Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_8.1905.475ON66664031400.0
Skud_15.3025.475ON67865426430.0
YOR138C (RUP1)5.475ON67164926280.0
Smik_15.3185.475ON67265126190.0
TPHA0J027805.475ON63164314160.0
TDEL0A033905.475ON62250313900.0
Kpol_543.95.475ON64252213800.0
SAKL0G03564g5.475ON60563413221e-175
KAFR0E025405.475ON65950813161e-173
NCAS0H022705.475ON69651812441e-162
NDAI0C013905.475ON70954411111e-142
KLTH0F15004g5.475ON59750010741e-138
TBLA0A025405.475ON67851510731e-137
Kwal_55.212675.475ON60449610501e-134
ZYRO0D11264g5.475ON5474899821e-125
KNAG0B040505.475ON6735019701e-121
CAGL0I07205g5.475ON6036449401e-118
TBLA0B022305.475ON7905399181e-112
KLLA0E03169g5.475ON5444956211e-71
Smik_5.3088.185ON42835910.022
YER143W (DDI1)8.185ON42835830.17
Skud_5.2808.185ON42835830.20
NDAI0C058908.185ON46233810.35
Ecym_71787.488ON126936781.1
KLLA0E10341g8.185ON41433771.1
AGR023C3.270ON78065761.5
ZYRO0G17996g7.488ON145534752.4
Suva_2.707.488ON138034752.6
Kpol_1013.697.488ON124436742.7
Suva_5.2718.185ON42835723.7
NCAS0I016203.270ON79564733.9
NCAS0A039208.185ON47233724.1
KAFR0G008907.470ON23497705.0
KAFR0C004103.270ON76955716.1
KAFR0B023008.185ON41634707.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_8.190
         (666 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...  1214   0.0  
Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...  1022   0.0  
YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...  1016   0.0  
Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...  1013   0.0  
TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...   550   0.0  
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   540   0.0  
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...   536   0.0  
SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...   513   e-175
KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...   511   e-173
NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...   483   e-162
NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...   432   e-142
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   418   e-138
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   417   e-137
Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...   409   e-134
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   382   e-125
KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...   378   e-121
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   366   e-118
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...   358   e-112
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   243   1e-71
Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W ...    40   0.022
YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA da...    37   0.17 
Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W ...    37   0.20 
NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON} Anc_8...    36   0.35 
Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar ...    35   1.1  
KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {...    34   1.1  
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    34   1.5  
ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} wea...    33   2.4  
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    33   2.6  
Kpol_1013.69 s1013 complement(167435..171169) [3735 bp, 1244 aa]...    33   2.7  
Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W ...    32   3.7  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    33   3.9  
NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {O...    32   4.1  
KAFR0G00890 Chr7 complement(211229..211933) [705 bp, 234 aa] {ON...    32   5.0  
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    32   6.1  
KAFR0B02300 Chr2 (451471..452721) [1251 bp, 416 aa] {ON} Anc_8.1...    32   7.3  

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score = 1214 bits (3140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/640 (92%), Positives = 594/640 (92%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQPRISENRVV 60
           MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQPRISENRVV
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQPRISENRVV 60

Query: 61  PDAGAGAYDVPNSGDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHYSISE 120
           PDAGAGAYDVPNSGDQ                                      HYSISE
Sbjct: 61  PDAGAGAYDVPNSGDQDIDMPDVVGGGGDGDGDGYDDLTDDRSGSSSSNGRGPDHYSISE 120

Query: 121 TSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQ 180
           TSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQ
Sbjct: 121 TSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQ 180

Query: 181 DLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLWQLQKLISVV 240
           DLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLWQLQKLISVV
Sbjct: 181 DLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLWQLQKLISVV 240

Query: 241 NTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETR 300
           NTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETR
Sbjct: 241 NTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETR 300

Query: 301 NLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVVYGGD 360
           NLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP        VVYGGD
Sbjct: 301 NLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEGEVVYGGD 360

Query: 361 GAHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHI 420
           GAHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHI
Sbjct: 361 GAHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHI 420

Query: 421 ISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKDADNEASKQIASLKD 480
           ISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKDADNEASKQIASLKD
Sbjct: 421 ISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKDADNEASKQIASLKD 480

Query: 481 TLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSPYSYF 540
           TLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSPYSYF
Sbjct: 481 TLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSPYSYF 540

Query: 541 TRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTD 600
           TRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTD
Sbjct: 541 TRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTD 600

Query: 601 DEVSKALENNTGCVKFAKDDQSTLNTLRAQFNDSTGNIST 640
           DEVSKALENNTGCVKFAKDDQSTLNTLRAQFNDSTGNIST
Sbjct: 601 DEVSKALENNTGCVKFAKDDQSTLNTLRAQFNDSTGNIST 640

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/654 (76%), Positives = 546/654 (83%), Gaps = 19/654 (2%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATG------QPRI 54
           MMDNQAVKSLLEMGIPHEVA+DAL RTGGNLEAAVNFIFSNELPEQ  TG      QPRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQADTGGEGGAGQPRI 60

Query: 55  SENRVVPDAGAGAYDVPNSGDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX- 113
           SENR++  AG+ +YDVPNSGDQ                                      
Sbjct: 61  SENRMM--AGSNSYDVPNSGDQEDIDMADVAGGEADYDDEDDEDITENHSGSSSSNERGP 118

Query: 114 -----XHYSISETSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASM 168
                 HYSISETS+ PPSY+IVQ N+FK AVDDPTVVLPLPLNSLIESYFGLFALL S+
Sbjct: 119 AARDYDHYSISETSIAPPSYNIVQQNEFKCAVDDPTVVLPLPLNSLIESYFGLFALLVSV 178

Query: 169 YFPHVFLKPDFQDLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPH 228
           YFPHVFLKPDFQDLNY PDWFKGSSF  P+YRLAYRE+ DGS TSEIV+ASG S D+QP 
Sbjct: 179 YFPHVFLKPDFQDLNYSPDWFKGSSFTGPKYRLAYREADDGSATSEIVLASGSSDDLQPR 238

Query: 229 LLWQLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDL 288
           LLWQLQKLISV+NT+MCERAFVSA+LFTLSLEPQLK+KLADSEHLYEVLPTFIKSLAVDL
Sbjct: 239 LLWQLQKLISVINTRMCERAFVSARLFTLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDL 298

Query: 289 EMCPGIRDRETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXX 348
           EMCPGIRDRETRNLFISSALHTP+KNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP  
Sbjct: 299 EMCPGIRDRETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEE 358

Query: 349 XXXXXXVVYGGDGAHQ-----EPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEF 403
                     G G  +     EPENTLKEVAPVLTILFNELETNTES+TLPNGVD+PLEF
Sbjct: 359 ENDEEDATRNGGGGQEDEEFAEPENTLKEVAPVLTILFNELETNTESMTLPNGVDIPLEF 418

Query: 404 YPQLYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQAD 463
           YPQLYTKRCKDQLIRH+ISKRKQAR++SR+LLQEINNLKSYQGKNIST+LESTLAYLQA 
Sbjct: 419 YPQLYTKRCKDQLIRHVISKRKQARIRSRTLLQEINNLKSYQGKNISTVLESTLAYLQAS 478

Query: 464 TKDADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLI 523
             DA+N+A++QIASLKDTLNS+R+AKMEEYKDLASK+HGEW+LSHPE HII TAKQL LI
Sbjct: 479 PNDANNKAARQIASLKDTLNSTRSAKMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLI 538

Query: 524 ENPYILSMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYAS 583
           ENPYIL++A LSPYSYF R+R+G WSW+QSN LGTEFKI  C SPSVVQEAI+HGTKYAS
Sbjct: 539 ENPYILTLAALSPYSYFLRNRNGVWSWVQSNALGTEFKIKNCPSPSVVQEAIKHGTKYAS 598

Query: 584 EMPLMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLNTLRAQFNDSTGN 637
           E PLMFIYCEEG+IPT++EVSKAL+NNTGC KFAKDD+++L TLR+ FND   N
Sbjct: 599 ETPLMFIYCEEGKIPTEEEVSKALQNNTGCSKFAKDDENSLRTLRSHFNDDNDN 652

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/649 (76%), Positives = 548/649 (84%), Gaps = 14/649 (2%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATG------QPRI 54
           MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQ   G      QPRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENDGSQPRI 60

Query: 55  SENRVVPDAGAGAYDVPNSGDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 114
           SEN++V  AG    DVPN+GDQ                                      
Sbjct: 61  SENKIV--AGTKPCDVPNNGDQDIDMPDVSGVDVDYDDDEDITDERSGSNSTSGCRVTAQ 118

Query: 115 HY---SISETSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFP 171
           +Y   SISETS+PPPSYSIVQHN+FKS V DPTVVLPLPLNSLIESYFGLFALL ++YFP
Sbjct: 119 NYDRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFP 178

Query: 172 HVFLKPDFQDLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLW 231
           HVFLKPDF+DLNYR DWFKGSSF EP+YRLAY E+ DGSTTSEIV+ASGP++ +QPHLLW
Sbjct: 179 HVFLKPDFKDLNYRADWFKGSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLW 238

Query: 232 QLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMC 291
           QLQKLISVVNT+ CERAFVSAK+FT SLEPQL++KLADSEHLYEVLP FIKSLAVDLEMC
Sbjct: 239 QLQKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMC 298

Query: 292 PGIRDRETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXX 351
           PGIRDRETR+LFISSALHTP+KNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP     
Sbjct: 299 PGIRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEE 358

Query: 352 XXXVVYGGD---GAHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLY 408
              V+ GG+     + EPENTLKEVAPVLTILFNELETNTESV+LPNGVD+PLEFYPQLY
Sbjct: 359 EEDVIRGGEQEEARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLY 418

Query: 409 TKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKDAD 468
           TK+CKDQLIRHIISKRKQAR +SR LLQEIN LKSYQGKNISTILESTLAYLQ    DA+
Sbjct: 419 TKQCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPDDAN 478

Query: 469 NEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYI 528
           NEA+KQIASLKDTLNS+RAAKMEEYKDLASKLHGEWNLSHPE HIINTAKQLGLIENPYI
Sbjct: 479 NEAAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYI 538

Query: 529 LSMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLM 588
           L+MA LSPYSYF R R+G WSWIQSNTLGTEFK+ KCSSPSVVQEAI+HGTKYASE PLM
Sbjct: 539 LTMAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLM 598

Query: 589 FIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLNTLRAQFNDSTGN 637
           FIYCEEG+IPT++ V++AL++N+GC+KFA+DDQ++L TLR+QF D  G+
Sbjct: 599 FIYCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRSQFFDGMGD 647

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score = 1013 bits (2619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/651 (76%), Positives = 546/651 (83%), Gaps = 17/651 (2%)

Query: 1   MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQ------PRI 54
           MMDNQAVKSLLEMGIPHEVAV+ALQRTGGNLEAAVNFIFSNELP+Q +         PRI
Sbjct: 1   MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTENNVELPRI 60

Query: 55  SENRVVPDAGAGAYDVPNSGDQXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 111
           SENR++      +YDVPN+G+Q                                      
Sbjct: 61  SENRIM---AGNSYDVPNNGEQDVDMPDVGGVDVDYDDDEDITDDRSGSNSTNEYRRAAQ 117

Query: 112 XXXHYSISETSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFP 171
              HYS+SETS+PPPSY+IVQHN+FKS +DDPTVVLPLPLNSLIESYFGLFALL S+YFP
Sbjct: 118 EYDHYSVSETSIPPPSYNIVQHNEFKSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFP 177

Query: 172 HVFLKPDFQDLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLW 231
           HVFLKPDFQDLN+RPDWFKG+SF EP+YR+AYRE+ DGSTTS+IV+ASGPS ++QPHLLW
Sbjct: 178 HVFLKPDFQDLNFRPDWFKGTSFTEPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLW 237

Query: 232 QLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMC 291
           QLQKLISVVNT+MCERAFVSAKLFTLSLEPQLK+KLA+SEHLYEVLP FIKSLAVDLEMC
Sbjct: 238 QLQKLISVVNTRMCERAFVSAKLFTLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMC 297

Query: 292 PGIRDRETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXX 351
           PGIRD+ETRNLFISSALHTP+KNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYP     
Sbjct: 298 PGIRDQETRNLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEE 357

Query: 352 XXXVVY-GGDGAHQE----PENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQ 406
              V+  GG G  +E    PENTLKEVAPVLTILFNELETNTESVTLPNGVD+PLEFYPQ
Sbjct: 358 EEEVIRRGGTGQEEERYVEPENTLKEVAPVLTILFNELETNTESVTLPNGVDMPLEFYPQ 417

Query: 407 LYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKD 466
           LYTKRCKDQLIRHIISKRKQARV+SR LL+EI+ LKSYQGKN  TILESTLAYLQ    D
Sbjct: 418 LYTKRCKDQLIRHIISKRKQARVRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDD 477

Query: 467 ADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENP 526
           A+NEA+ QIASLKDTLNS R+AKMEEYKDLASKLHGEWNLSHPE HIINTAKQLGLIENP
Sbjct: 478 ANNEAASQIASLKDTLNSMRSAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENP 537

Query: 527 YILSMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMP 586
           Y+L+MA +SPYSYF R+R+G WSWIQSNTLGTEFK+NKCSS SVVQEAIRHGTKYASEMP
Sbjct: 538 YVLTMAAISPYSYFIRNRNGVWSWIQSNTLGTEFKVNKCSSASVVQEAIRHGTKYASEMP 597

Query: 587 LMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLNTLRAQFNDSTGN 637
           LMFIYCEEG+IPT++ V KAL++N GC KFAKDDQS+L TL +QF D   N
Sbjct: 598 LMFIYCEEGKIPTEEVVEKALDSNNGCSKFAKDDQSSLRTLHSQFIDGIDN 648

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/643 (45%), Positives = 398/643 (61%), Gaps = 36/643 (5%)

Query: 1   MMDNQ-AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFS-----NELPEQVATGQPRI 54
           M DN+ +VKS+++MGIP +VA+DAL R  G+LEAAVNFIFS     N + E V   +   
Sbjct: 1   MNDNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELPDNNMGESVGNEKYTT 60

Query: 55  SENRVVPDAGAGAYDVPNSGDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 114
           SE+           ++ N  +                                       
Sbjct: 61  SEH----------VNISNDNNFQAGDLSEVMNVSNYGYDNRFETDSGDLSSDEVSDPEIV 110

Query: 115 HYSISETSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVF 174
              IS  +L  P+Y+IV+H   K+++ DPTVV+PLP NS+IESYFGLF++  S+Y PH+ 
Sbjct: 111 ENDIS-NNLKLPAYNIVKHEVEKTSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLPHLL 169

Query: 175 LKPDFQDLNYRPDWFKGSSFAEPRYRL-AYRESS---DGSTTSEIVVASGPSKDVQPHLL 230
           LKPDF+DLNY  +W+ G  F  P++ +  + E S   D  T+ E +       D QP LL
Sbjct: 170 LKPDFKDLNYDNEWYNGLKFVAPKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPKLL 229

Query: 231 WQLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEM 290
           WQLQKL +++N+ M ER++VS+KLF+L L+   K KL D+EHLYEVLP+FIK L  +LEM
Sbjct: 230 WQLQKLSTIMNSTMSERSYVSSKLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEM 289

Query: 291 CPGIRDRETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXX 350
           CP  R  E RN  ISSA + P  +EPP++T L+LFHFLP+EY+SNLYKMFN+LLY     
Sbjct: 290 CPDFRPDEIRNELISSAYYLPSDDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYADDE- 348

Query: 351 XXXXVVYGGDGAHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLYTK 410
                   GDGA  E  N+L  +AP LTI+F+E++  +    LP GV +PLEFYPQLYTK
Sbjct: 349 -------DGDGAIDEG-NSLNYLAPNLTIIFDEIDELSSMTPLPEGVSIPLEFYPQLYTK 400

Query: 411 RCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTK----- 465
            CKDQLI+HII KR+ A+ +SR  L+++N+LKS+QGK+I   L STL +L  D +     
Sbjct: 401 ECKDQLIKHIIGKRQDAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGL 460

Query: 466 -DADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIE 524
            + + +  + +  +K+ L   +  KM  YKDL  KL+  WNLS+PE+ II TAK+LGLI+
Sbjct: 461 TEGNGKLMEGLTDIKEQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLID 520

Query: 525 NPYILSMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASE 584
            PY LSMAV+SP  Y+ + RDG W  +Q    G +F I KCSS   +Q+ +R  T++ SE
Sbjct: 521 EPYHLSMAVMSPNLYYIKKRDGTWYLVQITENGDDFDIRKCSSGVEIQDCVRQYTRHGSE 580

Query: 585 MPLMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLNTL 627
            PLMF+Y +EG IP DD V K LE NTGC++F KDDQ  LN +
Sbjct: 581 TPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEM 623

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/503 (51%), Positives = 348/503 (69%), Gaps = 18/503 (3%)

Query: 137 KSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQDLNYRPDWFKGSSFAE 196
           K  + DPTVVLPLP N L E YF LF L  + Y PH+  +PDF DLNY  +W++G S+  
Sbjct: 109 KGQISDPTVVLPLPPNFLFEGYFALFCLFVANYMPHLLARPDFIDLNYDKNWYRGDSYTN 168

Query: 197 PRYRLAYRESSDGSTTSEIVVA-------SGPSKDVQPHLLWQLQKLISVVNTKMCERAF 249
             YRL Y  S +GS   +I +              +Q  LLWQLQKL SV N++M +RA+
Sbjct: 169 AEYRLKYL-SKNGSDDEQIEIVPKDELTQEDGDYTLQSELLWQLQKLASVANSRMSDRAY 227

Query: 250 VSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETRNLFISSALH 309
           V AK+F +++EPQ++  +A++EHL+EVLP+FIKS+AVDLEMCP  +D E R  FISSA H
Sbjct: 228 VRAKMFAIAVEPQVQRNMAEAEHLHEVLPSFIKSVAVDLEMCPNFQDNEVRECFISSAFH 287

Query: 310 TPDKNEP----PMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVVYGGDGAHQE 365
           TP  + P     M+T+LSLFHFLPEEY++NLY+MFN LL+              D    E
Sbjct: 288 TPSNSAPQEESTMKTWLSLFHFLPEEYETNLYRMFNALLFADDSVESDQ----SDSPDGE 343

Query: 366 PENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHIISKRK 425
            EN+L E+APV TI+F+E+E  TE+V L  GV++PLEFYPQLYTK CKD+LI+HII+KR+
Sbjct: 344 GENSLSEIAPVFTIVFDEMEETTEAVPLAEGVEMPLEFYPQLYTKECKDKLIKHIIAKRR 403

Query: 426 QARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKDADNEASKQIASLKDTLNSS 485
           Q++  SR++LQEI +LKS+QGK++S  + S+L YLQ D K    E  K +  LKD + + 
Sbjct: 404 QSQTDSRAILQEITDLKSFQGKDLSKFINSSLDYLQKDEKSP--ELIKGLLDLKDQITNK 461

Query: 486 RAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSPYSYFTRDRD 545
           +  KM EYK++A +L  EWNLS PEI I+ TAK+LGLI++ Y+L+MAV+SPY Y+TR+RD
Sbjct: 462 KTKKMNEYKEIAHRLQSEWNLSLPEIQIVKTAKELGLIDDSYLLTMAVISPYMYYTRNRD 521

Query: 546 GEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTDDEVSK 605
           G+W ++QS      + +  CSSP  +Q+AI+  T+  SE PLMFIYC++G IP DD V K
Sbjct: 522 GQWFFVQSTPYEASYNVRACSSPLEIQDAIKQHTRRPSEAPLMFIYCKKGFIPDDDTVLK 581

Query: 606 ALENNTGCVKFAKDDQSTLNTLR 628
           ALENN GC +FAKDDQ  LN ++
Sbjct: 582 ALENNQGCHRFAKDDQLQLNKMQ 604

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%)

Query: 1  MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVA 48
          M D  AV+SL+EMGI  +VA DAL+RT G++EAA NFIF N+ P Q++
Sbjct: 1  MNDTDAVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAPAQIS 48

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/522 (49%), Positives = 372/522 (71%), Gaps = 19/522 (3%)

Query: 122 SLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQD 181
           +L PPSY IV+H+  KS + DPTV+LPLP NS+IE+YF L++L  + Y PH+ ++PDF+D
Sbjct: 135 NLLPPSYQIVKHSDHKSRLRDPTVILPLPPNSMIENYFALYSLCITNYLPHIIMRPDFKD 194

Query: 182 LNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDV-----QPHLLWQLQKL 236
           L++  DWFKGSSF++P+  L   +S    TTS+  +   P +D+     QP LLWQLQKL
Sbjct: 195 LSFTEDWFKGSSFSKPKNVL---KSVTDETTSKSTMKICPIEDMNQDDDQPELLWQLQKL 251

Query: 237 ISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRD 296
            S+VN+ M ERA+V AK+F++ L+ Q + +LA+++HL EVLP+FIK L V+LE CPG  +
Sbjct: 252 SSIVNSTMSERAYVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLVVNLESCPGFEE 311

Query: 297 RETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVV 356
            E R LFISSA +TP  ++ P+ T LSLFHFLP+EYDSNLYKMFNVLLYP          
Sbjct: 312 DEIRKLFISSAFYTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLYPDENDSDYE-- 369

Query: 357 YGGDGAHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLYTKRCKDQL 416
             GD + Q   N+L +++P+L+I+F+E E  +  ++LP GV+VPLEF+PQ+YTK CK++L
Sbjct: 370 -SGDESEQG--NSLGDISPILSIVFDEAEEGSSGISLPEGVEVPLEFFPQIYTKDCKNKL 426

Query: 417 IRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKDADNEASKQIA 476
           I+HII+KRK A+ KS+ +L +IN++KS+QGK+I   + S+L YL+ D K +DN  ++++ 
Sbjct: 427 IKHIIAKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNK-SDN-ITEELL 484

Query: 477 SLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSP 536
            +K+ +   +  KM EY+DLA KL  EWN+S+PE HI+ T ++LGLI  PY+L MAVLSP
Sbjct: 485 KIKNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMAVLSP 544

Query: 537 YSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGR 596
           YSY+ R+R G+W+ +Q +T G +F + +CSS   V++ I+  T++ASE PLMF+YC    
Sbjct: 545 YSYYIRERTGKWNLVQCSTTGGDFDVRECSSELEVKDTIKQATRHASETPLMFMYCRRDV 604

Query: 597 IPTDDEVSKALENNTGCVKFAKDDQSTLNTLRAQFNDSTGNI 638
           IP + E+ K+ E+N+GC+ F K+DQ  LN +    N+S  NI
Sbjct: 605 IPEEYEIRKSFESNSGCLNFFKEDQLVLNKM----NNSDENI 642

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 38/53 (71%)

Query: 2  MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQPRI 54
          ++  ++ SL+EMGIP ++A+DAL R  GNLEAAVNFIFSNELP +       I
Sbjct: 4  LNENSINSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAENSDIEI 56

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score =  513 bits (1322), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 276/634 (43%), Positives = 396/634 (62%), Gaps = 54/634 (8%)

Query: 4   NQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNEL---PEQV-ATGQPRISENRV 59
           NQ+++ LL+MGI HEVAVDAL RT G+LEA+VN+IFS EL    E V  T     SEN +
Sbjct: 5   NQSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGELQATTEHVDLTQDDSDSENGI 64

Query: 60  VPDAGAGAYDVPNSGDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHYSIS 119
            P  G     +PN+ +                                         +I 
Sbjct: 65  KP--GMLNDVIPNTDN------------------------------VTTVETREVENTIP 92

Query: 120 ETSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDF 179
           +  L P           K +++DPTVVLPLP N+L+E+YF LF L   + FPH FLKPDF
Sbjct: 93  DDVLAPSGIMDSTTQLLKDSLNDPTVVLPLPPNALLENYFALFCLSVGISFPHHFLKPDF 152

Query: 180 QDLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLWQLQKLISV 239
           QDLNY  +WFKG  +++P YRL +  +++ S   +  +    S  +QP LLWQ QK I+V
Sbjct: 153 QDLNYNRNWFKGY-YSKPEYRLQFSSNNNVSIVPKAQLTIQDSLTLQPELLWQFQKFIAV 211

Query: 240 VNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRD-RE 298
           +N+ + +R FVSAK+F   LEP +  KL   +HL+EVLP+FIKSLA D+EMC    D R+
Sbjct: 212 LNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSLANDVEMCLLKEDARD 271

Query: 299 TRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVVYG 358
            R LFIS+A H P K+E  +ET +SL HFLPEEYD+NLY+MFN LLYP            
Sbjct: 272 IRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTLLYPEEDE-------- 323

Query: 359 GDGAHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLYTKRCKDQLIR 418
                +E EN+L  +AP+LT++F+E++ +TE+V+L  GVDVPL+FYPQ+YTK  KD LI 
Sbjct: 324 ---DGEEVENSLGNLAPMLTVVFDEMDESTENVSLQQGVDVPLKFYPQIYTKSSKDSLIN 380

Query: 419 HIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQAD---TKDADNEA-SKQ 474
           H+I+KRK+A+  S ++LQ++N LKS+QGK+I++ L ST+ +   D     D D E   K 
Sbjct: 381 HVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNSTVDFAAKDPLFQNDKDTEELLKS 440

Query: 475 IASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVL 534
           + S+K+ + + +  KMEEYK+++  +H +WNLSHP++++++ AK++GLI+ PY+L+ A+L
Sbjct: 441 LVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLYVVDAAKKMGLIDEPYLLTSAIL 500

Query: 535 SPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEE 594
           SPY Y+ R RDG W  + S   G++ + +  + P  V E+I+  T++ASE PLMF YC+E
Sbjct: 501 SPYHYYIRKRDGIWYRVISEANGSDLEAS-ITEPHEVSESIKLATRHASETPLMFTYCKE 559

Query: 595 GRIPTDDEVSKALENNTGCVKFAKDDQSTLNTLR 628
            +I  ++ + K+LE+N G  KF K DQ+ L  L+
Sbjct: 560 SKIGNENSIRKSLEDNQGVSKFVKMDQTELEALQ 593

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score =  511 bits (1316), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 258/508 (50%), Positives = 349/508 (68%), Gaps = 18/508 (3%)

Query: 125 PPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQDLNY 184
           PP YS VQH++ KS + DPT+VLPLP NSLIE+Y  L+AL  + +F   FLKPDF+DLNY
Sbjct: 154 PPEYSTVQHSERKSDIADPTIVLPLPPNSLIENYLALYALSIANFFAIDFLKPDFKDLNY 213

Query: 185 RPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVAS--GPSKDVQPHLLWQLQKLISVVNT 242
           R +W++ SS  EP YR+ + ++ +  T +EIV A+    +   QP LLWQLQKLI+VVN+
Sbjct: 214 RKEWYRSSSIDEPFYRVKFNKADE--TENEIVPAAELTETDHPQPKLLWQLQKLIAVVNS 271

Query: 243 KMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETRNL 302
            + ERA+VSAK+F  S   QL++KL D+EHL EVLP FIK+LAVDLE C G +  + + L
Sbjct: 272 DLSERAYVSAKIFNSSSNQQLQSKLGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKL 331

Query: 303 FISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVVYGGDGA 362
           FISSA + P +NEP  ET+LS FHFLPEEYD+NLYKMFNVLL P            G+  
Sbjct: 332 FISSAFYKPSQNEPLQETYLSFFHFLPEEYDTNLYKMFNVLLIPDEDDEE-----SGESD 386

Query: 363 HQEPENTLKEVAPVLTILFNELETNTESVTLPN----GVDVPLEFYPQLYTKRCKDQLIR 418
             +P+N+L  ++P LTI+FNE++ +T+     +    GVD+P EFYPQLYTK+CKD+LI+
Sbjct: 387 EDQPDNSLNIISPFLTIVFNEMDESTDDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIK 446

Query: 419 HIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADT--KDADN-EASKQI 475
           HI+SKRK+++ K + +LQEIN LKSY GK+I   L ST+ +LQ D+  +  D+ E ++++
Sbjct: 447 HILSKRKESKSKLKVILQEINALKSYHGKDILMFLNSTIDFLQKDSNAESTDHLEVAQEL 506

Query: 476 ASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLS 535
             L+  +N  +A   +EYK+L+ KLH EWNLS+P++HII TAK LGLI+ PY+L+  V+S
Sbjct: 507 NDLRAQINGRKAGLKDEYKELSQKLHNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVIS 566

Query: 536 PYSYFTRDRD--GEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCE 593
           PY YF RDR    +W  +QSN LGT+F I        V   I+  TK  +E PLMFIYC+
Sbjct: 567 PYFYFMRDRKKVDQWCLVQSNGLGTDFHITNFLDKENVSTTIKQYTKVPNESPLMFIYCK 626

Query: 594 EGRIPTDDEVSKALENNTGCVKFAKDDQ 621
           E  I + D++ K +E N GC  F K DQ
Sbjct: 627 ENYIASQDDIWKLIEENEGCSSFIKADQ 654

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 37/52 (71%)

Query: 6  AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQPRISEN 57
          ++ SLLEMGI   VA+DALQ+  GNLEAA+N+IFSN++  +     P+ + N
Sbjct: 7  SLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQPNNN 58

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {ON}
           Anc_5.475 YOR138C
          Length = 696

 Score =  483 bits (1244), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 239/518 (46%), Positives = 341/518 (65%), Gaps = 23/518 (4%)

Query: 125 PPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQDLNY 184
           PP Y++V     K  +D PT++LPLPLNS+IE+Y  LFAL A +  P  FLK DF+DLNY
Sbjct: 164 PPKYNLVAKGPLKDELDQPTIILPLPLNSMIENYLSLFALNAVINIPQFFLKTDFKDLNY 223

Query: 185 RPDWFKGSSFAEPRYRLAYRESSDGSTTSE------------IVVASGPSKDV---QPHL 229
             +W+KG+SF  P++ L +  S+D +T +E             ++  G S  V   QP L
Sbjct: 224 NKNWYKGTSFEMPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFL 283

Query: 230 LWQLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLE 289
           LWQLQKL ++ +  M ERA+ SA++F+L    Q+++ L+ S++L +VLP FIKS+  DL+
Sbjct: 284 LWQLQKLAAINSFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQ 343

Query: 290 MCPGIRDRET-RNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXX 348
           +CP   D E+ ++LFI+SA H P+K++  +ET L+ FHF+PEEY+ NLYKMFNVLLYP  
Sbjct: 344 LCPSNSDDESPQDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDD 403

Query: 349 XXXXXXVVYGGDGAHQEP--ENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQ 406
                      D   QE    N+L + A ++T++FNE +  T  +T  +GV++PL FYPQ
Sbjct: 404 PSEN-----NEDNGEQEEVYNNSLNKAAHIITVIFNEADAYTPEMTSNSGVEIPLTFYPQ 458

Query: 407 LYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKD 466
           LY K+CKDQLI+HI+ KR+QA  +S+ LL EI  LKS++GK+IS  LES   YLQ +   
Sbjct: 459 LYFKKCKDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENP 518

Query: 467 ADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENP 526
                 + I  ++  +   + +KMEEYK L+S+LH +WNLSHPE+ II TAK LGLI+ P
Sbjct: 519 MGKNLHETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEP 578

Query: 527 YILSMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMP 586
           Y+L+  ++SPY Y+ R +DG W  +Q NTLGT+F++++  S + VQE I+  T   +E P
Sbjct: 579 YLLTTVIISPYLYYIRKKDGIWYSVQCNTLGTDFQVSQLESGAAVQEIIKAQTSRPNETP 638

Query: 587 LMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTL 624
           LMF++C E  IP +D V KA+E N GC++FAK DQ +L
Sbjct: 639 LMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSL 676

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 42/54 (77%), Gaps = 1/54 (1%)

Query: 1  MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQPRI 54
          M +N+ VK+LLEMGIP EVAVDAL RTGGNLE AV FIFSNELP Q    QP I
Sbjct: 1  MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELP-QTEQEQPYI 53

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score =  432 bits (1111), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 224/544 (41%), Positives = 335/544 (61%), Gaps = 43/544 (7%)

Query: 127 SYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQDLNYRP 186
           +Y++V + Q K+ V DPT++LP+P+NSL+E+Y  L  L  ++  P  FL+PDF+DLNY  
Sbjct: 156 NYNVVTYTQLKARVTDPTIILPVPMNSLLENYLALIMLAIAINIPTPFLRPDFKDLNYEN 215

Query: 187 DWFKGSSFAEPRYRLAYRESSDG-----STTSEIVVASGPSK-------DVQPHLLWQLQ 234
           DW+KG+S + P Y L  +   D      S  S+  +  G  +       D+QP LLWQLQ
Sbjct: 216 DWYKGNSLSIPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQ 275

Query: 235 KLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGI 294
           KLISVVN+ + ER+++S K+F+L L P ++  LA+ E+L +VLP F KSLA ++E C  I
Sbjct: 276 KLISVVNSTLSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAI 335

Query: 295 -------------------------RDR-ETRNLFISSALHTPDKNEPPMETFLSLFHFL 328
                                    R R E  +LF+S+A +        ++T ++   F 
Sbjct: 336 FGSDITENDKVDNADNDNNNGNSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFS 395

Query: 329 PEEYDSNLYKMFNVLLYPXXXXXXXXVVYGGDGAHQEPENTLKEVAPVLTILFNELETNT 388
           PEEY+SNLYKMFN LL+P         V  GD         L  +AP+ T++F+ +++ T
Sbjct: 396 PEEYESNLYKMFNTLLFPEIDNPSKTAVSEGDVPGT---GCLDYIAPIFTVVFHAMDSTT 452

Query: 389 ESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKN 448
           + V LP GVD+P+EFYPQLYT  C+D L+R +  +RK+A   S+ LLQ+ N L+S+QGK+
Sbjct: 453 DEVDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKD 512

Query: 449 ISTILESTLAYLQADTKDADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSH 508
           I+  L+ST+ YL  D   ++ +A +++  L+  +N+++   ME+YK L++ L G  N+SH
Sbjct: 513 ITMFLKSTMDYLTKDCG-SETKALEEMKILETLINNAKNTIMEDYKALSADLQGPLNVSH 571

Query: 509 PEIHIINTAKQLGLIEN-PYILSMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSS 567
           PE+ II+ AK   LI++ PY+L+MAV+SP +YF R+R G+W  ++ N + TEF+I +C S
Sbjct: 572 PEVSIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTEFQITECES 631

Query: 568 PSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLNTL 627
              VQ AI+  T +A+E PLMFIYC +  I  D  + K LE+N GC++F+KDDQ  L+ L
Sbjct: 632 IRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCLQFSKDDQIALDVL 691

Query: 628 RAQF 631
           R Q 
Sbjct: 692 RQQI 695

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (79%)

Query: 1  MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELP 44
          M  N +V SL+EMGIP EVAV+AL R  GNLEAAV FIFSNE+P
Sbjct: 1  MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIP 44

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  418 bits (1074), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 214/500 (42%), Positives = 309/500 (61%), Gaps = 18/500 (3%)

Query: 135 QFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQDLNYRPDWFKGSSF 194
           Q K+  +DP VV P   N+L E+YF LF L   + FPH FL+PDFQDL Y  DW+KG  F
Sbjct: 102 QLKNRPEDPLVVRPASGNALFENYFALFCLAVGLGFPHHFLEPDFQDLTYGQDWYKGQ-F 160

Query: 195 AEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLWQLQKLISVVNTKMCERAFVSAKL 254
            +P YR+ +  + D S   +  + S  +  +QP LLWQ QK ++V N+  C R +V+A+ 
Sbjct: 161 LKPAYRVKFENNDDVSIVPQETLTSQDNLILQPELLWQFQKFLAVQNSPQCRRKYVTARY 220

Query: 255 FTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETRNLFISSALHTPDKN 314
            T  LEPQ+  KL +S+HL+E LP+FIKSLA D+E+CPG      + LFIS+A + P   
Sbjct: 221 LTKVLEPQVVEKLNNSDHLHEALPSFIKSLANDVELCPGAHS--VKELFISTAYYKPVSE 278

Query: 315 EPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVVYGGDGAHQEPENTLKEVA 374
             P+ET +SL HF+PEEYD+N+YKMFN LLYP             D    + +N+L  +A
Sbjct: 279 PEPIETLVSLLHFMPEEYDTNIYKMFNALLYPDS---------NEDAEMDDIQNSLGNLA 329

Query: 375 PVLTILFNELETNTESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHIISKRKQARVKSRSL 434
           P++TI+F+E++ +TE  TLP+GVDVPLEFYPQLYT+  K+ LI+ +      ++ ++RS+
Sbjct: 330 PMITIVFDEMDESTEQATLPHGVDVPLEFYPQLYTEEAKNLLIKEVTKLSADSQTQARSI 389

Query: 435 LQEINNLKSYQGKNISTILESTLAYLQADTKDADNEASKQ-----IASLKDTLNSSRAAK 489
           L+ +N+LKS+QGK I + L S L ++  D      ++  Q     +  +K  L S +  K
Sbjct: 390 LRNLNDLKSFQGKQIHSFLNSALDFITKDMSGVSEQSGVQELVDSLQEVKQQLGSKKTEK 449

Query: 490 MEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSPYSYFTRDRDGEWS 549
           M +YK ++ +L+ E NLSHPE+ II  AK LGLI+ PY+L+ AV+S  +YF R  +G+W 
Sbjct: 450 MAQYKAVSHRLNNELNLSHPELGIIQRAKDLGLIDEPYLLTSAVISASNYFIRQNNGQWF 509

Query: 550 WIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTDDEVSKALEN 609
            +   +      + K  + S V  AIR  T+ ASE PLMF Y +   I T+ +V +A+ +
Sbjct: 510 HVVGRSNSEHMDVTKTDA-STVSSAIRFHTRCASESPLMFTYFKPSAIDTEAQVKEAVGH 568

Query: 610 NTGCVKFAKDDQSTLNTLRA 629
           N G   FA+ DQ  +NTL A
Sbjct: 569 NKGAKLFAEQDQKHINTLSA 588

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 36/45 (80%)

Query: 2  MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQ 46
          M   A++SLL+MGI  EVA++AL +T G++E +VN+IFS ELP+Q
Sbjct: 1  MSENAIQSLLDMGITREVAIEALAKTNGDVENSVNYIFSGELPQQ 45

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  417 bits (1073), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 213/515 (41%), Positives = 321/515 (62%), Gaps = 17/515 (3%)

Query: 125 PPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQDLNY 184
           PP YS   +   KS  DDPTV+L L  + L+ +YFGLF++  +++ P +F+ PDF +LN+
Sbjct: 160 PPVYSKGTYKVQKSLPDDPTVLLSLEPSKLLSNYFGLFSMSLALFAPDLFMGPDFVNLNF 219

Query: 185 RPDWFKGSSFAEPRYRLAYRESSDGSTTS--EIVVASGPSKD-----VQPHLLWQLQKLI 237
             +W KG     P Y + Y  + +       EIV A   S+       QP++LWQLQK+I
Sbjct: 220 NDNWNKGLQIDTPEYEVKYTHNLEPGLEDRIEIVNAINLSEKERELTYQPYILWQLQKVI 279

Query: 238 SVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDR 297
           S++N+++  RA++S+ +++L L+   + KL ++ HLY++LPTFI+SL  D +  P +   
Sbjct: 280 SIMNSQISSRAYISSGIYSLCLDDNTQKKLMETSHLYDILPTFIRSLMNDCKHVPDLDQN 339

Query: 298 ETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLY--------PXXX 349
             +N+F+S A H    ++ P +  L LFHFLPEEYDSNLYKMFN LLY        P   
Sbjct: 340 RMKNMFVSKAFHQIPIHKEPTKVSLFLFHFLPEEYDSNLYKMFNSLLYRSYDEPIYPRTN 399

Query: 350 XXXXXVVYGGDGAHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLYT 409
                     D    E E++L E++ +LT++F+EL+ +TE +T P+GV++P EFYP+LYT
Sbjct: 400 QNSADSSSSDDEISNEEESSLDEISTILTVIFDELDQDTELITQPDGVEIPFEFYPELYT 459

Query: 410 KRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKDADN 469
           K+CK++LI  I+  R Q ++K + +L ++N+LKS++GK+I   L STL YLQ D K+   
Sbjct: 460 KKCKEKLINGILHTRYQNKLKMKEVLNDLNSLKSFEGKDILRFLNSTLEYLQRDGKEG-- 517

Query: 470 EASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYIL 529
               +++ +K+ L+ ++  KM EYK ++  L  EWN+  PE+ II  A+ LGLI +P++L
Sbjct: 518 PMVNKLSYVKEQLSRAKTEKMLEYKTISRSLQNEWNIDKPELSIIEQAQDLGLIGDPHLL 577

Query: 530 SMAVLSPYSYFTRDRDGEWSWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMF 589
            MAVLSPY YF RDR   W   QS+ +GT+F+I K  S   VQ+ I+  TK ASE P+MF
Sbjct: 578 VMAVLSPYLYFFRDRRNRWFKFQSSIMGTDFEITKYESDKTVQDEIKLNTKSASETPIMF 637

Query: 590 IYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTL 624
           +YC++  IP D  V +    N GC  FA+ D+ +L
Sbjct: 638 VYCKKDAIPNDSLVLQKFAKNQGCSAFAQADEMSL 672

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 13 MGIPHEVAVDALQRTGGNLEAAVNFIF 39
          MGI  +VA   L + GGNLEAA+N IF
Sbjct: 1  MGIAKDVATSTLNKVGGNLEAAINHIF 27

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score =  409 bits (1050), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 311/496 (62%), Gaps = 17/496 (3%)

Query: 134 NQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQDLNYRPDWFKGSS 193
           N+ K+  +DP VV P   N+L E+YF LF L   + FPH FL PDF+DLNY PDW +G  
Sbjct: 107 NEVKNDQEDPLVVKPESSNALFENYFALFCLAVGLGFPHYFLGPDFKDLNYGPDWARGQ- 165

Query: 194 FAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLWQLQKLISVVNTKMCERAFVSAK 253
           F +P++R+ +  + D +      + S  +  +QP LLWQ QK ++V ++    R  VSA+
Sbjct: 166 FLKPQFRIKFETNEDVTIVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSAR 225

Query: 254 LFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETRNLFISSALHTPDK 313
             T +LEPQ+  KL ++EHL++VLP+FI+SLA D+E+CPG   +  + LFIS+A + P  
Sbjct: 226 YLTKALEPQVVEKLNNAEHLHDVLPSFIRSLANDVELCPG--SQSIKELFISTAYYKPAS 283

Query: 314 NEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVVYGGDGAHQEPENTLKEV 373
              P+ET +SL HF+PEEYDSN+YKMFN LLYP        V        +E +N+L  +
Sbjct: 284 EPVPIETLVSLLHFMPEEYDSNIYKMFNALLYPNDADDDDDV--------EETQNSLGNL 335

Query: 374 APVLTILFNELETNTESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHIISKRKQARVKSRS 433
           A ++TI+F+E++ +T+ + LP+GV+VP++FYPQLYT+  K  LI+ +     + + ++ S
Sbjct: 336 ASMITIVFDEMDESTDDIRLPHGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHS 395

Query: 434 LLQEINNLKSYQGKNISTILESTLAYLQADTKDAD-----NEASKQIASLKDTLNSSRAA 488
           +L+ +N LKS+QGK+I + L STL ++  D+         N+    +  +K  L+  +  
Sbjct: 396 ILKTLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTD 455

Query: 489 KMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSPYSYFTRDRDGEW 548
            M EYK ++ KL+ +WNLSHPE+ II   ++LGLI+ PYIL+ AV+SP++YF R RD +W
Sbjct: 456 GMAEYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKRDSQW 515

Query: 549 SWIQSNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTDDEVSKALE 608
             +          + K  + +V    IR  T+ ASE PLMF Y +E  I T++ +++A+E
Sbjct: 516 YHVLGKQHNDALNVAKTDAETVTN-TIRLNTRTASETPLMFTYFKESAIDTNETLTEAIE 574

Query: 609 NNTGCVKFAKDDQSTL 624
            NTG   FA+ DQS+L
Sbjct: 575 KNTGVTSFAEQDQSSL 590

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 38/51 (74%)

Query: 2  MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQP 52
          M   A+KSLL+MGI  +VA++AL +T G++E +VN+IFS ELP+Q    +P
Sbjct: 1  MSESAIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKP 51

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  382 bits (982), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/489 (44%), Positives = 295/489 (60%), Gaps = 56/489 (11%)

Query: 137 KSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQDLNYRPDWFKGSSFAE 196
           KS V DPTVV+PLP +SL E+YF LF+L    Y PH+  KP+  DL Y P W +GSS   
Sbjct: 113 KSLVTDPTVVIPLP-HSLFENYFALFSLSMCQYLPHLMAKPELGDLMYNPKWAQGSS--- 168

Query: 197 PRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLWQLQKLISVVNTKMCERAFVSAKLFT 256
                      D ST+                 + QLQ+L SVVN    +R +VSAKLF 
Sbjct: 169 -----------DPSTS----------------FIQQLQRLCSVVNASFSDRCYVSAKLFA 201

Query: 257 LSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETRNLFISSALHTPDKNEP 316
             L+  LK KLA++EHL+EVLP+FI+SL   LE C    + + R+LF+SSAL +  K   
Sbjct: 202 AVLDAPLKRKLAEAEHLHEVLPSFIRSLIHALEECGCYAEDQIRSLFVSSALSSECK--- 258

Query: 317 PMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVVYGGDGAHQEPENTLKEVAPV 376
              + LS+  F+PEEY+S+LY MFN LLYP                 +E  N+L ++APV
Sbjct: 259 ---SLLSVLQFMPEEYESSLYAMFNALLYPELEEG------------EESGNSLLDLAPV 303

Query: 377 LTILFNELETNTESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHIISKRKQARVKSRSLLQ 436
           LTI+F+E++ +TE VT   GVDVPLEFYPQLYTK  KD ++R +  +RK A+ +SR +L 
Sbjct: 304 LTIVFDEMDADTE-VTSNRGVDVPLEFYPQLYTKSVKDAIVRPLQQQRKAAQERSRQVLA 362

Query: 437 EINNLKSYQGKNISTILESTLAYLQADTKDADNEASKQIASLKDTLNSSRAAKMEEYKDL 496
           E+N LKSYQGK+    + STL YLQ D +    E   ++ SLK+++   +  +  EYK+L
Sbjct: 363 EMNGLKSYQGKDTLKFINSTLDYLQRDNQ--SKEIIDKLESLKNSIADHKTQRKNEYKEL 420

Query: 497 ASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSPYSYFTRDRDGEWSWIQSNTL 556
           + KLHGEWNLSHP  ++IN A + GLI+ PY+L+M VLSP  Y  R R G+W  I++++ 
Sbjct: 421 SQKLHGEWNLSHP-TYLINEAMERGLIDEPYLLAMVVLSPGHYLQRSRSGQWKMIRTDS- 478

Query: 557 GTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTDDEVSKALENNTGCVKF 616
               +I+ C +PS VQ  IR  T + S+ PLM +Y +   +  D  VSK+LE+N G   F
Sbjct: 479 -NMIRISDC-APSQVQATIRQHTTFPSKTPLMLLYVKSSHVSVDTIVSKSLESNEGITNF 536

Query: 617 AKDDQSTLN 625
            + DQ  LN
Sbjct: 537 LRIDQEELN 545

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (72%)

Query: 6  AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATGQPR 53
          A +SL+EMGI  EVA  ALQ+T GNLEAAVN+IFS E+ +     QP+
Sbjct: 3  AQQSLIEMGITPEVAQRALQQTHGNLEAAVNYIFSGEVSDDQPVNQPQ 50

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score =  378 bits (970), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 204/501 (40%), Positives = 301/501 (60%), Gaps = 27/501 (5%)

Query: 157 SYFGLFALLASMYFPHVFLKPDFQDLNYRPDWFKGSSFAEPRYRLAYRESSDGS---TTS 213
           +Y  LFA   + Y P  F++ DF++LNY  +W+ G +  +P   ++   +  GS      
Sbjct: 176 NYLVLFAFAVATYAPLQFVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVPE 235

Query: 214 EIVVASGPSKDVQPHLLWQLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHL 273
           E V +  P   VQP +LWQLQ++ISV ++K+ ER++VSAK+FT   + ++++ + DS+HL
Sbjct: 236 EEVTSDTP---VQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHL 292

Query: 274 YEVLPTFIKSLAVDLEMCPGIR-DRETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEY 332
           YE LP+FIKS+  D EMCP    + + +++F+SSA+   ++   P ETFL LFHF PEEY
Sbjct: 293 YEALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEY 352

Query: 333 DSNLYKMFNVLLYPXXXXXXXXVVYGGDGAHQ--EPENTLKEVAPVLTILFNELETNTES 390
           ++NLYKMFN LLYP                    + E +LKE+AP+LTI+FNE +    S
Sbjct: 353 NANLYKMFNALLYPEDDTIDDNSSDTDSSNDTDVQVEGSLKELAPLLTIIFNEADPGQLS 412

Query: 391 -------VTLPNGVDVPLEFYPQLYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKS 443
                  +  P GV+VP  FYPQLYT+  K+Q+++ I+ +RK AR + R  L  +N LKS
Sbjct: 413 AGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQLKS 472

Query: 444 YQGKNISTILES---------TLAYLQADTKDADNEASKQIASLKDTLNSSRAAKMEEYK 494
           Y+GK     LE           ++ +++ TK+   E  +++ S+K  LN  RA   ++Y 
Sbjct: 473 YEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLKKQYV 532

Query: 495 DLASKLHGEWNLSHPEIHIINTAKQLGLIENPYILSMAVLSPYSYFTRDRDG--EWSWIQ 552
           DL++KL  EWN+S+PE  +I  AK+LGL++ P++LSM VLSPY Y  RD  G  +W+ +Q
Sbjct: 533 DLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWTLVQ 592

Query: 553 SNTLGTEFKINKCSSPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTDDEVSKALENNTG 612
           SN+ GT+  I K  +   VQ+ IR  TK A++ PLMFIYC E    + +E   A+E N G
Sbjct: 593 SNSYGTDGLITKHVTEEKVQQYIRDCTKTANDNPLMFIYCREDFFVSQEETWSAIEKNMG 652

Query: 613 CVKFAKDDQSTLNTLRAQFND 633
           C +F K DQ  L T R   N+
Sbjct: 653 CSEFNKADQLYLLTHREDRNE 673

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 41/57 (71%), Gaps = 2/57 (3%)

Query: 3  DNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELP--EQVATGQPRISEN 57
          +  AV SL EMGIP +VA+DAL+R  GNL AAVN+IFSN++P  E V   QPR S +
Sbjct: 4  EQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMPAGEHVELPQPRESSD 60

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  366 bits (940), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 238/644 (36%), Positives = 343/644 (53%), Gaps = 79/644 (12%)

Query: 7   VKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFS--NELPEQVATGQPRISENRVVPDAG 64
           V+SLLEMGI  +VA  AL+   G++EAA+N+IF+  NE+      GQ   S    VP   
Sbjct: 7   VQSLLEMGIARDVAEQALRECNGDVEAALNYIFNTPNEIDNDAMAGQQMGS----VPVGT 62

Query: 65  AGAYD------VPNSGDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHYSI 118
            G +D        N+  Q                                       Y+ 
Sbjct: 63  QGIFDDSAFKIQENNPPQSQSYSEQQLVQENLPDNTFRSDSDTNSDSDSSSSLEQSQYTS 122

Query: 119 SETSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFPHVFLKPD 178
            +  +P          QFK+ +D PTVV+P P       Y  LFAL  S++ PH F+K D
Sbjct: 123 IDDLIP---------QQFKNTMDYPTVVIPAPAVPNHIYYCALFALFISIHLPHYFVKAD 173

Query: 179 FQD--LNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLW--QLQ 234
             D  L + PDWF              RE  D                 +P L+   QL 
Sbjct: 174 HDDMPLLFSPDWFNDID----------REPED-----------------EPLLVLRDQLH 206

Query: 235 KLISVVNTK-MCERAFVSAKLFTLSLEPQLKAK---LADSE--HLYEVLPTFIKSLAVDL 288
           KLI+V N+     RAFV++K+F + L+  +++    L +    HLY++LP+FIK++A +L
Sbjct: 207 KLIAVQNSNDHSARAFVTSKMFDVDLQSVIQSNEPMLTNPNYFHLYQILPSFIKTIA-NL 265

Query: 289 EMCPGIRDRETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXX 348
                      +NLFISSA+   ++     E+ LSLFHFLPEEY+SNLYKMFNVLLYP  
Sbjct: 266 SYT-------EKNLFISSAIQGGEEASSSKESLLSLFHFLPEEYESNLYKMFNVLLYPDD 318

Query: 349 XXXXXXVVYGGDGAHQEPENTLKEVAPVLTILFNELETNTESVTLPNGVDVPLEFYPQLY 408
                     G+   +  EN+LKE+APV+TI+FNE E   E+  + NGV+VPL+FYPQLY
Sbjct: 319 DHDI------GEDEDEVSENSLKELAPVMTIIFNEAENIDENAPVTNGVEVPLKFYPQLY 372

Query: 409 TKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQADTKDAD 468
           TK+CKDQLI H++SKRK  R + + +L++I NLKSYQGK+I + + S+L YL   TKD D
Sbjct: 373 TKKCKDQLISHVLSKRKDGRKELKQILKDIGNLKSYQGKDILSFINSSLDYL---TKDKD 429

Query: 469 NEA-SKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGLIENPY 527
           +   ++++  LKD L + +  KM  YK ++ K+H EWN+ +PE+ I+ TA +LGLI+ PY
Sbjct: 430 DSGIAEELHKLKDELTAKKTEKMNSYKQISEKMHTEWNIQNPELKIVETATKLGLIDEPY 489

Query: 528 ILSMAVLSPYSYFTRDRDGEWSWIQSNTLGT---EFKINKCSSPSVVQEAIRHGTKYASE 584
            L++AV+SP+ YF R+R  EW  ++ N   T   +  + KC  P  V + +++ T   + 
Sbjct: 490 FLNLAVVSPFFYFVRNRKDEWYEVRFNPFNTAEDKISVGKCDGPGEVIQHVKNSTTVPNS 549

Query: 585 MPLMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLNTLR 628
            PLMF+Y ++  +  D E+ + L  N   + F K DQ  L    
Sbjct: 550 TPLMFVYSKDSYMADDTEMQELLSQNKTLLDFFKQDQIYLQNFE 593

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score =  358 bits (918), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 204/539 (37%), Positives = 307/539 (56%), Gaps = 77/539 (14%)

Query: 119 SETSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFP-HVFLKP 177
           S++  P  SY+       K  + DPTV+LPL  N L+E+Y  LF     M  P  +F   
Sbjct: 164 SQSFKPQASYTSTH----KLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQ 219

Query: 178 DFQDLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLWQLQKLI 237
            F DL Y   W+  S+  E             +TT++              L  QLQ++ 
Sbjct: 220 QFNDLMYNKKWYSISNNNE-------------NTTTD-------------SLFLQLQRVT 253

Query: 238 SVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDR 297
           S++N++M ERAF+S K+F+ +    L   L+ S+HL E+   FI+SL   + + P  +D 
Sbjct: 254 SIINSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPIFKD- 311

Query: 298 ETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPXXXXXXXXVVY 357
               + +++A++   +      + +S+ +FLPEEY+SNLYKMFN L+YP          Y
Sbjct: 312 ----ILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNE--------Y 359

Query: 358 GGDGAHQEPEN--------------TLKEVAPVLTILFNEL-ETNTESVTLPNGVDVPLE 402
           G +   Q  E+               L+E++P+ TILF E  E+++ S TLP GV++PL+
Sbjct: 360 GRNDDEQSDESLQTDDDDNDDANDSALEEISPIFTILFEEYDESDSSSTTLPEGVEIPLQ 419

Query: 403 FYPQLYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQA 462
           FYPQLY+K+  DQLI+HIISKRK+A+ KSRSLL EIN+LKS+QGK+I  IL+ST+ Y++ 
Sbjct: 420 FYPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEK 479

Query: 463 DTKDADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGL 522
           D++  + +++  + ++   + + +  KM++YK+L  KLH EWNLSHPE  II TAKQL L
Sbjct: 480 DSQ-RETKSANNLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNL 538

Query: 523 IENPYILSMAVLSPYSYFTRDRDGEWSWIQSNTLGTE----------------FKINKCS 566
           I++PY LSM + SP  Y  +  + +W  I   ++                   F + KC+
Sbjct: 539 IDSPYNLSMVIFSPDLYLIKKANVDWYLIDCRSINQMQNKNRNNNNNNNNPDLFVLRKCN 598

Query: 567 SPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLN 625
           S   +Q+ I+  T+  SE PLMFIYC+E  +P +D+V K+ E+N  C KF K+DQ TLN
Sbjct: 599 SEIEIQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLN 657

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 43/60 (71%), Gaps = 3/60 (5%)

Query: 1  MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVATG---QPRISEN 57
          M D + +++L++MGIP +VA +AL+   GN+EAAVN+IFSNELP Q +      PRI EN
Sbjct: 1  MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPPRIDEN 60

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  243 bits (621), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 155/495 (31%), Positives = 258/495 (52%), Gaps = 32/495 (6%)

Query: 146 VLPLPLNSLIESYFGLFALLASMYFPHVFLKPDFQDLNYRPDWFKGSSFAEPRYRLAYRE 205
           +LP   ++L+ESYF LFAL  ++  P  FL  DF++L Y P WFKG    +  YRL +R 
Sbjct: 57  ILPKGSSALLESYFPLFALCMAVNVPTKFLNVDFKELVYNPHWFKGE-LVQSDYRLVHRN 115

Query: 206 SSDGSTTSEIVVASGPSKDVQPHLLWQLQKLISVVNTKMCERAFVSAKLFTLSLEPQLKA 265
           +         +  S    ++QP L+ ++Q LI + N     R FV+++L     +  +  
Sbjct: 116 AGPLLIHKRELTGS-EYLEMQPELIPRMQLLIGIANDPESMRRFVASELINKGTDFNVSR 174

Query: 266 KLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETRNLFISSALHTPDKNEPPMETFLSLF 325
            L++ +HL EV P FIK+L  D+++C    D+ T  LF+S ALH P+  EP   T LS+ 
Sbjct: 175 ALSECDHLSEVFPQFIKNLHNDMDLCLK-DDKSTSKLFLSKALHRPNVLEPFQPTSLSVL 233

Query: 326 HFLPEEYDSNLYKMFNVLLYPXXXXXXXXVVYGGDGAHQEPENTLKEVAPVLTILFNELE 385
           +F PE Y   LY+MFN +L P              G   E EN    +APV TI+F++++
Sbjct: 234 NFSPENYAYTLYEMFNPMLLPE-----------DSGRGYEIENAFDFLAPVFTIIFDDMD 282

Query: 386 TNTESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQ 445
             TE V L +GV +P+EFYPQLYTK   ++++  ++ +    R  ++  + ++++L+S+Q
Sbjct: 283 DTTEEVNLSHGVQIPIEFYPQLYTKNALEKVVVPVLEETDALRNTNKLKVDQMSSLQSFQ 342

Query: 446 GKNISTILESTLAYLQA---DTKDADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHG 502
           GK IS+ L S++ YL+      +D   E    +  +K  L++ +   M +Y +   ++  
Sbjct: 343 GKQISSFLNSSINYLEEIPLGDEDKSKELVDTLEKIKYQLSNKKREMMADYTETQRQI-D 401

Query: 503 EWNLSHPEIHIINTAKQLGLIENPYILSMAVLSPYSY-----FTRDRDGEWSWIQSNTLG 557
             +   P   II+ AKQ+G+I+ PY+L + V SP  Y      + D         +N L 
Sbjct: 402 LLSFEGPSEKIIDLAKQVGIIDEPYLLRLVVFSPNDYIIARGISADDGNTGMETGNNNLQ 461

Query: 558 TEFKINKCSSPSVVQEAI---------RHGTKYASEMPLMFIYCEEGRIPTDDEVSKALE 608
               I +  S S+ QE +         +  T++ASE P++F+Y ++  I    ++  ++ 
Sbjct: 462 YIRNIIEFGSSSLTQEELTAQETQDITKSHTRHASETPILFVYIKKDHIDAPQDILASIS 521

Query: 609 NNTGCVKFAKDDQST 623
            N     F K++ +T
Sbjct: 522 ENETLTNFLKEEHTT 536

>Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%)

Query: 5   QAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           Q +K L+++G P +  V AL++TGGN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDTVVKALKQTGGNAEFAASLLF 427

>YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA
           damage-inducible v-SNARE binding protein with a role in
           suppression of protein secretion; may play a role in
           S-phase checkpoint control; has ubiquitin-associated
           (UBA), ubiquitin-like (UBL), and retroviral-like
           proteinase (RVP) domains
          Length = 428

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 5   QAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           Q +K L+++G P +  V AL++T GN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLF 427

>Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 5   QAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           Q +K L+++G P +  V AL++T GN E A + +F
Sbjct: 393 QTIKQLMDLGFPRDAVVTALKQTNGNAEFAASLLF 427

>NDAI0C05890 Chr3 (1349126..1350514) [1389 bp, 462 aa] {ON}
           Anc_8.185 YER143W
          Length = 462

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 7   VKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           +K L+++G P    + AL RTGGN E A   +F
Sbjct: 429 IKQLMDLGFPRNQVITALNRTGGNAEYAAALLF 461

>Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar to
            Ashbya gossypii ABR149W
          Length = 1269

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 6    AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSN 41
            A++ L  MG   E AV AL++   +LEAA NF+  N
Sbjct: 1233 AIEELSNMGFSEEEAVKALEKCKWDLEAATNFLLDN 1268

>KLLA0E10341g Chr5 complement(911148..912392) [1245 bp, 414 aa] {ON}
           similar to uniprot|P40087 Saccharomyces cerevisiae
           YER143W DDI1 DNA damage-inducible v-SNARE binding
           protein contains a ubiquitin-associated (UBA) domain may
           act as a negative regulator of constitutive exocytosis
           may play a role in S-phase checkpoint control
          Length = 414

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 24/33 (72%)

Query: 7   VKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           +K L+++G   + A++AL +TGGN++ A + +F
Sbjct: 381 IKKLVDLGFSRKEAINALNKTGGNVDYAASLLF 413

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 3   DNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSN-ELPEQVAT-GQPRISENRVV 60
           D   V S++ MG     A+ AL  TG  +E A+N+IF + E PE  A    P   +   V
Sbjct: 584 DEDKVISIISMGFSKNAALRALYNTGSEVERALNWIFEHMEDPELNAEFSVPGTKKQAAV 643

Query: 61  PDAGA 65
            D GA
Sbjct: 644 VDQGA 648

>ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} weakly
            similar to uniprot|P34216 Saccharomyces cerevisiae
            YBL047C EDE1 Key endocytic protein involved in a network
            of interactions with other endocytic proteins binds
            membranes in a ubiquitin-dependent manner may also bind
            ubiquitinated membrane-associated proteins
          Length = 1455

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 6    AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
            AV+ L  MG   + AVDAL+R   +LEAA N++ 
Sbjct: 1419 AVEELSGMGFTEQEAVDALERCKWDLEAATNYLL 1452

>Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON}
            YBL047C (REAL)
          Length = 1380

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 6    AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
            AV+ L  MG   E A +AL+R+  +LEAA NF+ 
Sbjct: 1344 AVEELSGMGFTEEEAHNALERSNWDLEAATNFLL 1377

>Kpol_1013.69 s1013 complement(167435..171169) [3735 bp, 1244 aa] {ON}
            complement(167435..171169) [3735 nt, 1245 aa]
          Length = 1244

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 6    AVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSN 41
            A++ L  MG   E A  AL+R G +LE+A N++  N
Sbjct: 1208 AIEELSGMGFSKEEATRALERCGYDLESATNYLLDN 1243

>Suva_5.271 Chr5 (427633..428919) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 23/35 (65%)

Query: 5   QAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           + +K L+++G P +  V AL++T GN + A + +F
Sbjct: 393 KTIKQLMDLGFPRDDVVKALKQTNGNADFAASLLF 427

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/64 (21%), Positives = 38/64 (59%), Gaps = 8/64 (12%)

Query: 2   MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSN-----ELPEQVATGQPRISE 56
           +D +++ ++++MG+  ++++ AL    G++ A++ ++F+N     ELP +     P+  E
Sbjct: 665 VDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGELPSETT---PKRDE 721

Query: 57  NRVV 60
             ++
Sbjct: 722 EGII 725

>NCAS0A03920 Chr1 complement(793999..795417) [1419 bp, 472 aa] {ON}
           Anc_8.185 YER143W
          Length = 472

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 7   VKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIF 39
           +K + ++G     A++AL RTGGN E A   +F
Sbjct: 439 IKQVTDLGFTRTEAINALNRTGGNAELAAALLF 471

>KAFR0G00890 Chr7 complement(211229..211933) [705 bp, 234 aa] {ON}
           Anc_7.470 YJR099W
          Length = 234

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 373 VAPVLTI--LFNELETN----TESVTLPNGVDVPLEFYPQLYTKRCKDQLIRHIISKRKQ 426
           V PV+ I  LF  +ET     T +  +    D P+ +  Q +   C    + HI++  KQ
Sbjct: 49  VRPVMAIILLFPPVETKEAVQTNNKDIDTSTDKPI-WLRQNFKNACGLYALLHILANNKQ 107

Query: 427 ARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQAD 463
                 SLL+ IN++ ++   ++S  +   + +  AD
Sbjct: 108 LLADDSSLLKFINDIPNFTDTDLSKFIIEFINHFNAD 144

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 32/55 (58%), Gaps = 5/55 (9%)

Query: 2   MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSN-----ELPEQVATGQ 51
           ++ +++ S++ MG+   ++  AL    G++ A++ ++F+N     ELPE+    Q
Sbjct: 640 INEESLNSMISMGLAQNLSRKALILNNGDINASIEWVFNNMDDNGELPEENTASQ 694

>KAFR0B02300 Chr2 (451471..452721) [1251 bp, 416 aa] {ON} Anc_8.185
           YER143W
          Length = 416

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 7   VKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFS 40
           +K L+++G      + AL  TGGN + A +F+F+
Sbjct: 383 IKQLMDLGFSRNEVIKALDATGGNADFAASFLFN 416

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,588,832
Number of extensions: 2654466
Number of successful extensions: 8643
Number of sequences better than 10.0: 61
Number of HSP's gapped: 8898
Number of HSP's successfully gapped: 79
Length of query: 666
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 550
Effective length of database: 40,180,143
Effective search space: 22099078650
Effective search space used: 22099078650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)