0H00814g5.77ON3902851563e-10
TBLA0A107004.385ON587641573e-10
ADL388W4.385ON482731564e-10
TPHA0E028806.209ON718641565e-10
ZYRO0G00484g4.385ON647641548e-10
TPHA0C001504.385ON510641531e-09
Ecym_74744.385ON496731521e-09
AEL216C5.77ON4501461493e-09
TBLA0E049804.385ON791651494e-09
Ecym_55735.77ON572701476e-09
Kpol_1050.795.77ON433661261e-06
Suva_12.2414.385ON349701181e-05
Skud_10.3734.385ON346691134e-05
YJR147W (HMS2)4.385ON358701020.001
Smik_10.4424.385ON34763920.019
TPHA0L019802.639ON55637790.82
AGR381C2.315ON33581751.8
YNL122C2.151ON11573675.1
KNAG0J019108.704ON763118725.7
NCAS0E00690singletonON24794706.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_8.191
         (758 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W ...  1244   0.0  
Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140...   997   0.0  
YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}  SFL1Trans...   971   0.0  
Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140...   939   0.0  
ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some s...   164   1e-41
NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {O...   163   4e-41
NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476    161   5e-41
TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.4...   162   8e-41
KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {O...   152   1e-37
Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {...   149   1e-36
CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {...   147   4e-36
KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]...   144   8e-35
KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some s...   142   3e-34
Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}...   140   6e-34
AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON} S...   139   1e-33
SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some s...   134   2e-31
TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5...    80   6e-15
Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W ...    77   9e-14
TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {O...    75   2e-13
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     75   2e-13
Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON...    75   3e-13
KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.7...    74   4e-13
KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.2...    74   5e-13
YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimer...    74   7e-13
Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W ...    74   1e-12
Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W ...    73   2e-12
KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {O...    72   2e-12
KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {...    71   2e-12
TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.2...    72   4e-12
Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON} (1155...    71   5e-12
ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} simila...    71   5e-12
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    71   5e-12
Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W ...    70   5e-12
TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.2...    71   5e-12
SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {...    71   6e-12
KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {...    70   9e-12
SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {...    69   9e-12
Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {O...    70   9e-12
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    70   1e-11
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    70   1e-11
Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073...    70   1e-11
NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77      69   1e-11
KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {...    70   1e-11
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    69   2e-11
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    69   2e-11
YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protei...    69   2e-11
CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some si...    67   2e-11
TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.7...    68   3e-11
KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON...    68   3e-11
NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209     69   4e-11
NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {O...    68   4e-11
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    68   4e-11
TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON}               68   4e-11
Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W ...    67   5e-11
Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}...    67   6e-11
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    67   8e-11
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    67   1e-10
ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some s...    65   1e-10
CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly...    67   1e-10
NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {O...    67   1e-10
AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON} S...    67   1e-10
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    66   1e-10
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    66   2e-10
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    65   3e-10
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    65   3e-10
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    65   3e-10
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    65   3e-10
KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON...    65   3e-10
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    65   3e-10
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    65   4e-10
TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {O...    65   5e-10
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    64   8e-10
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    64   1e-09
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    63   1e-09
AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON} S...    62   3e-09
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    62   4e-09
Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar...    61   6e-09
Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON} (1714...    53   1e-06
Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147...    50   1e-05
Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147...    48   4e-05
YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Prote...    44   0.001
Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147...    40   0.019
TPHA0L01980 Chr12 (414853..416523) [1671 bp, 556 aa] {ON} Anc_2....    35   0.82 
AGR381C Chr7 complement(1435245..1436252) [1008 bp, 335 aa] {ON}...    33   1.8  
YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON} P...    30   5.1  
KNAG0J01910 Chr10 complement(346989..349280) [2292 bp, 763 aa] {...    32   5.7  
NCAS0E00690 Chr5 complement(124188..124931) [744 bp, 247 aa] {ON}      32   6.7  

>Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W
           (REAL)
          Length = 758

 Score = 1244 bits (3219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/758 (83%), Positives = 632/758 (83%)

Query: 1   MNEEEMASASGAFVATXXXXXXXXXXXXXXXXXEGSEVPEDVKKHGSKTLVGPRPPQNAI 60
           MNEEEMASASGAFVAT                 EGSEVPEDVKKHGSKTLVGPRPPQNAI
Sbjct: 1   MNEEEMASASGAFVATANANANANANANANANAEGSEVPEDVKKHGSKTLVGPRPPQNAI 60

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 120
           FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF
Sbjct: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 120

Query: 121 HKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNPTKIWEF 180
           HKVSHDH                          KNSSGDETTGAGAQEKEKSNPTKIWEF
Sbjct: 121 HKVSHDHTSNDTNSGDDGNTNDDANATDDNGGNKNSSGDETTGAGAQEKEKSNPTKIWEF 180

Query: 181 KHSSGIFKKGDIESLKHIKXXXXXXXXXXXXXXXXXXXXXYDIESTIRARPASIQDPVSA 240
           KHSSGIFKKGDIESLKHIK                     YDIESTIRARPASIQDPVSA
Sbjct: 181 KHSSGIFKKGDIESLKHIKRRASSRNNSSINSRKNSSNQNYDIESTIRARPASIQDPVSA 240

Query: 241 SSAFSNYVPQISGASSSIPECFSHVPYENANHGPLEFNNPDTQETSKPLSFQDETLTHLK 300
           SSAFSNYVPQISGASSSIPECFSHVPYENANHGPLEFNNPDTQETSKPLSFQDETLTHLK
Sbjct: 241 SSAFSNYVPQISGASSSIPECFSHVPYENANHGPLEFNNPDTQETSKPLSFQDETLTHLK 300

Query: 301 DINFDMIKIIESMQHFISLQHNFCSQSFTFKNVSKKKSENIIKDHQNQLKVFESDMLTFK 360
           DINFDMIKIIESMQHFISLQHNFCSQSFTFKNVSKKKSENIIKDHQNQLKVFESDMLTFK
Sbjct: 301 DINFDMIKIIESMQHFISLQHNFCSQSFTFKNVSKKKSENIIKDHQNQLKVFESDMLTFK 360

Query: 361 QHVMSRAHRTIDALHSTAAATATGPTLVPAHKSQYEIMVPPNNQFGPQKSSLSASIPSRF 420
           QHVMSRAHRTIDALHSTAAATATGPTLVPAHKSQYEIMVPPNNQFGPQKSSLSASIPSRF
Sbjct: 361 QHVMSRAHRTIDALHSTAAATATGPTLVPAHKSQYEIMVPPNNQFGPQKSSLSASIPSRF 420

Query: 421 NTSSVPPSQFFIQYXXXXXXXXXXXXXXXXXHMAYPKQPPHMQNFINXXXXXXXXXXXYA 480
           NTSSVPPSQFFIQY                 HMAYPKQPPHMQNFIN           YA
Sbjct: 421 NTSSVPPSQFFIQYQPQPQPQQQQQQQQQQQHMAYPKQPPHMQNFINQPIPIQQLPPQYA 480

Query: 481 ETFNTPQMMHNPFASKNSHKPGNTKRTNSVLMDPLTPAAQGPLNYPIMNVNPSARDYNKC 540
           ETFNTPQMMHNPFASKNSHKPGNTKRTNSVLMDPLTPAAQGPLNYPIMNVNPSARDYNKC
Sbjct: 481 ETFNTPQMMHNPFASKNSHKPGNTKRTNSVLMDPLTPAAQGPLNYPIMNVNPSARDYNKC 540

Query: 541 VPQNRAPSPIYPMNEPTTRLYSQPKMRTLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPK 600
           VPQNRAPSPIYPMNEPTTRLYSQPKMRTLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPK
Sbjct: 541 VPQNRAPSPIYPMNEPTTRLYSQPKMRTLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPK 600

Query: 601 PRNXXXXXXXXXXXXXXXXXXXNNPAPIRYSQQGLLRSLNKAANCAPDSATPLDPSLLAG 660
           PRN                   NNPAPIRYSQQGLLRSLNKAANCAPDSATPLDPSLLAG
Sbjct: 601 PRNSLKSSISGTSISSSFTLVSNNPAPIRYSQQGLLRSLNKAANCAPDSATPLDPSLLAG 660

Query: 661 PTPKNIDNLPIVSSNLINSPMNVEHGTSLSHPQPTPQMELPQPSLPTTNVTKGNDETDTI 720
           PTPKNIDNLPIVSSNLINSPMNVEHGTSLSHPQPTPQMELPQPSLPTTNVTKGNDETDTI
Sbjct: 661 PTPKNIDNLPIVSSNLINSPMNVEHGTSLSHPQPTPQMELPQPSLPTTNVTKGNDETDTI 720

Query: 721 RRTGSGVYSLLXXXXXXXXXXXXXXXGETTPASKKARL 758
           RRTGSGVYSLL               GETTPASKKARL
Sbjct: 721 RRTGSGVYSLLNKDDSSSANANSKAKGETTPASKKARL 758

>Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140W
           (REAL)
          Length = 748

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/736 (69%), Positives = 550/736 (74%), Gaps = 18/736 (2%)

Query: 34  EGSEVPEDVKKHGSKTLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVE 93
           EG +  EDVKKHGSK LVGPRPPQNAIFIHKLYQILEDDSLHDLIWWS SGLSFMIKPVE
Sbjct: 20  EGGDASEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVE 79

Query: 94  RFSKALATYFKHTNITSFVRQLNIYGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXX 153
           RFSKALATYFKHTNITSFVRQLNIYGFHKVSHDH                          
Sbjct: 80  RFSKALATYFKHTNITSFVRQLNIYGFHKVSHDHNSNEINSGDDANTNDVNSTNDDGGGS 139

Query: 154 KNSSGDETTGAGAQEKEK--SNPTKIWEFKHSSGIFKKGDIESLKHIKXXXXXXXXXXXX 211
           KNSSG+E  GA  QEKEK  SNPTKIWEFKHSSGIFKKGDIE LKHIK            
Sbjct: 140 KNSSGEENNGATVQEKEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIKRRASSRNNSSIN 199

Query: 212 XXXXXXXXXYDIESTIRARPASIQDPVSASSAFSNYVPQISGASSSIPECF--SHVPYEN 269
                    YD +S +RARP+SIQDP + S+ F NYVPQISGA++ IPECF  SHVPYEN
Sbjct: 200 SRKNSSNQNYDADSGVRARPSSIQDPTATSNGFCNYVPQISGANNPIPECFNNSHVPYEN 259

Query: 270 ANHGPLEFNNPDTQETSKPLSFQDETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFT 329
           A HGP+EFNNP+TQE ++P SFQDETLTHLK+IN DMIKIIESMQHFISLQHNFCS+SFT
Sbjct: 260 ATHGPMEFNNPETQEQARPSSFQDETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFT 319

Query: 330 FKNVSKKKSENIIKDHQNQLKVFESDMLTFKQHVMSRAHRTIDALHSTAAATATGP---T 386
           FKNVSKKKSENI+KDHQ QLK FE+DMLTFKQHVMSRAHRT+D+LH+  A         +
Sbjct: 320 FKNVSKKKSENIMKDHQKQLKTFENDMLTFKQHVMSRAHRTMDSLHAATATATAPALASS 379

Query: 387 LVPAHKSQYEIMVPPNNQFGPQKSSLSASIPSRFNTSSVPPSQFFIQYXXXXXXXXXXXX 446
              A KSQY++MVPP NQ+ PQKSS S +IPSRFNTSSVPPSQFF+Q             
Sbjct: 380 SACAPKSQYDMMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQFFVQ-------YQPQPQ 432

Query: 447 XXXXXHMAYPKQPPHMQNFINXXXXXXXXXXXYAETFNTPQMMHNPFASKNSHKPGNTKR 506
                HMAY KQP HM NFIN           YA+TFNTPQMMHNPFASKN HKPGNTKR
Sbjct: 433 LQPQQHMAYSKQPAHMPNFINQPIPIQQLPPQYADTFNTPQMMHNPFASKNGHKPGNTKR 492

Query: 507 TNSVLMDPLTPAA----QGPLNYPIMNVNPSARDYNKCVPQNRAPSPIYPMNEPTTRLYS 562
           TNSVLMDPLTPA     QG LNYPIMN+NP+ RDYNK VPQN APSPIYP+NEPTTR+YS
Sbjct: 493 TNSVLMDPLTPATSVGIQGTLNYPIMNINPTVRDYNKSVPQNMAPSPIYPINEPTTRMYS 552

Query: 563 QPKMRTLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRNXXXXXXXXXXXXXXXXXXX 622
           QPKMR+LGSTSSLPNDRRNSPLKLTPRSSLNEDSLY KP+N                   
Sbjct: 553 QPKMRSLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYSKPKNSLKSSISGTSLSSSFTLVS 612

Query: 623 NNPAPIRYSQQGLLRSLNKAANCAPDSATPLDPSLLAGPTPKNIDNLPIVSSNLINSPMN 682
           NNPAPIRYSQQGLLRSLNKAANC PDS  PLD ++L GPTPKN+DNLP +SSNLINSPMN
Sbjct: 613 NNPAPIRYSQQGLLRSLNKAANCPPDSVIPLDSTVLTGPTPKNMDNLPAISSNLINSPMN 672

Query: 683 VEHGTSLSHPQPTPQMELPQPSLPTTNVTKGNDETDTIRRTGSGVYSLLXXXXXXXXXXX 742
           VEHGTSLSHP+PTP +ELPQPSLPTTN TK  DETD  +R+GSGVYSLL           
Sbjct: 673 VEHGTSLSHPEPTPGIELPQPSLPTTNATKKIDETDNTKRSGSGVYSLLNQEESRSSNAD 732

Query: 743 XXXXGETTPASKKARL 758
                ET P SKK R+
Sbjct: 733 PRAKEETAPPSKKVRM 748

>YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}
           SFL1Transcriptional repressor and activator; involved in
           repression of flocculation-related genes, and activation
           of stress responsive genes; negatively regulated by
           cAMP-dependent protein kinase A subunit Tpk2p
          Length = 766

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/734 (67%), Positives = 544/734 (74%), Gaps = 26/734 (3%)

Query: 40  EDVKKHGSKTLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKAL 99
           EDVKKHGSK LVGPRPPQNAIFIHKLYQILED+SLHDLIWW+PSGLSFMIKPVERFSKAL
Sbjct: 44  EDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKAL 103

Query: 100 ATYFKHTNITSFVRQLNIYGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGD 159
           ATYFKHTNITSFVRQLNIYGFHKVSHDH                          KNSSGD
Sbjct: 104 ATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDANSGDDANTNDDSNTHDDNSGNKNSSGD 163

Query: 160 ETTGAGAQEKEKSNPTKIWEFKHSSGIFKKGDIESLKHIKXXXXXXXXXXXXXXXXXXXX 219
           E TG G QEKEKSNPTKIWEFKHSSGIFKKGDIE LKHIK                    
Sbjct: 164 ENTGGGVQEKEKSNPTKIWEFKHSSGIFKKGDIEGLKHIKRRASSRNNSSINSRKNSSNQ 223

Query: 220 XYDIESTIRARPASIQDPVSASSAFSNYVPQISGASSSIPECF--SHVPYENANHGPLEF 277
            YDI+S  R RP+SIQDP ++S++F N+VPQI GA++SIPE F  SHV YENANH PLE 
Sbjct: 224 NYDIDSGARVRPSSIQDPSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANHAPLES 283

Query: 278 NNPDTQETSKPLSFQDETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFTFKNVSKKK 337
           NNP+ QE ++P +FQDETL HLK+INFDM+KIIESMQHFISLQH+FCSQSFTFKNVSKKK
Sbjct: 284 NNPEMQEQNRPPNFQDETLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKK 343

Query: 338 SENIIKDHQNQLKVFESDMLTFKQHVMSRAHRTIDAL---------HSTAAATATGPTLV 388
           SENI+KDHQ QL+ FESDMLTFKQHVMSRAHRTID+L          S A A A   T  
Sbjct: 344 SENIVKDHQKQLQAFESDMLTFKQHVMSRAHRTIDSLCAVNAAATAASVAPAPAPTSTSA 403

Query: 389 PAHKSQYEIMVPPNNQFGPQKSSLSASIPSRFNTSSVPPSQFFIQYXXXXXXXXXXXXXX 448
            A KSQYE+MVPP NQ+ PQKSS + +IPSRFNT+SVPPSQ F+QY              
Sbjct: 404 YAPKSQYEMMVPPGNQYVPQKSSSTTNIPSRFNTASVPPSQLFVQY-----------QPQ 452

Query: 449 XXXHMAYPKQPPHMQNFINXXXXXXXXXXXYAETFNTPQMMHNPFASKNSHKPGNTKRTN 508
              H+ Y KQP H+ NFIN           YA+TF+TPQMMHNPFASKN++KPGNTKRTN
Sbjct: 453 SQQHVTYAKQPAHVPNFINQPIPIQQLPPQYADTFSTPQMMHNPFASKNNNKPGNTKRTN 512

Query: 509 SVLMDPLTPAA----QGPLNYPIMNVNPSARDYNKCVPQNRAPSPIYPMNEPTTRLYSQP 564
           SVLMDPLTPAA    QGPLNYPIMN+NPS RDYNK VPQN APSPIYP+NEPTTRLYSQP
Sbjct: 513 SVLMDPLTPAASVGVQGPLNYPIMNINPSVRDYNKPVPQNMAPSPIYPINEPTTRLYSQP 572

Query: 565 KMRTLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRNXXXXXXXXXXXXXXXXXXXNN 624
           KMR+LGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRN                   NN
Sbjct: 573 KMRSLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRNSLKSSISGTSLSSSFTLVANN 632

Query: 625 PAPIRYSQQGLLRSLNKAANCAPDSATPLDPSLLAGPTPKNIDNLPIVSSNLINSPMNVE 684
           PAPIRYSQQGLLRSLNKAANCAPDS TPLD S+L GP PKN+DNLP VSSNLINSPMNVE
Sbjct: 633 PAPIRYSQQGLLRSLNKAANCAPDSVTPLDSSVLTGPPPKNMDNLPAVSSNLINSPMNVE 692

Query: 685 HGTSLSHPQPTPQMELPQPSLPTTNVTKGNDETDTIRRTGSGVYSLLXXXXXXXXXXXXX 744
           H +SLS  +P PQ+ELPQPSLPTT+ TK   E D  +R GSGVYSLL             
Sbjct: 693 HSSSLSQAEPAPQIELPQPSLPTTSTTKNTGEADNSKRKGSGVYSLLNQEDSSTSSADPK 752

Query: 745 XXGETTPASKKARL 758
              +  PA KK ++
Sbjct: 753 TEDKAAPALKKVKM 766

>Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140W
           (REAL)
          Length = 762

 Score =  939 bits (2426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/738 (64%), Positives = 533/738 (72%), Gaps = 26/738 (3%)

Query: 34  EGSEVPEDVKKHGSKTLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVE 93
           EGS+V EDVKKHGSK LVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVE
Sbjct: 38  EGSDVSEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVE 97

Query: 94  RFSKALATYFKHTNITSFVRQLNIYGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXX 153
           RFSKALATYFKHTNITSFVRQLNIYGFHKVSHDH                          
Sbjct: 98  RFSKALATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDTNGGDEANTNDDSSGN------ 151

Query: 154 KNSSGDETTGAGAQEKEKSNPTKIWEFKHSSGIFKKGDIESLKHIKXXXXXXXXXXXXXX 213
           KN+SGDE  G   QEKE+SNPTKIWEFKHSSGIFKKGDIE LKHIK              
Sbjct: 152 KNTSGDENNGVSVQEKERSNPTKIWEFKHSSGIFKKGDIEGLKHIKRRASSRNSSSINSR 211

Query: 214 XXXXXXXYDIESTIRARPASIQDPVSASSAFSNYVPQISGASSSIPECF--SHVPYENAN 271
                  YD +S +RARP+S+QDP ++SSAF N+VPQI  A+++IPECF  SHV YEN +
Sbjct: 212 KNSSNQNYDTDSGVRARPSSVQDPSTSSSAFGNFVPQIPSANNTIPECFNNSHVTYENLS 271

Query: 272 HGPLEFNNPDTQETSKPLSFQDETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFTFK 331
           HG LE+NNPD QE SKP SFQDE L HLKDIN DM+KIIESMQHFISLQH+FCSQSFTFK
Sbjct: 272 HGALEYNNPDMQEQSKPPSFQDEALKHLKDINVDMVKIIESMQHFISLQHSFCSQSFTFK 331

Query: 332 NVSKKKSENIIKDHQNQLKVFESDMLTFKQHVMSRAHRTIDALHSTAAATATGPTLVP-- 389
           NVSKKKSENI+K+HQ QLK FE+DMLTFKQHVMSRAHRTID+L++  +            
Sbjct: 332 NVSKKKSENIVKEHQKQLKAFENDMLTFKQHVMSRAHRTIDSLYAINSNAIATAPAPAPA 391

Query: 390 -----AHKSQYEIMVPPNNQFGPQKSSLSASIPSRFNTSSVPPSQFFIQYXXXXXXXXXX 444
                A KSQY++MVPP NQ+ PQKSS S +IPSRFNTSSVPPSQ F+Q           
Sbjct: 392 SISAYAPKSQYDVMVPPGNQYVPQKSSSSTNIPSRFNTSSVPPSQLFVQ-------YQSQ 444

Query: 445 XXXXXXXHMAYPKQPPHMQNFINXXXXXXXXXXXYAETFNTPQMMHNPFASKNSHKPGNT 504
                  +M Y KQP HM NF++           YA+TF+TPQMMHNPFASKN++KPGNT
Sbjct: 445 PQAQPQQYMTYAKQPTHMPNFVHQPIPIQQLPPQYADTFSTPQMMHNPFASKNTNKPGNT 504

Query: 505 KRTNSVLMDPLTPAA----QGPLNYPIMNVNPSARDYNKCVPQNRAPSPIYPMNEPTTRL 560
           +RTNSVLMDPLTPAA    Q PLNYPIMN+NP  RDYNK VPQN APSPIYP+NEPTTRL
Sbjct: 505 RRTNSVLMDPLTPAASVGVQAPLNYPIMNINPPGRDYNKSVPQNMAPSPIYPINEPTTRL 564

Query: 561 YSQPKMRTLGSTSSLPNDRRNSPLKLTPRSSLNEDSLYPKPRNXXXXXXXXXXXXXXXXX 620
           YSQPKMR+LGSTSSLPNDR+NSPLKLTPR SLNEDSLYPKPRN                 
Sbjct: 565 YSQPKMRSLGSTSSLPNDRKNSPLKLTPRPSLNEDSLYPKPRNSLKSSTSGTSLSSSLTL 624

Query: 621 XXNNPAPIRYSQQGLLRSLNKAANCAPDSATPLDPSLLAGPTPKNIDNLPIVSSNLINSP 680
             NNPAPIRYSQQGLLRSL+KAANCAPD  TPLD S+L GP PKN+DNLP VSSNLINSP
Sbjct: 625 VANNPAPIRYSQQGLLRSLSKAANCAPDPTTPLDSSVLTGPIPKNMDNLPAVSSNLINSP 684

Query: 681 MNVEHGTSLSHPQPTPQMELPQPSLPTTNVTKGNDETDTIRRTGSGVYSLLXXXXXXXXX 740
           MNV+HG+S+SH +    +E+PQPS   T   K  DE D  +R GS VYSLL         
Sbjct: 685 MNVDHGSSISHAESISSIEVPQPSFSATVAAKETDEADNSKRNGSAVYSLLNREDNGASS 744

Query: 741 XXXXXXGETTPASKKARL 758
                  + TP  KK ++
Sbjct: 745 TDFKTEEKATPVLKKVKM 762

>ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 717

 Score =  164 bits (414), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 97/145 (66%), Gaps = 14/145 (9%)

Query: 55  PPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 114
           P Q+ +FIHKLY ILEDD L DLIWWSPSGLSF+I+P+E+FS+ALATYFKHTNI SFVRQ
Sbjct: 73  PLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQ 132

Query: 115 LNIYGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNP 174
           LN+YGFHKVS+DH                           +S  +  + A  QE      
Sbjct: 133 LNMYGFHKVSNDH---------GKSSEHDSASNSRTNNSNSSDNNNNSNADVQED----- 178

Query: 175 TKIWEFKHSSGIFKKGDIESLKHIK 199
            KIW+F+HS+G+FK+GDIE LK+IK
Sbjct: 179 IKIWKFRHSTGLFKRGDIEGLKYIK 203

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 86/242 (35%), Gaps = 83/242 (34%)

Query: 293 DETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFTFKNVSKKKSENIIKDHQNQLKVF 352
           DE L +LK +N DM+ ++E ++  +++Q             S + S         +    
Sbjct: 385 DEALGYLKGVNMDMVHVLELLESLVTIQ------------TSSEPSP-------QEFSGL 425

Query: 353 ESDMLTFKQHVMSRAHRTIDALHSTAAATATGPTLVPAHKSQYEIMVPPNNQFGPQKSSL 412
           E ++L FK  +MSR HR  DA                      ++  P    FG  +   
Sbjct: 426 EQELLRFKALLMSRVHRNSDA----------------------QVQQPSQRSFGENRPLS 463

Query: 413 SASIPSRFNTSSVPPSQFFIQYXXXXXXXXXXXXXXXXXHMAYPKQPPHMQNFINXXXXX 472
           S S+P+    S+VP     +Q+                   A P +P    N +      
Sbjct: 464 SISVPTSH--SNVPS---LVQHV-----------------FAVPARPSSAVNVVQPASTT 501

Query: 473 XXXXX---------------XYAETFNTPQ-MMHNPFASKNSHKPGNTKRTNSVLMDPLT 516
                                  + F+ P+ MM NPF S  +     +KR  S+LMDPL 
Sbjct: 502 GSASSAPVPAPTPAPPPPPPQATDHFSGPRMMMMNPFESTGN----GSKRNMSILMDPLA 557

Query: 517 PA 518
           PA
Sbjct: 558 PA 559

>NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {ON}
           Anc_5.476
          Length = 767

 Score =  163 bits (412), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 85/150 (56%), Positives = 94/150 (62%), Gaps = 31/150 (20%)

Query: 58  NAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 117
           N IFIHKLY ILED  L DLIWWS  G SF+I+P ERFSKALATYFKHTNITSFVRQLNI
Sbjct: 77  NTIFIHKLYNILEDKDLEDLIWWSNDGKSFLIRPTERFSKALATYFKHTNITSFVRQLNI 136

Query: 118 YGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETT---GAGAQEKEKSNP 174
           YGFHKVS+DH                           N + D+TT      A     +N 
Sbjct: 137 YGFHKVSNDH-----------------------QYINNKTEDDTTTNVTNHANTDVNNNI 173

Query: 175 T-----KIWEFKHSSGIFKKGDIESLKHIK 199
           T     KIWEFKHS+GIF+KGD+ESLK IK
Sbjct: 174 TDNEQVKIWEFKHSAGIFRKGDVESLKLIK 203

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 59/113 (52%), Gaps = 14/113 (12%)

Query: 267 YENANHGPLEFNNPDTQETSKPLSFQDETLTHLKDINFDMIKIIESMQHFISLQHNFCSQ 326
           Y N + G   +  PD Q T + +   ++T+   K  N DMIK+I+ MQ F+SL +   + 
Sbjct: 344 YTNTDQG---YEQPDPQYTHESV---EQTM---KAANMDMIKLIDYMQKFVSLLNKNTNG 394

Query: 327 SFTFKNVSKKKSENIIKDHQNQLKVFESDMLTFKQHVMSRAHRTIDALHSTAA 379
             +  ++     +N +K    Q   F+S++  FK+ ++SR    I+A++  ++
Sbjct: 395 IISEPSIGTSLKDNEMKQ---QWDEFQSEITNFKRSILSRLQ--INAMYEQSS 442

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 487 QMMHNPFASKNSHKPGNTKRTNSVLMDPLTPA 518
           QMM NPF S N+    ++KR  SVL+DPLTP 
Sbjct: 557 QMMQNPFNS-NASSRYSSKRHRSVLLDPLTPV 587

>NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476
          Length = 657

 Score =  161 bits (408), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 94/143 (65%), Gaps = 21/143 (14%)

Query: 58  NAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 117
           N IFIHKLY ILED  L DLIWWS SG SF IKP E+FSKALATYFKHTNITSFVRQLNI
Sbjct: 47  NTIFIHKLYNILEDKDLEDLIWWSSSGQSFFIKPTEKFSKALATYFKHTNITSFVRQLNI 106

Query: 118 YGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNPT-K 176
           YGFHKVS+DH                            ++ ++    G + ++ +N T K
Sbjct: 107 YGFHKVSNDHQYINYPNN--------------------NNSNDNDSKGKEREDLTNETIK 146

Query: 177 IWEFKHSSGIFKKGDIESLKHIK 199
           IWEFKHS+GIFKKGD+E LK IK
Sbjct: 147 IWEFKHSAGIFKKGDVEGLKLIK 169

 Score = 38.1 bits (87), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 16/106 (15%)

Query: 271 NHGPLEFNNPDTQETSKPLSFQDETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFTF 330
           N  P ++N  D  E+S    F    +  L+ IN DM K+I  M++F++L  +    S  +
Sbjct: 284 NMSPNQYNEED--ESSTHGKFSVSEIDDLRSINQDMAKLIGFMEYFVTLHLD----SGKY 337

Query: 331 KNVSKKKSENIIKDHQNQ-LKVFESDMLTFKQHVMSRAHRTIDALH 375
           K         I  D Q Q  + F++++  FK +V+ R H  + A H
Sbjct: 338 K---------IDDDPQKQNWENFQNELANFKNNVIKRLHTKLGASH 374

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 50/115 (43%), Gaps = 12/115 (10%)

Query: 487 QMMHNPFASKNSHKPGNTKRTNSVLMDPLTPAAQGPLNYPIMNVNPSARDYNKCVPQNRA 546
           Q+M NPF   N+    +TKR  SVL+DPLTP      N P+ N   S       +     
Sbjct: 478 QIMQNPFERTNNSI--STKRNQSVLLDPLTPVVSVSSNNPMRNRVSS------LINTKTQ 529

Query: 547 PSPIYPMNEPTTRLYSQPKMRTLGSTSSLP----NDRRNSPLKLTPRSSLNEDSL 597
           P PI   +     + +   M+T   +S  P    N   + P  L P +S  +DS+
Sbjct: 530 PCPIESASNTPMHVSNHDLMKTRSQSSLYPNLPLNKLEDLPSNLAPITSTAKDSI 584

>TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.476
           YOR140W
          Length = 810

 Score =  162 bits (410), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 91/145 (62%), Gaps = 26/145 (17%)

Query: 55  PPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 114
           P QN +FIHKLY ILEDD L DLIWWSPSG SF+I+P ERFS+ALATYFKHTNI SFVRQ
Sbjct: 46  PLQNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQ 105

Query: 115 LNIYGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNP 174
           LN+YGFHKVS+DH                                 ++ AG       + 
Sbjct: 106 LNMYGFHKVSNDHNKGIQQQQQQQQP--------------------SSEAG------QDG 139

Query: 175 TKIWEFKHSSGIFKKGDIESLKHIK 199
            KIWEF+HS GIFK+GDIE LK IK
Sbjct: 140 VKIWEFRHSMGIFKRGDIEGLKFIK 164

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 47/82 (57%), Gaps = 2/82 (2%)

Query: 293 DETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFTFKNVSKKKSE-NIIKDHQNQLKV 351
           DE L  L+ +N DM+K+++ +Q F++LQ    S+ +   ++    S+ +  + HQ ++  
Sbjct: 309 DELLEQLRVLNTDMVKLLDFLQKFVTLQ-KLSSEVYHEASLKDDPSKLHQFQKHQQEMSY 367

Query: 352 FESDMLTFKQHVMSRAHRTIDA 373
            E ++L FK ++M R  + + +
Sbjct: 368 LEQEILRFKANLMQRLTKKLGS 389

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 41/91 (45%), Gaps = 16/91 (17%)

Query: 483 FNTPQMMHNPFASKNSHKPGNTKRTNSVLMDPLT--PAAQGPLNYPIMNVNPSARDYNKC 540
           F  P+MM NPF +  + +  + KR  S+LMDPL+  P   GP      N +PS    N  
Sbjct: 533 FAGPRMMMNPFET--TGQTSSVKRNMSILMDPLSSAPHYSGP-----QNSSPSRHPGNLG 585

Query: 541 VPQNRAPSPIY-------PMNEPTTRLYSQP 564
               R PSP+          NEP     SQP
Sbjct: 586 SQIPRNPSPLVNSCKPPKQENEPPANEVSQP 616

>KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {ON}
           Anc_5.476 YOR140W
          Length = 852

 Score =  152 bits (384), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 92/153 (60%), Gaps = 14/153 (9%)

Query: 57  QNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLN 116
           QN +FIHKLY ILEDD+L DLIWW+P+G+SF I+P E FSK LATYFKHTNITSFVRQLN
Sbjct: 61  QNTVFIHKLYHILEDDALRDLIWWAPNGMSFYIRPNETFSKTLATYFKHTNITSFVRQLN 120

Query: 117 IYGFHKVSHDHXXXXXXXXXXXXXXXXXXX----------XXXXXXXKNSSGDETTGAGA 166
           IYGFHKV++ +                                      S     +G GA
Sbjct: 121 IYGFHKVTNWNDTAAFAAVSNDGRNNSLGALPGGPDMNTHSPSTGVVVKSEPHTKSGPGA 180

Query: 167 QEKEKSNPTKIWEFKHSSGIFKKGDIESLKHIK 199
                S+P KIWEFKHS+ +F++GDIE LK IK
Sbjct: 181 ----TSSPVKIWEFKHSANLFRRGDIEGLKFIK 209

>Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {ON}
           YOR140W (SFL1) - 1:1 [contig 130] FULL
          Length = 853

 Score =  149 bits (376), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 72/139 (51%), Positives = 88/139 (63%), Gaps = 19/139 (13%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 120
           FIHKLY +LED+ +H+LIWWSPS  SF+I+P ERFSKALATYFKHTN+ SFVRQLN+YGF
Sbjct: 60  FIHKLYSMLEDEEMHELIWWSPSQTSFLIRPTERFSKALATYFKHTNVASFVRQLNMYGF 119

Query: 121 HKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNPTKIWEF 180
           HKV+ DH                             +G +T G     +   N T +WEF
Sbjct: 120 HKVN-DHKAHGAKSGAANKG--------------EEAGLKTRGG----QPTDNSTSVWEF 160

Query: 181 KHSSGIFKKGDIESLKHIK 199
           KHSS  F++GD+ESLK IK
Sbjct: 161 KHSSAAFRRGDMESLKLIK 179

>CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {ON}
           some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140w SFL1
          Length = 771

 Score =  147 bits (372), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 72/142 (50%), Positives = 88/142 (61%), Gaps = 18/142 (12%)

Query: 58  NAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 117
           N +FI+KLY +LE+  L DLIWW+ +G SF+I+P E FS+ LA YFKHTNITSFVRQLNI
Sbjct: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67

Query: 118 YGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNPTKI 177
           YGFHK+S+DH                          + SS D  TG         N  K+
Sbjct: 68  YGFHKISNDH-----------------FHNLKREKKQKSSTDNNTGVSNNNSGDEN-IKV 109

Query: 178 WEFKHSSGIFKKGDIESLKHIK 199
           WEFKHS G+FKKGD+E+LK IK
Sbjct: 110 WEFKHSGGLFKKGDLENLKLIK 131

>KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]
           {ON} some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 828

 Score =  144 bits (362), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 72/142 (50%), Positives = 84/142 (59%), Gaps = 25/142 (17%)

Query: 58  NAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 117
           N  FIHKLY +LED  + +LIWWSP   SF+I+P ERF KALATYFKHTN+ SFVRQLN+
Sbjct: 71  NTAFIHKLYSMLEDPEMDELIWWSPPQTSFLIRPTERFGKALATYFKHTNVASFVRQLNM 130

Query: 118 YGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNPTKI 177
           YGFHKV +DH                          KN +      A   E    N T I
Sbjct: 131 YGFHKV-NDH--------------------KTHAASKNGAAKTDDPASKSE----NTTSI 165

Query: 178 WEFKHSSGIFKKGDIESLKHIK 199
           WEFKHSS  F++GD+ESLK IK
Sbjct: 166 WEFKHSSSAFRRGDMESLKLIK 187

>KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 770

 Score =  142 bits (357), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 92/165 (55%), Gaps = 33/165 (20%)

Query: 35  GSEVPEDVKKHGSKTLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVER 94
            +E   +VK     T+     PQN  FIHKLY +LEDD L +LIWWSPS  SF+I+P ER
Sbjct: 62  ATEGTSNVKSEVQPTVQNSSTPQNPHFIHKLYSMLEDDDLKNLIWWSPSCDSFLIRPTER 121

Query: 95  FSKALATYFKHTNITSFVRQLNIYGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXK 154
           FSKAL+ +FKHTN+ SFVRQLN+YGF KVS DH                           
Sbjct: 122 FSKALSAFFKHTNVASFVRQLNMYGFQKVS-DH--------------------------- 153

Query: 155 NSSGDETTGAGAQEKEKSNPTKIWEFKHSSGIFKKGDIESLKHIK 199
                ++T A   +        +WEFKHSSG F+KGD ESLK IK
Sbjct: 154 -----KSTWAANTDDSDEPSINLWEFKHSSGYFRKGDTESLKSIK 193

>Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}
           similar to Ashbya gossypii AFR136C
          Length = 756

 Score =  140 bits (354), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 84/139 (60%), Gaps = 26/139 (18%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 120
           FIHKLY +LED+ + DLIWWS S  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN+YGF
Sbjct: 73  FIHKLYSMLEDEEMKDLIWWSESENSFLIKPNEKFSKALATFFKHTNVASFVRQLNMYGF 132

Query: 121 HKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNPTKIWEF 180
           HKVS DH                           N    ET GA      + +   +WEF
Sbjct: 133 HKVS-DH-------------------------KSNEKSSETDGAHGNGDIEEDSINLWEF 166

Query: 181 KHSSGIFKKGDIESLKHIK 199
           +HS G F+KGD ESLK IK
Sbjct: 167 RHSLGCFRKGDKESLKSIK 185

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 20/35 (57%)

Query: 486 PQMMHNPFASKNSHKPGNTKRTNSVLMDPLTPAAQ 520
           P +M NPFA + S +    KR  SV MDPL P  Q
Sbjct: 472 PYLMMNPFAKRKSTESLPKKRHMSVFMDPLAPVPQ 506

>AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR140W
           (SFL1)
          Length = 695

 Score =  139 bits (350), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/142 (52%), Positives = 86/142 (60%), Gaps = 33/142 (23%)

Query: 58  NAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 117
           N  FIHKLY +LEDD++ DLIWWS S  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN+
Sbjct: 24  NTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 83

Query: 118 YGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNPTKI 177
           YGFHKVS DH                          K SS     G    E E  N   +
Sbjct: 84  YGFHKVS-DH--------------------------KPSSAK---GTSQDEDEAIN---L 110

Query: 178 WEFKHSSGIFKKGDIESLKHIK 199
           WEF+HS G F+KGD ESLK IK
Sbjct: 111 WEFRHSMGCFRKGDKESLKSIK 132

>SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 853

 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 94/278 (33%), Positives = 129/278 (46%), Gaps = 48/278 (17%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNIYGF 120
           FIHKLY +LED  + DLIWWSP+  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN+YGF
Sbjct: 45  FIHKLYSMLEDQEMKDLIWWSPTQDSFLIKPNEKFSKALATFFKHTNVASFVRQLNMYGF 104

Query: 121 HKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNPTKIWEF 180
           HKV+ +                           K +    T  A   E    +   +WEF
Sbjct: 105 HKVNDN-------------------------TGKQTDKYSTDSASTNE----DSINLWEF 135

Query: 181 KHSSGIFKKGDIESLKHIKXXXXXXXXXXXXXXXXXXXXXYDIESTI---RARPASIQDP 237
           KHSS  F+KGD+E LK IK                        ES     R   ++   P
Sbjct: 136 KHSSSAFRKGDMEGLKTIKRRSSRNPILARKNSSTASTPAEQSESWTDHNRHPLSNASAP 195

Query: 238 VSASSAFSNY----VPQISGASSSIP-ECFSHVPYENANHGPLEF----NNPDTQETSKP 288
              S +++N      PQ S     +P E F   P  + N    +     +N   Q T+  
Sbjct: 196 EMNSQSYTNLRSISSPQHSNGMVYVPVEYFGVQPAASHNQQQNQVLDSKHNEGVQNTTSL 255

Query: 289 LSFQ-------DETLTHLKDINFDMIKIIESMQHFISL 319
            + Q       D+T+  L+  N DMI+++E ++ +  L
Sbjct: 256 KNEQANAPWNCDQTVYELRTTNMDMIRLLELIEKWFFL 293

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 479 YAETFNTPQMMHNPFASKNSHKPGNTKRTNSVLMDPL 515
           Y+ +  TP +M NPFA + S       R  SVLMDPL
Sbjct: 541 YSGSSGTPYLMMNPFAKRKSSASSARNRHMSVLMDPL 577

>TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5.77
           YGR249W
          Length = 601

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 67/149 (44%), Gaps = 10/149 (6%)

Query: 60  IFIHKLYQILEDDSLHDLIWWSPSGLS-FMIKPVE-RFS-KALATYFKHTNITSFVRQLN 116
           +FIH+LY IL+   L + I W P     F IKP    FS K L  YFKH N TSFVRQL 
Sbjct: 3   VFIHQLYSILDQSDLREWIHWIPDADGVFAIKPFHHNFSQKVLQKYFKHKNFTSFVRQLY 62

Query: 117 IYGFHKVS-----HDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEK 171
           +YGFHK+S      D                            NS  D++ G     K  
Sbjct: 63  MYGFHKLSPNKNVIDSKASLTSNTGKTSQTNSTSAKDSNSRKSNSLSDKSKGNSENAKNG 122

Query: 172 SNPTKIWEFKHSSGIFKKG-DIESLKHIK 199
               + W F H SG+F KG D+ +L  I+
Sbjct: 123 KEDIE-WYFTHPSGLFHKGSDVVTLNKIQ 150

>Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W
           (REAL)
          Length = 836

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 119
           F++KL+ +L DDS   LI W+P G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 176 FVNKLWSMLNDDSNAKLIQWAPDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMYG 235

Query: 120 FHKV 123
           +HKV
Sbjct: 236 WHKV 239

>TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {ON}
           Anc_5.77 YGR249W
          Length = 398

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 69/143 (48%), Gaps = 36/143 (25%)

Query: 61  FIHKLYQILEDDSLHDLI-WWSPSGLSFMIKPVER-FSK-ALATYFKHTNITSFVRQLNI 117
           FIH+LY IL++  L + I W+      F++KP +  FSK  L  YFKH N++SFVRQL++
Sbjct: 6   FIHQLYAILQESQLQEWISWFKDDDSVFVLKPHDGGFSKYVLRRYFKHGNVSSFVRQLHM 65

Query: 118 YGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNPTKI 177
           YGFHK+++                                  E  G G  +++    T  
Sbjct: 66  YGFHKITNPQ--------------------------------EGLGEGRSDEQGDRATTR 93

Query: 178 WEFKHSSGIFKK-GDIESLKHIK 199
           W F H  G F+K  D+ SLK I+
Sbjct: 94  WFFAHPLGYFRKDADLASLKKIQ 116

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 8/80 (10%)

Query: 45  HGSKTLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYF 103
           HGSK         N  F+ KLY+ILE ++  +L+ W+P G SF++    +F+ + L T+F
Sbjct: 74  HGSKA-------ANNDFVRKLYKILETNTFPNLVRWTPEGTSFVVLDTGKFTTQILPTHF 126

Query: 104 KHTNITSFVRQLNIYGFHKV 123
           KH+N +SFVRQLN Y FHKV
Sbjct: 127 KHSNFSSFVRQLNKYDFHKV 146

>Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON}
           complement(17211..18512) [1302 nt, 434 aa]
          Length = 433

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 69/143 (48%), Gaps = 8/143 (5%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLS-FMIKP--VERFSKALATYFKHTNITSFVRQLNI 117
           F+H+LY IL    L D I+WS    S F IKP   +  S+ L +YFKH N++SFVRQL++
Sbjct: 6   FLHQLYSILHQPDLTDWIYWSEDDSSIFAIKPYSTQFSSQILKSYFKHGNVSSFVRQLHM 65

Query: 118 YGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNPTKI 177
           YGFHK+SH +                           + S         Q++  +    I
Sbjct: 66  YGFHKLSHLNKQGNDKNGNNTDPQNTTNNGNNSGIDPSESDISFPPTLPQDRSLT----I 121

Query: 178 WEFKHSSGIF-KKGDIESLKHIK 199
           W F H SG F K  DI +L+ I+
Sbjct: 122 WYFTHPSGYFHKNADILNLEKIQ 144

>KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.77
           YGR249W
          Length = 465

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 53/71 (74%), Gaps = 4/71 (5%)

Query: 61  FIHKLYQILEDDSLHDLIWWSP-SGLSFMIKPVE-RFS-KALATYFKHTNITSFVRQLNI 117
           FIH+L+ IL++  LH+LI WSP     F++KP +  FS + L  YFKH NI+SFVRQL++
Sbjct: 6   FIHQLHSILQEPDLHNLICWSPMENNIFLLKPHDPNFSTQVLKRYFKHGNISSFVRQLHM 65

Query: 118 YGFHKV-SHDH 127
           YGFHK+ SH+H
Sbjct: 66  YGFHKLPSHNH 76

>KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.209
           YGL073W
          Length = 613

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F++KL+ +L D+S  DLI WS  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 152 FVNKLWSMLNDNSNLDLIQWSNDGKSFVVTNREQFVHEILPKYFKHSNFASFVRQLNMYG 211

Query: 120 FHKV 123
           +HKV
Sbjct: 212 WHKV 215

>YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimeric
           heat shock transcription factor, activates multiple
           genes in response to stresses that include hyperthermia;
           recognizes variable heat shock elements (HSEs)
           consisting of inverted NGAAN repeats;
           posttranslationally regulated
          Length = 833

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 119
           F++KL+ +L DDS   LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 175 FVNKLWSMLNDDSNTKLIQWAEDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMYG 234

Query: 120 FHKV 123
           +HKV
Sbjct: 235 WHKV 238

>Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W
           (REAL)
          Length = 837

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 119
           F++KL+ +L DDS   LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 176 FVNKLWSMLNDDSNTKLIQWAKDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMYG 235

Query: 120 FHKV 123
           +HKV
Sbjct: 236 WHKV 239

>Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W
           (REAL)
          Length = 846

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 119
           F++KL+ +L DDS   LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 176 FVNKLWSMLNDDSNTKLIQWALDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMYG 235

Query: 120 FHKV 123
           +HKV
Sbjct: 236 WHKV 239

>KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {ON}
           Anc_6.209 YGL073W
          Length = 771

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 119
           F++KL+ +L D +  DLI W+  G SF++   E+F    L  YFKH+N  SFVRQLN+YG
Sbjct: 169 FVNKLWSMLNDQANLDLIRWADDGKSFIVTNREKFVHDILPKYFKHSNFASFVRQLNMYG 228

Query: 120 FHKV 123
           +HKV
Sbjct: 229 WHKV 232

>KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {ON}
           weakly similar to uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 412

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 70/143 (48%), Gaps = 28/143 (19%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLS-FMIKP-VERFS-KALATYFKHTNITSFVRQLNI 117
           FIH+L+ IL  D L + I WS    S F+IKP    FS K L  +FKH N++SFVRQL++
Sbjct: 6   FIHQLHHILMQDELIEWIRWSEDDESMFIIKPNAPNFSSKVLKRFFKHGNVSSFVRQLHM 65

Query: 118 YGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKEKSNPTKI 177
           YGFHK+ H                              +SG +  GA A     ++ ++I
Sbjct: 66  YGFHKLPHSASSTLA-----------------------ASGADNNGATASTNNATSKSEI 102

Query: 178 -WEFKHSSGIFKKGDIES-LKHI 198
            W+F H S  F K   E+ LK I
Sbjct: 103 EWKFTHHSHDFCKSASEAQLKRI 125

>TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.209
           YGL073W
          Length = 546

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F++K++ +L D+S  +LI WS  G SF++   E F  + L  YFKH+N+ SFVRQLN+YG
Sbjct: 120 FVNKVWSMLNDESNVNLIQWSKDGKSFIVVNREEFVHQILPKYFKHSNLASFVRQLNMYG 179

Query: 120 FHKV 123
           +HKV
Sbjct: 180 WHKV 183

>Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON}
           (115581..117734) [2154 nt, 718 aa]
          Length = 717

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIYG 119
           F++K++ ++ DD+  +LI WS  GLS +I   E   +  L  YFKH+N  SFVRQLN+YG
Sbjct: 186 FVNKVWNMVNDDNNAELIRWSSDGLSIVINNREELVREILPKYFKHSNFASFVRQLNMYG 245

Query: 120 FHKV 123
           +HKV
Sbjct: 246 WHKV 249

>ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} similar
           to uniprot|P10961 Saccharomyces cerevisiae YGL073W HSF1
           Trimeric heat shock transcription factor activates
           multiple genes in response to hyperthermia recognizes
           variable heat shock elements
          Length = 572

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 46/65 (70%), Gaps = 1/65 (1%)

Query: 60  IFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIY 118
           +F++K++ +L D+S  +LI W+  G SF++   E F  + L  YFKH+N  SFVRQLN+Y
Sbjct: 112 LFVNKVWSMLNDESNGNLIRWAEDGKSFVVVNREEFVHQVLPKYFKHSNFASFVRQLNMY 171

Query: 119 GFHKV 123
           G+HKV
Sbjct: 172 GWHKV 176

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
           (REAL)
          Length = 623

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 50/78 (64%), Gaps = 2/78 (2%)

Query: 47  SKTLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKH 105
           S T  G + P N  F+ KL++ILE++   D++ W+ +G SF++    +F+   L  +FKH
Sbjct: 74  SSTSTGAKAPANE-FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKH 132

Query: 106 TNITSFVRQLNIYGFHKV 123
           +N  SFVRQLN Y FHKV
Sbjct: 133 SNFASFVRQLNKYDFHKV 150

>Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W
           (REAL)
          Length = 469

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 48/68 (70%), Gaps = 3/68 (4%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPS-GLSFMIKPVE-RFSK-ALATYFKHTNITSFVRQLNI 117
           F+H+L+ IL +  ++  I+WSP+  + F +KP +  FS   L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHSILLEPEVNQWIYWSPTDSMVFFLKPYDPNFSTHVLKRYFKHGNVNSFVRQLHM 65

Query: 118 YGFHKVSH 125
           YGFHK+SH
Sbjct: 66  YGFHKLSH 73

>TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.209
           YGL073W
          Length = 627

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 5/77 (6%)

Query: 48  KTLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHT 106
           + L   RP     F++KL+ +L D    D+I WS  G SF++   E+F    L  YFKH+
Sbjct: 154 RVLAKTRPA----FVNKLWNMLNDPINQDMIRWSDDGKSFLVVNREKFVHHVLPNYFKHS 209

Query: 107 NITSFVRQLNIYGFHKV 123
           N  SFVRQLN+YG+HKV
Sbjct: 210 NFASFVRQLNMYGWHKV 226

>SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 557

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F++KL+ ++ D S   LI WS  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 166 FVNKLWSMVNDTSNQKLIHWSKDGKSFIVTKREQFVHEILPKYFKHSNFASFVRQLNMYG 225

Query: 120 FHKV 123
           +HKV
Sbjct: 226 WHKV 229

>KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 677

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 51/83 (61%), Gaps = 2/83 (2%)

Query: 42  VKKHGSKTLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALA 100
           V KH SK  +     + A F++KL+ ++ D S    I WS SG S ++   ERF  + L 
Sbjct: 179 VDKHHSKKKLSTTRARPA-FVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLP 237

Query: 101 TYFKHTNITSFVRQLNIYGFHKV 123
            YFKH+N  SFVRQLN+YG+HKV
Sbjct: 238 KYFKHSNFASFVRQLNMYGWHKV 260

>SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 385

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 3/71 (4%)

Query: 57  QNAIFIHKLYQILEDDSLHDLIWWS-PSGLSFMIKPV--ERFSKALATYFKHTNITSFVR 113
           Q   FIH+L+ IL+ + L   I+WS  S   F +KP   E  S+ L  YFKH N++SFVR
Sbjct: 2   QTKTFIHQLHGILQQEDLDQWIYWSSKSQTVFALKPYDPEFSSQVLKRYFKHGNVSSFVR 61

Query: 114 QLNIYGFHKVS 124
           QL++YGFHK++
Sbjct: 62  QLHMYGFHKIA 72

>Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {ON}
           YGR249W (REAL)
          Length = 453

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 48/68 (70%), Gaps = 3/68 (4%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPS-GLSFMIKPVE-RFSK-ALATYFKHTNITSFVRQLNI 117
           F+H+L+ IL +  ++  I+WSP+  + F +KP +  FS   L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHSILLEPEVNKWIYWSPTDNMVFFLKPYDPNFSTHVLKRYFKHGNVNSFVRQLHM 65

Query: 118 YGFHKVSH 125
           YGFHK+SH
Sbjct: 66  YGFHKLSH 73

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
           response regulator and transcription factor; physically
           interacts with the Tup1-Cyc8 complex and recruits Tup1p
           to its targets; part of a branched two-component
           signaling system; required for optimal induction of
           heat-shock genes in response to oxidative stress;
           involved in osmoregulation
          Length = 622

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 48/73 (65%), Gaps = 2/73 (2%)

Query: 52  GPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHTNITS 110
           G + P N  F+ KL++ILE++   D++ W+ +G SF++    +F+   L  +FKH+N  S
Sbjct: 79  GAKAPANE-FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFAS 137

Query: 111 FVRQLNIYGFHKV 123
           FVRQLN Y FHKV
Sbjct: 138 FVRQLNKYDFHKV 150

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON}
           Anc_4.385
          Length = 609

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (67%), Gaps = 2/71 (2%)

Query: 54  RPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHTNITSFV 112
           RPP N  F+ KLY ILE ++  D++ W+ +G +F++    +F++  L  +FKH+N  SFV
Sbjct: 50  RPPANE-FVRKLYTILEKNAYPDIVRWTENGDTFVVLDTGKFTEDILPNHFKHSNFASFV 108

Query: 113 RQLNIYGFHKV 123
           RQLN Y FHK+
Sbjct: 109 RQLNKYDFHKI 119

>Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073W
           (HSF1) - heat shock transcription factor [contig 166]
           FULL
          Length = 567

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F++KL+ ++ D +   LI WS  G SF+I   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 160 FVNKLWSMVNDSANQKLIHWSSDGKSFIITNREHFVHEILPKYFKHSNFASFVRQLNMYG 219

Query: 120 FHKV 123
           +HKV
Sbjct: 220 WHKV 223

>NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77
          Length = 393

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (68%), Gaps = 3/74 (4%)

Query: 57  QNAIFIHKLYQILEDDSLHDLIWWSP-SGLSFMIKPVE-RFS-KALATYFKHTNITSFVR 113
           Q+  FIH+L+ IL++ +L D I WS      F++KP +  FS K L  YFKH NI+SFVR
Sbjct: 2   QHRNFIHQLHSILQEPTLDDWITWSSFDNNVFILKPYDPNFSDKVLKKYFKHGNISSFVR 61

Query: 114 QLNIYGFHKVSHDH 127
           QL++YGFHK++  H
Sbjct: 62  QLHMYGFHKIATVH 75

>KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 569

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F++KL+ ++ D +   LI WS  G SF+I   E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 161 FVNKLWSMVNDSANQKLIHWSADGKSFVITNREHFVHEILPKYFKHSNFASFVRQLNMYG 220

Query: 120 FHKV 123
           +HKV
Sbjct: 221 WHKV 224

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
           (REAL)
          Length = 625

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 48/73 (65%), Gaps = 2/73 (2%)

Query: 52  GPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHTNITS 110
           G + P N  F+ KL++ILE++   D++ W+ +G SF++    +F+   L  +FKH+N  S
Sbjct: 80  GSKAPANE-FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFAS 138

Query: 111 FVRQLNIYGFHKV 123
           FVRQLN Y FHKV
Sbjct: 139 FVRQLNKYDFHKV 151

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
           Anc_4.385 YJR147W
          Length = 615

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 2/71 (2%)

Query: 54  RPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFV 112
           RPP N  F+ KL++ILE +   +++ W+  G SF++    +F+ + L  +FKH+N  SFV
Sbjct: 72  RPPSNE-FVRKLFKILESNIYSNIVRWTEEGDSFVVLDTGKFTTQILPNHFKHSNFASFV 130

Query: 113 RQLNIYGFHKV 123
           RQLN Y FHKV
Sbjct: 131 RQLNKYDFHKV 141

>YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protein
           similar to heat shock transcription factor; multicopy
           suppressor of pseudohyphal growth defects of ammonium
           permease mutants
          Length = 456

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (66%), Gaps = 3/72 (4%)

Query: 57  QNAIFIHKLYQILEDDSLHDLIWWSPS-GLSFMIKPVE-RFSK-ALATYFKHTNITSFVR 113
           Q   F+H+L+ IL +  ++  I+WSP+    F +KP +  FS   L  YFKH N+ SFVR
Sbjct: 2   QPKTFVHQLHAILLEPEVNKWIYWSPTDNTVFFLKPYDPNFSTHVLKRYFKHGNVNSFVR 61

Query: 114 QLNIYGFHKVSH 125
           QL++YGFHK+SH
Sbjct: 62  QLHMYGFHKLSH 73

>CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249w MGA1
          Length = 325

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 48/74 (64%), Gaps = 4/74 (5%)

Query: 57  QNAIFIHKLYQILEDDSLHDLIWWSPS--GLSFMIKPV--ERFSKALATYFKHTNITSFV 112
           Q+  F+H+L+ IL D +L  +I W+    G  F++KP   E     L  YFKH N++SFV
Sbjct: 2   QHKTFVHQLHSILSDPTLTGIINWNDDEIGTVFLLKPYHPEFCDNVLKRYFKHGNVSSFV 61

Query: 113 RQLNIYGFHKVSHD 126
           RQL++YGFHKV ++
Sbjct: 62  RQLHMYGFHKVGNN 75

>TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.77
           YGR249W
          Length = 439

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 50/68 (73%), Gaps = 3/68 (4%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLS-FMIKP-VERFS-KALATYFKHTNITSFVRQLNI 117
           F+H+L+ IL  ++L++ I+W+    + F IKP   +FS K L  YFKH N++SFVRQL++
Sbjct: 6   FLHQLFSILAQENLNEWIYWTEDDDAVFAIKPYASQFSAKILKGYFKHGNVSSFVRQLHM 65

Query: 118 YGFHKVSH 125
           YGFHK+S+
Sbjct: 66  YGFHKLSN 73

>KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON}
           Anc_5.77 YGR249W
          Length = 414

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 68/144 (47%), Gaps = 23/144 (15%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPS-GLSFMIKPVER-FSK-ALATYFKHTNITSFVRQLNI 117
           F+HKL+ IL++  + +LI WS     +F +KP +  F+   L  YFKH N++SFVRQL++
Sbjct: 6   FVHKLHSILQEPGISNLIAWSDKYDGAFCLKPYDADFANLVLKRYFKHGNVSSFVRQLHM 65

Query: 118 YGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTG---------AGAQE 168
           YGFHK+                               NS+G E TG         + AQE
Sbjct: 66  YGFHKI--------PVLDVKNTISPLPSSDSINNTSTNSTGPEFTGNNNENSSLESMAQE 117

Query: 169 KEKSNPTK---IWEFKHSSGIFKK 189
            ++    K   IW F H SG F K
Sbjct: 118 TDQRRTDKASTIWYFSHPSGNFYK 141

>NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209
          Length = 760

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F++KL+ ++ D++ H LI WS  G SF++     F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 197 FVNKLWSMVNDEANHPLIQWSDDGKSFVVTNRGSFVHEILPKYFKHSNFASFVRQLNMYG 256

Query: 120 FHKV 123
           +HK+
Sbjct: 257 WHKI 260

>NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {ON}
           Anc_5.77 YGR249W
          Length = 526

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 61  FIHKLYQILEDDSLHDLI-WWSPSGLSFMIKPVE-RFS-KALATYFKHTNITSFVRQLNI 117
           F+++L+ IL+   LH  I W+S     F++KP +  FS K L  YFKH NI+SFVRQL++
Sbjct: 6   FVNQLHLILQQKGLHQWIRWYSIEKSIFLLKPYDPNFSEKVLKKYFKHGNISSFVRQLHM 65

Query: 118 YGFHKVS 124
           YGFHK+S
Sbjct: 66  YGFHKIS 72

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON}
           Anc_4.385 YJR147W
          Length = 545

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F+ KLY ILE++   D++ W+  G SF++    +F+ K L  +FKH+N  SFVRQLN Y 
Sbjct: 61  FVRKLYNILENNEYPDIVRWTARGDSFVVLDTGKFTTKILPNHFKHSNFASFVRQLNKYD 120

Query: 120 FHKV 123
           FHK+
Sbjct: 121 FHKI 124

>TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON} 
          Length = 445

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 48/77 (62%), Gaps = 5/77 (6%)

Query: 48  KTLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHT 106
           + L   RP     F++KL+ +L++    D+I W+  G SF++   E+F    L  YFKH+
Sbjct: 112 RVLAKTRPA----FVNKLWNMLKEPINQDMIRWNDDGKSFLVVNREKFVHHVLPNYFKHS 167

Query: 107 NITSFVRQLNIYGFHKV 123
           N  SFVRQLN+YG+HKV
Sbjct: 168 NFASFVRQLNMYGWHKV 184

>Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W
           (REAL)
          Length = 452

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (70%), Gaps = 3/68 (4%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPS-GLSFMIKPVE-RFS-KALATYFKHTNITSFVRQLNI 117
           F+H+L+ IL +  ++  I+WS +  + F +KP +  FS + L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHSILLEPEVNKWIYWSSTDNVVFFLKPYDPNFSTQVLKRYFKHGNVNSFVRQLHM 65

Query: 118 YGFHKVSH 125
           YGFHK+SH
Sbjct: 66  YGFHKLSH 73

>Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AFL085C
          Length = 529

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F++KL+ ++ D +   LI W+  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 214 FVNKLWSMVNDPTNQALIHWNDDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYG 273

Query: 120 FHKV 123
           +HKV
Sbjct: 274 WHKV 277

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 464

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F+ KL++ILE    +D+I W+  G SF++     F+ K L  +FKH+N +SFVRQLN Y 
Sbjct: 30  FVRKLFKILEGAEYNDIIRWTEDGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 89

Query: 120 FHKV 123
           FHK+
Sbjct: 90  FHKI 93

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
           (REAL)
          Length = 617

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSK-ALATYFKHTNITSFVRQLNIYG 119
           F+ KL++ILE++   D++ W+ +G SF++    +F+   L  +FKH+N  SFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 120 FHKV 123
           FHKV
Sbjct: 147 FHKV 150

>ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 334

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 49/68 (72%), Gaps = 5/68 (7%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPS--GLSFMIKPVERF--SKALATYFKHTNITSFVRQLN 116
           FIH+L+ IL D +L + I WS    G+ F+++P +++  +  L  YFKH N++SFVRQL+
Sbjct: 6   FIHQLHAILNDATLAEWIRWSDDQDGV-FVLRPYDKWFSTLVLKRYFKHGNVSSFVRQLH 64

Query: 117 IYGFHKVS 124
           +YGFHK+S
Sbjct: 65  MYGFHKLS 72

>CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073w HSF1
          Length = 706

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 119
           F++K++ ++ D     LI WS  GLS ++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 230 FVNKVWSMINDPVNSHLIQWSEDGLSLIVVNREKFVHEILPKYFKHSNFASFVRQLNMYG 289

Query: 120 FHKV 123
           +HKV
Sbjct: 290 WHKV 293

>NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {ON}
           Anc_6.209
          Length = 905

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 119
           F++K++ ++ D     LI WS  G SF+++  E F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 266 FVNKVWSMINDPVNKGLINWSDDGRSFIVQNRENFVHEVLPKYFKHSNFASFVRQLNMYG 325

Query: 120 FHKV 123
           +HKV
Sbjct: 326 WHKV 329

>AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL073W
           (HSF1)
          Length = 569

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F++KL+ ++ D     LI WS  G SF++   E+F  + L  YFKH+N  SFVRQLN+YG
Sbjct: 160 FVNKLWSMVNDPVNQSLIHWSHDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYG 219

Query: 120 FHKV 123
           +HKV
Sbjct: 220 WHKV 223

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
           (SKN7) - transcription factor involved in oxidative
           stress response [contig 376] FULL
          Length = 461

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F+ KL++ILE     D+I W+  G SF++     F+ K L  +FKH+N +SFVRQLN Y 
Sbjct: 29  FVRKLFKILEGGEYTDIIRWTADGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 88

Query: 120 FHKV 123
           FHK+
Sbjct: 89  FHKI 92

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
           [1650 nt, 550 aa]
          Length = 549

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (63%), Gaps = 1/69 (1%)

Query: 56  PQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQ 114
           PQ+  F+ K+Y ILE     D++ W+ +G SF++     F S+ L  +FKH+N  SFVRQ
Sbjct: 82  PQSNEFVRKIYGILERGDYPDIVRWTENGDSFVVLDTGSFTSQILPNHFKHSNFASFVRQ 141

Query: 115 LNIYGFHKV 123
           LN Y FHKV
Sbjct: 142 LNKYDFHKV 150

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           weakly similar to YHR206W uniprot|P38889 Saccharomyces
           cerevisiae
          Length = 465

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F+ KL+ ILE     D++ W+ +G SF++     F+ K L  +FKH+N  SFVRQLN Y 
Sbjct: 26  FVRKLFNILEGGEYTDIVCWTETGDSFVVLNTNDFTTKILPKHFKHSNFASFVRQLNKYD 85

Query: 120 FHKV 123
           FHKV
Sbjct: 86  FHKV 89

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
           Anc_4.385 YJR147W
          Length = 547

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F+ KLY ILE     D++ W+ +G SF++    +F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 34  FVRKLYGILERCEYPDIVRWTETGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 93

Query: 120 FHKV 123
           FHKV
Sbjct: 94  FHKV 97

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar
           to uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
           transcription factor
          Length = 630

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F+ KL+ ILE +   +++ WS +G SF++    +F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 77  FVRKLFNILESNQYSNIVRWSNTGDSFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 136

Query: 120 FHKV 123
           FHK+
Sbjct: 137 FHKI 140

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           some similarites with YHR206W uniprot|P38889
           Saccharomyces cerevisiae
          Length = 475

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F+ KL+ ILE +    +I WSP G +F++    +F+   L  +FKH+N  SFVRQLN Y 
Sbjct: 43  FVRKLFLILESEEYTSIISWSPDGKNFIVLDTNKFTTDILPKHFKHSNFASFVRQLNKYD 102

Query: 120 FHKV 123
           FHKV
Sbjct: 103 FHKV 106

>KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W MGA1 Protein similar to heat shock
           transcription factor; multicopy suppressor of
           pseudohyphal growth defects of ammonium permease mutants
          Length = 390

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 113/285 (39%), Gaps = 26/285 (9%)

Query: 57  QNAIFIHKLYQILEDDSLHDLIWWSPS----GLSFMIKPVER-FS-KALATYFKHTNITS 110
           QN  FIH+L+ IL+   L   I W P     G+ F ++P +  FS   L  YFKH N++S
Sbjct: 2   QNKTFIHQLHAILQQPELERWIRWEPDEQLRGV-FSLRPHDAAFSTNVLKRYFKHGNVSS 60

Query: 111 FVRQLNIYGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTGAGAQEKE 170
           FVRQL++YGFHK++                              +S+      A      
Sbjct: 61  FVRQLHMYGFHKLAAPTAPTSTEPASPATSPAASAGSSVAGGGTSSADGSAGAAATTAGT 120

Query: 171 KSNPTK-IWEFKHSSGIF-KKGDIESLKHIKXXXXXXXXXXXXXXXXXXXXXYDIEST-- 226
           KS  +  +W+F H SG F +   +  L  I+                       +++T  
Sbjct: 121 KSGKSAVVWQFSHPSGAFCRDSTMSELGRIQRKSGGVGKNGKRKNVLSAVCVNYVDTTAA 180

Query: 227 --IRARPASIQD---------PVSASSAFSNYVPQISGASSSIPECFSHVPYENANHGPL 275
             I +RP+S            P+ +    +   P  S  S S P+  S      +++   
Sbjct: 181 ASIVSRPSSAMSGSDEAPQMTPLPSLRPLTTPAPPESARSPSSPDLLSQKGSSGSSNSVP 240

Query: 276 EFNNPDTQETSKPLSFQDETLTHLK-DINF---DMIKIIESMQHF 316
           + +      T  P   Q+ TL HL+ +IN     M+ I++ +Q F
Sbjct: 241 QLSALYPGSTPVPAGPQNLTLQHLQHNINLIQRGMVTILDVLQQF 285

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON}
           Anc_4.385 YJR147W
          Length = 587

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 119
           F+  +Y ILE +   D+I WS  G SF++    +F S+ L  +FKH+N  SFVRQLN Y 
Sbjct: 67  FVRIIYGILEREDYPDIITWSEKGDSFLVLDTGKFTSQILPNHFKHSNFASFVRQLNKYD 126

Query: 120 FHKV 123
           FHKV
Sbjct: 127 FHKV 130

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
           (HMS2)
          Length = 482

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 52  GPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITS 110
           G R   N  F+ KL+ ILE     D+I W+  G SF++     F+   L  +FKH+N +S
Sbjct: 30  GSRAAYND-FVRKLFAILESGEYTDIISWTKEGNSFVVVDTNEFTTNILPKHFKHSNFSS 88

Query: 111 FVRQLNIYGFHKV 123
           FVRQLN Y FHKV
Sbjct: 89  FVRQLNKYDFHKV 101

>TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {ON}
           Anc_6.209 YGL073W
          Length = 718

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIYG 119
           F++K++ ++ D S + LI W+  G SF +   E   +  L  YFKH+N  SFVRQLN+YG
Sbjct: 171 FVNKVWNMINDPSNNQLIQWADDGKSFFVTNKEDLIREILPKYFKHSNFASFVRQLNMYG 230

Query: 120 FHKV 123
           +HK+
Sbjct: 231 WHKI 234

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
           similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 647

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITSFVRQLNIYG 119
           F+ KL+ ILE     D++ W+  G SF++    +F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 44  FVRKLFGILERCEYPDIVRWTEKGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 103

Query: 120 FHKV 123
           FHKV
Sbjct: 104 FHKV 107

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
           Anc_4.385 YJR147W
          Length = 510

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIYG 119
           F+ K+Y ILE     +++ W+ +G SF++    +F S+ L  +FKH+N  SFVRQLN Y 
Sbjct: 51  FVRKIYSILEGGEYPEIVTWTEAGDSFVVVDTGKFTSQILPNHFKHSNFASFVRQLNKYD 110

Query: 120 FHKV 123
           FHKV
Sbjct: 111 FHKV 114

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL388W
          Length = 496

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 52  GPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFS-KALATYFKHTNITS 110
           G R   N  F+ KL+ ILE     ++I W+  G SF++     F+   L  +FKH+N +S
Sbjct: 35  GTRAAYND-FVRKLFAILESGEYTNIISWTKDGNSFVVVDTNEFTTNILPKHFKHSNFSS 93

Query: 111 FVRQLNIYGFHKV 123
           FVRQLN Y FHKV
Sbjct: 94  FVRQLNKYDFHKV 106

>AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR249W
           (MGA1)
          Length = 450

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 63/146 (43%), Gaps = 39/146 (26%)

Query: 57  QNAIFIHKLYQILEDDSLHDLIWWSPSGLS-FMIKPV--ERFSKALATYFKHTNITSFVR 113
           Q   FIH+L+ +L D SL   I WS      F +KP   E     L   FKH N++SFVR
Sbjct: 2   QPKTFIHQLHHMLSDRSLETWIRWSAEDDHIFCLKPYDPEFPGTVLKKNFKHGNVSSFVR 61

Query: 114 QLNIYGFHKVSHDHXXXXXXXXXXXXXXXXXXXXXXXXXXKNSSGDETTG-AGAQEKE-- 170
           QL++YGFHK+                              +   G  ++G AG  E    
Sbjct: 62  QLHLYGFHKL------------------------------QTGPGAASSGPAGDNEPPTH 91

Query: 171 --KSN-PTKIWEFKHSSGIFKKGDIE 193
             KSN  + +W F H SG F KG  +
Sbjct: 92  IIKSNKESMVWYFTHPSGYFYKGACQ 117

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON}
           Anc_4.385 YJR147W
          Length = 791

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 60  IFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERF-SKALATYFKHTNITSFVRQLNIY 118
           +F+  L+ ILED+   ++I W+  G  F++     F S  L  +F H+N  SFVRQLN +
Sbjct: 34  LFVKTLFNILEDEKYQNIIKWTEKGDRFVVIDAGLFTSDILPIHFNHSNFASFVRQLNKF 93

Query: 119 GFHKV 123
           GFHK+
Sbjct: 94  GFHKI 98

>Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar to
           Ashbya gossypii AEL216C
          Length = 572

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 57  QNAIFIHKLYQILEDDSLHDLIWWSPSGLS-FMIKPV--ERFSKALATYFKHTNITSFVR 113
           Q   FIH+L+ +L D SL   I WS      F +KP   E   K L   FKH N++SFVR
Sbjct: 2   QPKTFIHQLHHMLNDKSLESWIRWSAEDDHIFCLKPYDPEFPGKVLKKNFKHGNVSSFVR 61

Query: 114 QLNIYGFHKV 123
           QL++YGFHK+
Sbjct: 62  QLHMYGFHKL 71

>Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON}
           (171402..172703) [1302 nt, 434 aa]
          Length = 433

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 61  FIHKLYQILEDDSLHDLI-WWSPSGLSFMIKPV--ERFSKALATYFKHTNITSFVRQLNI 117
           F+H+L+ +L      + I W +     F+I P   E   K L  YFKH N +SFVRQL++
Sbjct: 4   FVHQLFSMLNQPDYKEWIHWLNDEDSIFVITPYNQEFGDKVLKKYFKHGNFSSFVRQLHM 63

Query: 118 YGFHKV 123
           YGF K+
Sbjct: 64  YGFQKL 69

>Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147W
           (REAL)
          Length = 349

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 2/70 (2%)

Query: 60  IFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHT--NITSFVRQLNI 117
           +F+ KL+Q+L+ ++  ++I W P G  F+I   ++F+K +   F  +  +  SFVRQL+ 
Sbjct: 6   VFVSKLFQLLQSNAYSEIIQWLPDGTRFVIWNTDQFAKVILKRFFPSLPSFASFVRQLSK 65

Query: 118 YGFHKVSHDH 127
           Y F K+   H
Sbjct: 66  YEFQKMERLH 75

>Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147W
           (REAL)
          Length = 346

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 60  IFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIY 118
           +F+ KL+ +L+ ++   +I WS  G  F+I   E+F+K  L  +F  ++ T+FV+QL+ Y
Sbjct: 6   VFVSKLFHLLQSNAYSSIIQWSSDGSRFIIWDPEQFTKVILERFFSLSSYTAFVKQLSKY 65

Query: 119 GFHKVSHDH 127
            F K    H
Sbjct: 66  SFQKTKRPH 74

>YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Protein
           with similarity to heat shock transcription factors;
           overexpression suppresses the pseudohyphal filamentation
           defect of a diploid mep1 mep2 homozygous null mutant
          Length = 358

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 54  RPPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKA-LATYFKHTNITSFV 112
           R  Q  +F+ KLY +L+ ++  ++I WS  G   +I   ++F+K  L  +F      +FV
Sbjct: 6   RMEQPDVFVSKLYHLLQGNAYSNIIQWSTDGSKLVIWNPDQFTKVILERFFGIHTFAAFV 65

Query: 113 RQLNIYGFHK 122
           +QL+ Y F K
Sbjct: 66  KQLSKYNFQK 75

>Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147W
           (REAL)
          Length = 347

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 61  FIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKA-LATYFKHTNITSFVRQLNIYG 119
           F+  L++IL+ ++   +I WS  G  F+I   ++F+K  L  +F   +  +F +QL+ Y 
Sbjct: 7   FLSILFEILQGNAYSSIIQWSADGSKFIIWNPDQFTKVILERFFSIASFAAFAKQLSKYK 66

Query: 120 FHK 122
           F K
Sbjct: 67  FQK 69

>TPHA0L01980 Chr12 (414853..416523) [1671 bp, 556 aa] {ON} Anc_2.639
           YMR068W
          Length = 556

 Score = 35.0 bits (79), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 546 APSPIYPMNEPTTRLYSQPKMRTLGSTSSLPNDRRNS 582
            PSPIY +N PT  LYSQ  +  L + S + N RR S
Sbjct: 228 GPSPIYSLNSPTVSLYSQANV--LNNLSRISNGRRAS 262

>AGR381C Chr7 complement(1435245..1436252) [1008 bp, 335 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL153W
           (PEX14)
          Length = 335

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 43/81 (53%), Gaps = 11/81 (13%)

Query: 291 FQDETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFTFKNVSKKKSENIIK------- 343
           F+D+ +  LK+++  +IK+  +++     ++N    +F F+++  + +E   K       
Sbjct: 159 FRDQQVEKLKELDATIIKLQGALEETTKTRNNI---NFEFRDLKLQVTEMAKKLDEFRQA 215

Query: 344 -DHQNQLKVFESDMLTFKQHV 363
            DH +QL   +SDM + K+ +
Sbjct: 216 RDHNSQLTALQSDMESLKRLI 236

>YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to mitochondria;
           YNL122C is not an essential gene
          Length = 115

 Score = 30.4 bits (67), Expect = 5.1,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 30/73 (41%)

Query: 328 FTFKNVSKKKSENIIKDHQNQLKVFESDMLTFKQHVMSRAHRTIDALHSTAAATATGPTL 387
           F F NVS      ++K H+   K +     TFK+ +  R H  I   H +  A       
Sbjct: 41  FLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIA 100

Query: 388 VPAHKSQYEIMVP 400
            PA+    + ++P
Sbjct: 101 HPAYSKHLKRLLP 113

>KNAG0J01910 Chr10 complement(346989..349280) [2292 bp, 763 aa] {ON}
           Anc_8.704 YPL174C
          Length = 763

 Score = 32.3 bits (72), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 10/118 (8%)

Query: 284 ETSKPLS---FQDETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFTFKNVSKKKSEN 340
           E SK L    ++D+ + HL + N  +   ++S+Q  +S   +  ++  + +  SK KS  
Sbjct: 199 ELSKQLDSQEYRDDIVVHLTETNSQLTTHVQSLQQELSGLEHLSARLESME--SKYKSR- 255

Query: 341 IIKDHQNQLKVFESDMLTFKQHVMSRAHRTIDALHSTAAATATGPTLVPAHKSQYEIM 398
            I D ++QL   ++++ TFK     RA    D L S   +  T    +P  + Q E++
Sbjct: 256 -IADLEDQLDRLQTELSTFKMS-QQRAQAEADTLSSQLDSLITRE--LPDREQQIEVL 309

>NCAS0E00690 Chr5 complement(124188..124931) [744 bp, 247 aa] {ON} 
          Length = 247

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 38/94 (40%), Gaps = 7/94 (7%)

Query: 328 FTFKNVSKKKSENIIKDHQNQLKVFESDMLTFKQHVMSRAHRTIDALHSTAAATATGPTL 387
           FT K   +KK   + +DHQ +L  F  D  +   H    A  T  AL        T P +
Sbjct: 27  FTIKRDGRKKCRCVARDHQQKLGTFNEDATSSTVH--HYALMTFLALALDKGQYVTQPDI 84

Query: 388 VPAH-----KSQYEIMVPPNNQFGPQKSSLSASI 416
             AH     + +  I +PP+     +   L+ S+
Sbjct: 85  SSAHLYATLEEELYIRIPPHMHMPGKAMKLNKSL 118

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,453,524
Number of extensions: 3124243
Number of successful extensions: 8919
Number of sequences better than 10.0: 132
Number of HSP's gapped: 9235
Number of HSP's successfully gapped: 158
Length of query: 758
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 641
Effective length of database: 40,065,477
Effective search space: 25681970757
Effective search space used: 25681970757
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)