Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_8.1885.473ON36936918340.0
Smik_15.3165.473ON36936917650.0
YOR136W (IDH2)5.473ON36936917600.0
Skud_15.3005.473ON36936917280.0
NDAI0C014105.473ON36936916040.0
NCAS0H022505.473ON42236915950.0
SAKL0G03520g5.473ON36936915800.0
CAGL0I07227g5.473ON36836915550.0
KNAG0B040705.473ON37337315510.0
Ecym_23135.473ON37037115270.0
KLTH0F15048g5.473ON36836915190.0
Kwal_55.212735.473ON36836915150.0
Kpol_440.125.473ON36836915090.0
KLLA0E03125g5.473ON36836915060.0
AFR137C5.473ON36736915000.0
TDEL0A033705.473ON37137114980.0
TBLA0B022405.473ON37337314540.0
Kpol_543.85.473ON36836914400.0
KAFR0B063705.473ON37837814400.0
ZYRO0D11220g5.473ON36836914310.0
TPHA0J027705.473ON37637714220.0
TPHA0E014805.473ON37735812651e-174
ADL223W2.278ON3623727022e-89
Ecym_33162.278ON3623726996e-89
SAKL0E07876g2.278ON3613726841e-86
KLTH0G10186g2.278ON3603746779e-86
KLLA0F04103g2.278ON3613456771e-85
ZYRO0D02838g2.278ON3613706665e-84
Smik_14.2902.278ON3603666657e-84
YNL037C (IDH1)2.278ON3603666588e-83
Kwal_23.50122.278ON3613746571e-82
NDAI0B035902.278ON3593676561e-82
Skud_14.2932.278ON3613666492e-81
CAGL0G02673g2.278ON3583696464e-81
KNAG0A052802.278ON3613746441e-80
TBLA0B069102.278ON3653646441e-80
TPHA0D015602.278ON3603436352e-79
KAFR0J014102.278ON3503716239e-78
TDEL0C038402.278ON3613476231e-77
Kpol_1039.352.278ON3593726231e-77
NCAS0B062902.278ON3593676213e-77
Suva_14.3022.278ON3002865223e-63
KNAG0A054202.287ON3723534184e-47
Kpol_1003.392.287ON3703904176e-47
NCAS0B062502.287ON3733554151e-46
NDAI0B035502.287ON3723554115e-46
KLLA0E08339g2.287ON3693914081e-45
TBLA0B059402.287ON3693864011e-44
CAGL0G02585g2.287ON3723904011e-44
SAKL0E07656g2.287ON3683904002e-44
ADL214C2.287ON3673533958e-44
Smik_9.852.287ON3713903959e-44
YIL094C (LYS12)2.287ON3713533932e-43
ZYRO0A01914g2.287ON3683903906e-43
Suva_9.1052.287ON3713533906e-43
TPHA0C034102.287ON3713963907e-43
Skud_9.792.287ON3713533871e-42
TDEL0G021802.287ON3693913811e-41
Ecym_33262.287ON3663613704e-40
KAFR0J013602.287ON3733913697e-40
KLTH0G10384g2.287ON3673913634e-39
Kwal_27.115282.287ON3673913591e-38
AAL012C1.402ON3723522302e-20
NDAI0G042301.402ON3633572222e-19
Ecym_12961.402ON3632702187e-19
Skud_3.431.402ON3643592179e-19
KAFR0I022001.402ON3653572171e-18
Smik_3.661.402ON3643622152e-18
TBLA0C015001.402ON3653532116e-18
YCL018W (LEU2)1.402ON3643592116e-18
TDEL0B060001.402ON3623542116e-18
KLLA0D04906g1.402ON3623562108e-18
Kwal_0.2251.402ON3643562072e-17
Suva_3.31.402ON3643592063e-17
CAGL0H03795g1.402ON3653612011e-16
ZYRO0E04796g1.402ON3622682001e-16
NCAS0C048701.402ON3653571974e-16
KNAG0I012801.402ON4473541976e-16
SAKL0D08690g1.402ON3643551957e-16
KLTH0H12188g1.402ON3643521878e-15
Kpol_1048.631.402ON3643601806e-14
TPHA0B037301.402ON3653571781e-13
Suva_14.303singletonON53511002e-05
ADR028W3.425ON83258722.2
TBLA0A080104.254ON42873694.7
NCAS0A052504.152ON19534667.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_8.188
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   711   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   684   0.0  
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   682   0.0  
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   670   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   622   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    619   0.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   613   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   603   0.0  
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   602   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   592   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   589   0.0  
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   588   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   585   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   584   0.0  
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   582   0.0  
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   581   0.0  
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   564   0.0  
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   559   0.0  
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   559   0.0  
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   555   0.0  
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   552   0.0  
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   491   e-174
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   275   2e-89
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   273   6e-89
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   268   1e-86
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   265   9e-86
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   265   1e-85
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   261   5e-84
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   260   7e-84
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   258   8e-83
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   257   1e-82
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   257   1e-82
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   254   2e-81
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   253   4e-81
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              252   1e-80
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            252   1e-80
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   249   2e-79
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   244   9e-78
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   244   1e-77
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   244   1e-77
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   243   3e-77
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   205   3e-63
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              165   4e-47
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   165   6e-47
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   164   1e-46
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   162   5e-46
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   161   1e-45
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   159   1e-44
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   159   1e-44
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   158   2e-44
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   156   8e-44
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   156   9e-44
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   155   2e-43
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   154   6e-43
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   154   6e-43
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   154   7e-43
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   153   1e-42
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   151   1e-41
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   147   4e-40
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   146   7e-40
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   144   4e-39
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   142   1e-38
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...    93   2e-20
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...    90   2e-19
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...    89   7e-19
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)    88   9e-19
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    88   1e-18
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)    87   2e-18
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...    86   6e-18
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...    86   6e-18
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...    86   6e-18
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...    86   8e-18
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...    84   2e-17
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)       84   3e-17
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              82   1e-16
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...    82   1e-16
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...    80   4e-16
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...    80   6e-16
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...    80   7e-16
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...    77   8e-15
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...    74   6e-14
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    73   1e-13
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    43   2e-05
ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic ho...    32   2.2  
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    31   4.7  
NCAS0A05250 Chr1 (1038189..1038776) [588 bp, 195 aa] {ON} Anc_4....    30   7.1  

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/369 (95%), Positives = 351/369 (95%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV
Sbjct: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVVTNPSAYTNAVSVCPNLYGDI                  ANIGHKVSIFEAVHGSAP
Sbjct: 241 LNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS
Sbjct: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/369 (90%), Positives = 345/369 (93%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLRNTF RNTSRRFL+TVKQPSIG+YTGKP+PSTG+YTVSFIEGDGIGPEISKSVKKIFS
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA+VPI WEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TFGLFANVRPAKS+EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYAFEYARAIGRPR+IVVHKSTIQRLADGLFVNVAKELSKEYPDIT ETELIDN V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDITLETELIDNSV 240

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L VVTNPSAYTNAVSVCPNLYGDI                  ANIGHK+SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG+DKANPTALLLSSVMMLNHMGLT++ADQIQNAVLSTIASGPENRTGDLAG ATTSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/369 (90%), Positives = 345/369 (93%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLRNTF RNTSRRFL+TVKQPSIGRYTGKP+PSTG+YTVSFIEGDGIGPEISKSVKKIFS
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA+VPI WE CDV+PIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYAFEYARAIGRPR+IVVHKSTIQRLADGLFVNVAKELSKEYPD+T ETELIDN V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSV 240

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L VVTNPSAYT+AVSVCPNLYGDI                  ANIGHK+SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG+DKANPTALLLSSVMMLNHMGLT+HADQIQNAVLSTIASGPENRTGDLAGTATTSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/369 (88%), Positives = 340/369 (92%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLR+   RNTSRRFL+TVKQPSIGR+TGKP+PSTGRYTVSFIEGDGIGPEISKSVKKIF+
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA+VPI WE CDVNPIFVNGLTTIPD AVQSIT NL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TFGLFANVRPAKS+EGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYAFEYARAIGRPR+IVVHKSTIQRLADGLFVNVAKELSKEYPDI  ETELIDN V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L VVTNPSAYTNAVSVCPNLYGDI                  ANIGHK+SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG+DKANPTALLLSSVMMLNHMGLT+HADQIQNAVLSTIASGPENRTGDLAGTATTSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/369 (81%), Positives = 331/369 (89%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           M RN  LRNT+RRFLS   QPSIG++TGKP+PSTG++TVSFIEGDGIGPEIS+SVK+IF 
Sbjct: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA VPI+WE CDV+P+F+NGLTTIP+PAVQSI KNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TFGLFANVRPAKSIEGFKT Y+NVDLV+IRENTEGEYSGIEH+V PGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYA+EYARAIGRPR+IVVHKSTIQRLADGLFV+VAKELS+EYPDI  ETELIDN V
Sbjct: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVV+NPS+Y+NAVSVCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 241 LNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 300

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG++KANPTALLLSSVMMLNHMGL +HAD+I+ AVLSTIASGPE RTGDLAG ATTSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360

Query: 361 FTEAVIKRL 369
           FT+AVI RL
Sbjct: 361 FTDAVIGRL 369

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/369 (80%), Positives = 329/369 (89%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           M R++ LR T+RR LS   QPSIG+YTGKP+PSTG+YTVSFIEGDGIGPEIS SVK+IFS
Sbjct: 54  MFRSSILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS 113

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA VPI WE CDV P+F++GLTTIP+PAVQSI KNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 114 AAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 173

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TFGLFANVRPA+S++GFKTTY NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITREAS
Sbjct: 174 TFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREAS 233

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYAFEY RAIGRPR++VVHKSTIQRL+DGLFVNVAKELSKEYPDI FETELIDN V
Sbjct: 234 ERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTV 293

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L VV+NPS+YT+AVSVCPNLYGDI                   NIG+++SIFEAVHGSAP
Sbjct: 294 LKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAP 353

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGK+ ANPTALLLSSVMMLNHMGL+ HADQI+NAVLSTIASGPE+RTGDLAGTATTS+
Sbjct: 354 DIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTST 413

Query: 361 FTEAVIKRL 369
           FT+AVIK+L
Sbjct: 414 FTDAVIKKL 422

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/369 (79%), Positives = 323/369 (87%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLR+  LR   RRFLS+ KQPSIGR+TGKP+PSTG+YTVSFIEGDG+GPEISKSVK IF+
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA+VP+ WE CDV P+F+NGLTTIP PAV SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TFGLFANVRPAKS+EGFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYAFEYARA+GRP+++VVHKSTIQRLADGLFV+VAKELS EYPDI  + +L+DN V
Sbjct: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVV+NP AY + VSVCPNLYGDI                  ANIGHKVSIFEAVHGSAP
Sbjct: 241 LNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG++KANPTALLLSSVMMLNHMGL   AD I+ AVLSTIASGPENRT DLAG+A+TSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360

Query: 361 FTEAVIKRL 369
           FTEAVIKRL
Sbjct: 361 FTEAVIKRL 369

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/369 (79%), Positives = 322/369 (87%), Gaps = 1/369 (0%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           ML     R  +RRFL+T  QPSIGR+TGKP+PSTG++TVSFIEGDGIGPEIS SVK+IF 
Sbjct: 1   MLGIRSFRLNARRFLATA-QPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRIFQ 59

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AADVP+ WE CDV PIFVNGLTTIPDPAVQSI KNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AADVPVEWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TF LFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+AS
Sbjct: 120 TFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLITRDAS 179

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYA+EYARAIGRPR+IVVHKSTIQRLADGLFVNVAKEL+ EYPDI  ETELIDN  
Sbjct: 180 ERVIRYAYEYARAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAEYPDIQLETELIDNTC 239

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVV+NPS+YT+AVSVCPNLYGDI                  ANIGHKVSIFEAVHGSAP
Sbjct: 240 LNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 299

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG++KANPTALLLSSVMMLNHMG+T HAD+I+ AVL TIA G E RTGDL G+A+T+S
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTS 359

Query: 361 FTEAVIKRL 369
           FT+A+IK+L
Sbjct: 360 FTDAIIKKL 368

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/373 (79%), Positives = 328/373 (87%), Gaps = 4/373 (1%)

Query: 1   MLRNTFLRN--TSRRFLST-VK-QPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVK 56
           MLRN+ LRN  T+RRFL+T VK QPSIGR+TGKP+P+TG++ VSFIEGDGIGPEIS+SVK
Sbjct: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60

Query: 57  KIFSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNL 116
            IF AA+VPINWEFCDV PIFVNGLTTIPDPAV SI KNL+ALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120

Query: 117 TLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLIT 176
           TLRKTF LFANVRPAKSIEGFKTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT
Sbjct: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 177 REASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELI 236
           R+ASERVIRYAFEYA+AIGRPR++VVHKSTIQRLADGLFVNVAKELSKEYP+I  ETELI
Sbjct: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240

Query: 237 DNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVH 296
           DN VLNVV+NP+ YT+AVSVCPNLYGDI                  ANIG+++SIFEAVH
Sbjct: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVH 300

Query: 297 GSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTA 356
           GSAPDIAG++KANPTALLLSSVMMLNHMGL   A +I+ AVL+TIAS  +NRTGDL G+A
Sbjct: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360

Query: 357 TTSSFTEAVIKRL 369
           TTSSFT+AVIK L
Sbjct: 361 TTSSFTDAVIKNL 373

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/371 (77%), Positives = 322/371 (86%), Gaps = 3/371 (0%)

Query: 1   MLRNTFLRNTSRRFLSTV--KQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKI 58
           M + +  +  SRR+L++   KQPSIGR+TGKP+P TG+YTVSFIEGDGIGPEIS+SVK I
Sbjct: 1   MFKQSIFKG-SRRYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDI 59

Query: 59  FSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTL 118
           FSAA VP+ WE+CDV PIF+NGLTTIPDPAVQSI KNLVALKGPLATPIGKGHRSLNLTL
Sbjct: 60  FSAAKVPVEWEYCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTL 119

Query: 119 RKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRE 178
           RKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+
Sbjct: 120 RKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRD 179

Query: 179 ASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDN 238
           ASERVIRYAFEYARA+GRP+++VVHKSTIQRLADGLFVNVA+E+ KEYPDI  + ELIDN
Sbjct: 180 ASERVIRYAFEYARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKEYPDIELQPELIDN 239

Query: 239 KVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGS 298
            VLNVV+ P  Y+++V+VCPNLYGDI                  ANIGH VSIFEAVHGS
Sbjct: 240 TVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGS 299

Query: 299 APDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATT 358
           APDIAG++ ANPTALLLSSVMMLNHMGL  HADQI++AVL+T+AS  +NRT DLAGTATT
Sbjct: 300 APDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATT 359

Query: 359 SSFTEAVIKRL 369
           SSFT+AVI+RL
Sbjct: 360 SSFTKAVIERL 370

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/369 (75%), Positives = 321/369 (86%), Gaps = 1/369 (0%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           M +++F+RN S RFL+T KQPSIGRYTGKPDP+TG+YTVSFIEGDG+GPEISK+VK IF+
Sbjct: 1   MFKSSFVRN-SARFLATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA  PI WE CDV+P+F+NGLTTIP PA  SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKAPIQWESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TFGLFANVRPAKS++G+KT Y+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT++AS
Sbjct: 120 TFGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITQDAS 179

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYAFEYARA+ RP+++VVHKSTIQRLADGLFV+VA++LSKEYPDI  +TELIDN V
Sbjct: 180 ERVIRYAFEYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKEYPDIELQTELIDNTV 239

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L+ V +P+ Y++ V VCPNLYGDI                  ANIGHKVSIFEAVHGSAP
Sbjct: 240 LHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 299

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG++KANPTALLLSSVMMLNHMGLT HAD+I+ AV +TIA+GPE+RTGDL G+A+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSS 359

Query: 361 FTEAVIKRL 369
           F EAVI RL
Sbjct: 360 FAEAVISRL 368

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/369 (76%), Positives = 317/369 (85%), Gaps = 1/369 (0%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           M R+ F RNT  RF +T KQPSIGRYTGKPDP+TG+YTVSFIEGDG+GPEISK+VK IF+
Sbjct: 1   MFRSQFGRNT-LRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA 59

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA  PI WE CDV P+F+NGLTTIP PA  SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TFGLFANVRPAKSI+GFKT Y+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT++AS
Sbjct: 120 TFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYAFEYARA+ RP+++VVHKSTIQRLADGLFV+VA++L+KEYPDI  +TELIDN V
Sbjct: 180 ERVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTV 239

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L+ V +P  Y++ V VCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 240 LHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 299

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG++KANPTALLLSSVMMLNHMGLT HAD+I+ AV STIASGPENRTGDLAG+A+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSS 359

Query: 361 FTEAVIKRL 369
           F EAVI RL
Sbjct: 360 FAEAVISRL 368

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/369 (76%), Positives = 318/369 (86%), Gaps = 1/369 (0%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLRNT  R +  R ++T  QP+IGR+TGKP+P TG+YTV FIEGDG+GPEISKSVK IF+
Sbjct: 1   MLRNTIYRGSFARMMTT-GQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFA 59

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA VPI WE CDV PIFVNGLTTIPD AVQSI K+LVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TF LFANVRPA+S+  +KTTY+NVDLVLIRENTEGEYSGIEH++ PGV+QSIKLIT++AS
Sbjct: 120 TFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLITKDAS 179

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYAFEY RAIGRPR++VVHKSTIQR+ADGLFVNVAKEL+ EYPDI  +TELIDN +
Sbjct: 180 ERVIRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASEYPDIELQTELIDNTI 239

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVVT+P +YT+AVSVCPNLYGDI                  ANIG KVSIFEAVHGSAP
Sbjct: 240 LNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAP 299

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG++KANPTALLLSSVMMLNHMGL  HA +I+NA+LSTIASG ENRTGDLAGTATTSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSS 359

Query: 361 FTEAVIKRL 369
           FTEAVI +L
Sbjct: 360 FTEAVINKL 368

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/369 (76%), Positives = 317/369 (85%), Gaps = 1/369 (0%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           M R + ++  S RFL+T KQPSIGRYTGKP+P TG+YTVSFIEGDG+GPEISKSVK IFS
Sbjct: 1   MFRQSIVKQ-SCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA VPI WE CDV+PIFVNGLTTIPDPAV SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TFGLFANVRPAKSIEG+KTTYENV+LVLIRENTEGEYSGIEH+V PGVVQSIKLIT++AS
Sbjct: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYAFEYARA+ R +++VVHKSTIQRLADGLFV+VAK+LS EYPDI  +TEL+DN V
Sbjct: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           L  V +P AY + V VCPNLYGDI                  ANIGH VSIFEAVHGSAP
Sbjct: 240 LKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAP 299

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG++KANPTALLLSSVMMLNHMGLT HAD+I+ AVL+TIAS  +NRTGDL G+A+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359

Query: 361 FTEAVIKRL 369
           FT+AVI+RL
Sbjct: 360 FTDAVIERL 368

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/369 (76%), Positives = 316/369 (85%), Gaps = 2/369 (0%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLR    +  SRR+L++V+QPSIGRY GKP+ + G+YTVSFIEGDG+GPEIS+SVK IFS
Sbjct: 1   MLRQKLFQG-SRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFS 58

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA VP+ WE+CDV P+ VNGLTTIP+PAV SI KNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRK 118

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TFGLFANVRPAKSIEG+KTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLITREAS
Sbjct: 119 TFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREAS 178

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIRYAFEYAR +GRP+++VVHKSTIQRLADGLFVNVA+EL +EYPDI  +TEL+DN V
Sbjct: 179 ERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTV 238

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVVT P AY + V+VCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 239 LNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAP 298

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG+++ANPTALLLSSVMMLNHMGL  HA +I+ AVLSTIAS  ENRT DLAGTA+TSS
Sbjct: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358

Query: 361 FTEAVIKRL 369
           FT AVI+RL
Sbjct: 359 FTNAVIERL 367

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/371 (75%), Positives = 317/371 (85%), Gaps = 2/371 (0%)

Query: 1   MLRNTFLRNTSRRFLS--TVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKI 58
           MLR+   R T  R L+  T KQPSIG+YTGKPDP TG+YTVSFIEGDG+GPEISKSVK I
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60

Query: 59  FSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTL 118
           F+AA VPI WE C V P+ VNG+TTIP+ A +SI +NLVALKGPLATPIGKGHRS+NLTL
Sbjct: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120

Query: 119 RKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRE 178
           RKTFGLFANVRPAKS+EGFKTTYE+VDLVLIRENTEGEY+GIEH++ PGVVQSIKLITRE
Sbjct: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180

Query: 179 ASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDN 238
           ASERVIRYA+EYARA+GRP+++VVHKSTIQRLADGLFV VAKEL+ E+PDI  +TELIDN
Sbjct: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240

Query: 239 KVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGS 298
            VLNVV+NPS Y++ V VCPNLYGDI                   NIGHKVSIFEAVHGS
Sbjct: 241 TVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGS 300

Query: 299 APDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATT 358
           APDIAG++KANPTALLLSSVMMLNHMGL  HA +I+ AVL+TIA+GPE+RTGDLAG+A+T
Sbjct: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360

Query: 359 SSFTEAVIKRL 369
           SSFTEAVI RL
Sbjct: 361 SSFTEAVISRL 371

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/373 (72%), Positives = 317/373 (84%), Gaps = 4/373 (1%)

Query: 1   MLRNTFLRNTSRRFLSTVK----QPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVK 56
           MLR    + ++RR  ST         +G+Y G P+PSTGR+TV FIEGDG+GPEISKSVK
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 57  KIFSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNL 116
            IF AA VP++WE+CDV+P+ +NGLTTIP+PAVQ I K+ +ALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120

Query: 117 TLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLIT 176
           TLRKTFGLFANVRPA+SI G++TTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT
Sbjct: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 177 REASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELI 236
           R+ASERVIRYA+EYARAIGRPR++VVHKSTIQ+LADGLFVN+AKEL+ E+PDI  ETELI
Sbjct: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240

Query: 237 DNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVH 296
           DN VLNVV +P +YT+AV+VCPNLYGDI                  ANIG++VSIFEAVH
Sbjct: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVH 300

Query: 297 GSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTA 356
           GSAPDIAG++KANPTALLLSS MMLN+MGL S++++I+NA+L+TIASG ENRTGDLAGTA
Sbjct: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360

Query: 357 TTSSFTEAVIKRL 369
           TTSSFTE+VIK L
Sbjct: 361 TTSSFTESVIKNL 373

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/369 (73%), Positives = 310/369 (84%), Gaps = 1/369 (0%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           M  +     T  RFLST  QPSIGR+TGKPDP+TG++TV FIEGDG+GPEIS+SVKKIFS
Sbjct: 1   MFNSRLQLRTVSRFLST-GQPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFS 59

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA VPI W  CDV PIFVNG TTIP+PAV+ I K+L+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWVPCDVGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TF LFANVRPA+SI  +K+TYENVDLVLIRENTEGEYSGIEH++ PGV+QSIKLITREA+
Sbjct: 120 TFNLFANVRPARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITREAT 179

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERV+RYAFEY +AIGRPR++V+HKSTIQR+ADGLFV VA+EL+ EYPDI  ETE+ID  +
Sbjct: 180 ERVVRYAFEYTQAIGRPRLLVIHKSTIQRMADGLFVKVAEELASEYPDIKLETEIIDKSI 239

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LNVV+ P  Y++AVSVCPNLYGDI                  ANIG KVSIFEAVHGSAP
Sbjct: 240 LNVVSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAP 299

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAG++KANPTALLLSSVMML HMGL  HA++I+NAVL+TIASG ENRT DL+GTA+TSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSS 359

Query: 361 FTEAVIKRL 369
           FTE VI+RL
Sbjct: 360 FTEEVIQRL 368

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/378 (74%), Positives = 314/378 (83%), Gaps = 9/378 (2%)

Query: 1   MLRNTFL---RNT--SRRFLSTV--KQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISK 53
           MLR   L   R T  ++RFLS    +QPSIGR+TGKPD +TG+YTVSFIEGDGIGPEIS+
Sbjct: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60

Query: 54  SVKKIFSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRS 113
           SVK IF AA VPI WE CDV+PI V+GLTTIPD AV+SI KNLV LKGPLATPIGKGHRS
Sbjct: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120

Query: 114 LNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIK 173
           LNLTLRKTF LFANVRPAKS+ GFKTTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIK
Sbjct: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180

Query: 174 LITREASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKE--YPDITF 231
           LITR+ASERVIRYAFEYA+AIGRP++IVVHKSTIQRL+DGLFVNVAKEL KE  + +I  
Sbjct: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240

Query: 232 ETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSI 291
           +TELIDN VLNVV NPS Y++AV VCPNLYGDI                  ANIG K+SI
Sbjct: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISI 300

Query: 292 FEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGD 351
           FEAVHGSAPDIAG++KANPTALLLSSVMML+HMGL  + D+I+NAVL TIA+  +NRTGD
Sbjct: 301 FEAVHGSAPDIAGQNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGD 360

Query: 352 LAGTATTSSFTEAVIKRL 369
           L GTATT+SFTEAVI  L
Sbjct: 361 LGGTATTTSFTEAVIDNL 378

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/369 (72%), Positives = 308/369 (83%), Gaps = 1/369 (0%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           M ++   R    R  S+ KQPSIG++TGKPDP TG Y VSFIEGDGIGPEISKSVK IF+
Sbjct: 1   MFKSQVCRRAVARMFSS-KQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFA 59

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           AA VP+++E   V PI VNG+T+IP+ A +SI  NLVALKGPLATP+GKGHRS+NLTLRK
Sbjct: 60  AAKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNLTLRK 119

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
           TFGLFAN+RPAKS+EGFKT Y+NV+LVLIRENTEGEY+GIEH + PGVVQSIKLITREAS
Sbjct: 120 TFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLITREAS 179

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240
           ERVIR+A+EYARA  RPR+IVVHKSTIQRL+DGLFV+VAKEL  E+PDI  ETELIDN V
Sbjct: 180 ERVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVAKELQSEFPDIKLETELIDNAV 239

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAP 300
           LN VT+P+ Y++AVSVCPNLYGDI                   NIGHKVSIFEAVHGSAP
Sbjct: 240 LNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAP 299

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DIAGKDKANPTALLLSSVMML+HMGL  HA QI+ AVL+TIA+GPE+RTGDL G+A+TSS
Sbjct: 300 DIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSS 359

Query: 361 FTEAVIKRL 369
           FTEAVIK+L
Sbjct: 360 FTEAVIKKL 368

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/377 (72%), Positives = 314/377 (83%), Gaps = 9/377 (2%)

Query: 1   MLRNTFL---RNTSR-RFLSTVK----QPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEIS 52
           MLRNT     +NT+  + L + +    QP+IGR+TGK + S+G YTV FIEGDG+GPEIS
Sbjct: 1   MLRNTAAIAQKNTTLLKILGSTRSISNQPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEIS 59

Query: 53  KSVKKIFSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHR 112
           KSVK IFSAA+VPI W+ CDV PIFVNGLTTIP+PAV++I ++LVALKGPLATP+GKGHR
Sbjct: 60  KSVKDIFSAANVPIQWQPCDVGPIFVNGLTTIPEPAVKAIKESLVALKGPLATPVGKGHR 119

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSI 172
           SLNLTLRKTF LFANVRPAKS+  +K+TYENVDLVLIRENTEGEYSGIEHIV PGVVQSI
Sbjct: 120 SLNLTLRKTFDLFANVRPAKSVPNYKSTYENVDLVLIRENTEGEYSGIEHIVTPGVVQSI 179

Query: 173 KLITREASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFE 232
           KLITREASE+VIRYA+EYA A+GRPR+IVVHKSTIQRL DGLFV +A EL  EYP I  E
Sbjct: 180 KLITREASEKVIRYAYEYAIAVGRPRLIVVHKSTIQRLGDGLFVQIANELQSEYPSIKLE 239

Query: 233 TELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIF 292
           T+++DN VLNVV+NP+ Y +AVSVCPNLYGDI                  ANIG KVSIF
Sbjct: 240 TQILDNTVLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIF 299

Query: 293 EAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDL 352
           EAVHGSAPDIAG++KANPTALLLSSVMMLNHMGL  HA +I+NAVLSTIASGPE+RTGDL
Sbjct: 300 EAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDL 359

Query: 353 AGTATTSSFTEAVIKRL 369
            G+ATTSSFTE VIK+L
Sbjct: 360 GGSATTSSFTECVIKKL 376

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  491 bits (1265), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/358 (65%), Positives = 280/358 (78%), Gaps = 1/358 (0%)

Query: 12  RRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVPINWEFC 71
           R F++   + SIG + GKP+P TG YTV FIEGDG+GPEISKSV+ IF AA VPI+W  C
Sbjct: 20  RYFMTAADKISIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKAAKVPIDWVNC 79

Query: 72  DVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA 131
           D+ P+ +NG TTIP  AV  I  +L+ALKGPLATP+G+GHRS+NLTLRKTFGLFANVRPA
Sbjct: 80  DIGPLLINGETTIPQTAVDQINNSLIALKGPLATPVGQGHRSINLTLRKTFGLFANVRPA 139

Query: 132 KSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREASERVIRYAFEYA 191
           KSI    +TYENVDL++IRENTEGEYSGIEH + PGVVQSIKLITR+ASE+VI+YAFEY 
Sbjct: 140 KSIPNLASTYENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLITRKASEKVIKYAFEYT 199

Query: 192 RAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYT 251
           R+IGR  +IVVHK+TIQR  DGLFV  A+E++ +YPD+  + ELIDN VLN + NP  Y 
Sbjct: 200 RSIGRSNLIVVHKATIQRRGDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIMNPEKYA 259

Query: 252 NAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPT 311
           ++VSVCPNLYGDI                  ANIG  V ++EAVHGSAPDIAG+DKANPT
Sbjct: 260 DSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIGETV-LYEAVHGSAPDIAGQDKANPT 318

Query: 312 ALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           ALLLSSVMMLNHMGL  +AD I+ AVL+TI SG E RT DL G+ATT+SFT+AVI+ L
Sbjct: 319 ALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  275 bits (702), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 159/372 (42%), Positives = 217/372 (58%), Gaps = 16/372 (4%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           M RNT    T R +       + GR    P    GRYTV+ I GDGIG E++ SV +IF 
Sbjct: 1   MFRNTLSHITKRGY-------AAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFE 53

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGK-GHRSLNLTLR 119
           A +VP++WE  +++ +  N        AV+S+ +N V LKG   TP  + GH SLN+  R
Sbjct: 54  AENVPVDWESVELSALEENHEGV--QKAVESLKRNKVGLKGIWHTPADQTGHGSLNVAFR 111

Query: 120 KTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREA 179
           K   +FANV   KS  G KT  ++VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAK 171

Query: 180 SERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKEL-SKEYPDITFETELIDN 238
           SER+ R+AF++A    R  +  VHK+ I +L DGLF N   E+ +KEYP++   + ++DN
Sbjct: 172 SERIARFAFDFALKNNRKAVCAVHKANIMKLGDGLFRNTVSEIGAKEYPEVNVSSIIVDN 231

Query: 239 KVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHG 297
             +  V  P  +   V V PNLYG I                  AN G + ++FE     
Sbjct: 232 ASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGCRH 288

Query: 298 SAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTAT 357
              DI G+D ANPTA++LSS +ML H+GL  +AD+I  A   TIA G +  T D+ GTAT
Sbjct: 289 VGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEG-KRTTKDIGGTAT 347

Query: 358 TSSFTEAVIKRL 369
           T+ FT AVI +L
Sbjct: 348 TTEFTNAVIDKL 359

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  273 bits (699), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 156/372 (41%), Positives = 221/372 (59%), Gaps = 16/372 (4%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLRNTF++ + RRF     Q         P    GRYTV+ I GDG+G E++ SV  IF 
Sbjct: 1   MLRNTFVQISKRRFALASGQLL-------PKKYGGRYTVTLIPGDGVGKEVTDSVVNIFE 53

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGK-GHRSLNLTLR 119
           A +VPI+WE  +++ +  N        AV+S+ +N V LKG  +TP  + GH SLN+  R
Sbjct: 54  AENVPIDWESVELSGLEEN--MEGVQKAVESLKRNKVGLKGIWSTPADQTGHGSLNVAFR 111

Query: 120 KTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREA 179
           K   +FANV   KS  G KT  ++VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAK 171

Query: 180 SERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKEL-SKEYPDITFETELIDN 238
           SER+ R+AF++A    R  +  VHK+ I +L DGLF N   E+ +KEYP++  ++ ++DN
Sbjct: 172 SERIARFAFDFALKNNRRSVCAVHKANIMKLGDGLFRNTVNEIGAKEYPELEVKSIIVDN 231

Query: 239 KVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHG 297
             +  V  P  +   V V PNLYG I                  AN G + ++FE     
Sbjct: 232 ASMQAVAKPHQFD--VLVTPNLYGSI-LGNVGAALIGSPGLVPGANFGREYAVFEPGSRH 288

Query: 298 SAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTAT 357
              DI G+D ANPTA++LSS +ML H+GL  +AD+I  A    IA G ++ T D+ G A+
Sbjct: 289 VGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEG-KHTTKDIGGHAS 347

Query: 358 TSSFTEAVIKRL 369
           T+ FT+A++ +L
Sbjct: 348 TTQFTKAIVDKL 359

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  268 bits (684), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 157/372 (42%), Positives = 219/372 (58%), Gaps = 17/372 (4%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           M RNTF    S+R L+TV    +      P    GRYTV+ I GDG+G E++ SV  IF 
Sbjct: 1   MFRNTFA--VSKRSLATVATEQL-----LPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFE 53

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGK-GHRSLNLTLR 119
           A +VPI+WE   +N   V+    +   AV+S+ +N + LKG   TP  + GH SLN+  R
Sbjct: 54  AENVPIDWE--TINITGVDSEEGV-QKAVESLKRNKIGLKGIWHTPADQTGHGSLNVAFR 110

Query: 120 KTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREA 179
           K   +FANV   K++ G KT   N+DLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  
Sbjct: 111 KQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEYSGLEHESVPGVVESLKIITKAK 170

Query: 180 SERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKEL-SKEYPDITFETELIDN 238
           SER+ R+AF++A    R  +  VHK+ I +L DGLF N   E+ + EYP+I  +  ++DN
Sbjct: 171 SERIARFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNTVNEVGASEYPEIDVKNIIVDN 230

Query: 239 KVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHG 297
             +  V  P  +   V V PNLYG I                  AN G + ++FE     
Sbjct: 231 ASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGSRH 287

Query: 298 SAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTAT 357
              DI GKD ANPTA++LSS +ML H+GL  +AD+I  A    IA G ++ T D+ G+++
Sbjct: 288 VGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEG-KHTTKDIGGSSS 346

Query: 358 TSSFTEAVIKRL 369
           T+ FT++VI +L
Sbjct: 347 TTEFTKSVIDKL 358

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  265 bits (677), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 156/374 (41%), Positives = 222/374 (59%), Gaps = 22/374 (5%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLRN F    S+R L+TV +  +      P    GRYTV+ I GDG+G E++ SV  IF 
Sbjct: 1   MLRNGF--GISKRSLATVAEQLL------PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFE 52

Query: 61  AADVPINWEFCDVNPIFVNGLTTIP--DPAVQSITKNLVALKGPLATPIGK-GHRSLNLT 117
           + +VPI+WE  +++     GL        AV S+ +N V LKG   TP  + GH SLN+ 
Sbjct: 53  SENVPIDWETVEIS-----GLDNEEGVQKAVDSLKRNKVGLKGIWHTPSDQTGHGSLNVA 107

Query: 118 LRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITR 177
           LRK   +FANV   K++ G  + + NVDLV+IRENTEGEYSG+EH   PGVV+S+K++T+
Sbjct: 108 LRKQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEYSGLEHESVPGVVESLKIMTK 167

Query: 178 EASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKEL-SKEYPDITFETELI 236
             S+R+ R+AF++A    R  +  VHK+ I +L DGLF N   E+ +KEYP+I  +  ++
Sbjct: 168 AKSDRIGRFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNCINEIGAKEYPEIEVKNIIV 227

Query: 237 DNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AV 295
           DN  +  V  P  +   V V PNLYG I                  AN G + ++FE   
Sbjct: 228 DNASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREFAVFEPGS 284

Query: 296 HGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGT 355
                DI G++ ANPTA++LSS +ML H+GL S+AD+I  A    IA   +N T D+ G+
Sbjct: 285 RHVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIAEA-KNTTKDIGGS 343

Query: 356 ATTSSFTEAVIKRL 369
           A+T+ FT+A+I++L
Sbjct: 344 ASTTDFTQAIIEKL 357

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  265 bits (677), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 149/345 (43%), Positives = 209/345 (60%), Gaps = 14/345 (4%)

Query: 30  PDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVPINWEFCDVNPIFVNGLTTIPD--P 87
           P    GRYTV+ I GDG+G E++ SV KIF   ++PI+WE  D++     GL    +   
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIPIDWETIDIS-----GLENTENVQR 77

Query: 88  AVQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDL 146
           AV+S+ +N V LKG   TP  + GH SLN+ LRK   +FANV   KSI G KT   N+D+
Sbjct: 78  AVESLKRNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDM 137

Query: 147 VLIRENTEGEYSGIEHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRPRIIVVHKST 206
           V+IRENTEGEYSG+EH   PGVV+S+K++TR  SER+ R+AF++A    R  +  VHK+ 
Sbjct: 138 VIIRENTEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKAN 197

Query: 207 IQRLADGLFVNVAKEL-SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIX 265
           I +L DGLF N   E+ + EYP++  +  ++DN  +  V  P  +   V V PNLYG I 
Sbjct: 198 IMKLGDGLFRNTVNEIGANEYPELDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 254

Query: 266 XXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGKDKANPTALLLSSVMMLNHM 324
                            AN G + ++FE        DI G++ ANPTA++LSS +ML H+
Sbjct: 255 LGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHL 314

Query: 325 GLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           GL ++AD+I  A    I+ G ++ T D+ G+A+TS FT AVI++L
Sbjct: 315 GLNAYADRISKATYDVISEG-KSTTRDIGGSASTSEFTNAVIEKL 358

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  261 bits (666), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 152/370 (41%), Positives = 225/370 (60%), Gaps = 19/370 (5%)

Query: 6   FLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVP 65
           F  + ++R L+TV           P    GRYTV+ I GDG+G E++ SV  IF A +VP
Sbjct: 2   FRHSLTKRTLATVATTE----KMLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKAENVP 57

Query: 66  INWEFCDVNPIFVNGLTTIPD--PAVQSITKNLVALKGPLAT-PIGK-GHRSLNLTLRKT 121
           ++W+  D++     G+    D   AV+S+ +N + LKG   T P  + GH SLN+ LRK 
Sbjct: 58  VDWDRVDIS-----GVDRAEDVKSAVESLKRNRIGLKGIWHTSPADQAGHGSLNVALRKE 112

Query: 122 FGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREASE 181
             ++ANV   KSI G +    +VDLV+IRENTEGE+SG+EH   PGVV+S+K++T++  E
Sbjct: 113 LDIYANVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPGVVESLKIMTQDNIE 172

Query: 182 RVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKEL-SKEYPDITFETELIDNKV 240
           R+ R+AF+YA+   R +++ VHK+ I ++ DGLF N+ +E+  KEYP++     ++DN  
Sbjct: 173 RIARFAFDYAKKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGEKEYPELQVGNIIVDNAS 232

Query: 241 LNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSA 299
           +  V NP  +   V V P++YG I                  AN G  V++FE       
Sbjct: 233 MQTVANPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVG 289

Query: 300 PDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTS 359
            DI G++ ANPTA++LSSV++LNH+GL + AD+I  AV + IA G ++ T D+ GTA+T+
Sbjct: 290 LDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEG-KSVTRDIGGTASTT 348

Query: 360 SFTEAVIKRL 369
            FTEAVI +L
Sbjct: 349 EFTEAVINKL 358

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  260 bits (665), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 147/366 (40%), Positives = 217/366 (59%), Gaps = 16/366 (4%)

Query: 8   RNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVPIN 67
           R  ++R L+T  Q         P    GR+TV+ I GDG+G EI+ SVK IF A  +P++
Sbjct: 4   RTIAKRTLATAAQAE----RALPKKYGGRFTVTLIPGDGVGKEITDSVKTIFEAEKIPVD 59

Query: 68  WEFCDVNPI-FVNGLTTIPDPAVQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLF 125
           WE  ++       G+      AV+S+ +N + LKG   TP  + GH SLN+ LRK   ++
Sbjct: 60  WETVNIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIY 115

Query: 126 ANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREASERVIR 185
           ANV   KS++G KT   ++DL++IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R
Sbjct: 116 ANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKIMTRPKTERIAR 175

Query: 186 YAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKEL-SKEYPDITFETELIDNKVLNVV 244
           +AF++A+   R  +  VHK+ I +L DGLF N+  E+  KEYPDI   + ++DN  +  V
Sbjct: 176 FAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAV 235

Query: 245 TNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIA 303
             P  +   V V P++YG I                  AN G   ++FE        DI 
Sbjct: 236 AKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIK 292

Query: 304 GKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTE 363
           G++ ANPTA++LSSV+MLNH+GL  +A +I  AV  TIA G ++ T D+ G+++T+ FT 
Sbjct: 293 GQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEG-KHTTKDIGGSSSTTDFTN 351

Query: 364 AVIKRL 369
            +I +L
Sbjct: 352 EIINKL 357

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  258 bits (658), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 146/366 (39%), Positives = 217/366 (59%), Gaps = 16/366 (4%)

Query: 8   RNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVPIN 67
           R  ++R L+T  Q         P    GR+TV+ I GDG+G EI+ SV+ IF A ++PI+
Sbjct: 4   RTIAKRTLATAAQAE----RTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPID 59

Query: 68  WEFCDVNPI-FVNGLTTIPDPAVQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLF 125
           WE  ++       G+      AV+S+ +N + LKG   TP  + GH SLN+ LRK   ++
Sbjct: 60  WETINIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIY 115

Query: 126 ANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREASERVIR 185
           ANV   KS++G KT   ++DL++IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R
Sbjct: 116 ANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIAR 175

Query: 186 YAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKEL-SKEYPDITFETELIDNKVLNVV 244
           +AF++A+   R  +  VHK+ I +L DGLF N+  E+  KEYPDI   + ++DN  +  V
Sbjct: 176 FAFDFAKKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAV 235

Query: 245 TNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIA 303
             P  +   V V P++YG I                  AN G   ++FE        DI 
Sbjct: 236 AKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIK 292

Query: 304 GKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTE 363
           G++ ANPTA++LSS +MLNH+GL  +A +I  AV  TIA G ++ T D+ G+++T+ FT 
Sbjct: 293 GQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTN 351

Query: 364 AVIKRL 369
            +I +L
Sbjct: 352 EIINKL 357

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  257 bits (657), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 152/374 (40%), Positives = 219/374 (58%), Gaps = 21/374 (5%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLR+      S+R L+T+    +      P    GRYTV+ I GDG+G E++ SV  IF 
Sbjct: 1   MLRSGL--GVSKRSLATMAAEQL-----LPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFE 53

Query: 61  AADVPINWEFCDVNPIFVNGLTTIP--DPAVQSITKNLVALKGPLATPIGK-GHRSLNLT 117
           + ++PI+WE  +++     GL        AV+S+ +N V LKG   TP  + GH SLN+ 
Sbjct: 54  SENIPIDWETVEIS-----GLDNQEGVQKAVESLKRNKVGLKGIWHTPSDQTGHGSLNVA 108

Query: 118 LRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITR 177
           LRK   +FANV   KS+ G  + + NVD+V+IRENTEGEYSG+EH   PGVV+S+K++T+
Sbjct: 109 LRKQLDIFANVALFKSVPGVPSRHSNVDMVVIRENTEGEYSGLEHESVPGVVESLKIMTK 168

Query: 178 EASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKEL-SKEYPDITFETELI 236
             SER+ R+AF++A    R  +  VHK+ I +L DGLF N   E+ +KEYP+I  +  ++
Sbjct: 169 AKSERIGRFAFDFAVKNNRKSVCAVHKANIMKLGDGLFRNCINEVGAKEYPEIDVKNIIV 228

Query: 237 DNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AV 295
           DN  +  V  P  +   V V PNLYG I                  AN G + ++FE   
Sbjct: 229 DNASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGS 285

Query: 296 HGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGT 355
                DI G++ ANPTA++LSS +ML H+GL ++AD+I  A    IA   +  T D+ G+
Sbjct: 286 RHVGLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAEA-KTTTQDIGGS 344

Query: 356 ATTSSFTEAVIKRL 369
           A+T+ FTEA+I +L
Sbjct: 345 ASTTEFTEAIISKL 358

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  257 bits (656), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 150/367 (40%), Positives = 219/367 (59%), Gaps = 15/367 (4%)

Query: 6   FLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVP 65
           F  + ++R L T+ + +I      P    GR+TV+ + GDG+G EI+ SV  IF + +VP
Sbjct: 2   FKHSVTKRSLVTLAKETI-----IPKKYGGRFTVTLLPGDGVGKEITDSVVSIFKSENVP 56

Query: 66  INWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGL 124
           I+WE  D++ +     T     AV S+ +N + LKG   TP  + GH SLN+  RK   +
Sbjct: 57  IDWETVDISGL---DHTEGVKAAVDSLKRNKIGLKGIWHTPADQVGHGSLNVAFRKQLDI 113

Query: 125 FANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREASERVI 184
           +ANV   KSIEG KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ 
Sbjct: 114 YANVAIFKSIEGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKSKSERIA 173

Query: 185 RYAFEYARAIGRPRIIVVHKSTIQRLADGLFVN-VAKELSKEYPDITFETELIDNKVLNV 243
           R+AF++A+   R  +  VHK+ I +L+DGLF N V+K   +EYP+I   + ++DN  +  
Sbjct: 174 RFAFDFAKRNNRKSVTAVHKANIMKLSDGLFRNTVSKIGEEEYPEIQTSSIIVDNASMQA 233

Query: 244 VTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDI 302
           V  P  +   V V P++YG I                   N G   ++FE        DI
Sbjct: 234 VAKPHQFD--VMVTPSMYGTI-VGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDI 290

Query: 303 AGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFT 362
            G++ ANPTA+LLS+ ++L+H+GL   A++I++AV   IA G    T D+ G+A+T+ FT
Sbjct: 291 KGQNVANPTAMLLSATLLLDHLGLEKSANRIKSAVYDVIAEGKAT-TQDIGGSASTTEFT 349

Query: 363 EAVIKRL 369
           +AVI +L
Sbjct: 350 QAVINKL 356

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  254 bits (649), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 145/366 (39%), Positives = 217/366 (59%), Gaps = 16/366 (4%)

Query: 8   RNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVPIN 67
           R  ++R L+T  Q         P    GR+TV+ I GDG+G EI+ SV+ IF A  +P++
Sbjct: 4   RTIAKRTLATAAQAE----RTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAERIPVD 59

Query: 68  WEFCDVNPI-FVNGLTTIPDPAVQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLF 125
           WE  ++       G+      AV+S+ +N + LKG   TP  + GH SLN+ LRK   ++
Sbjct: 60  WETINIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIY 115

Query: 126 ANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREASERVIR 185
           ANV   KS++G KT   ++DL++IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R
Sbjct: 116 ANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTKPKTERIAR 175

Query: 186 YAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSK-EYPDITFETELIDNKVLNVV 244
           +AF++A+   R  +  VHK+ I +L DGLF N+  E+ + EYPDI   + ++DN  +  V
Sbjct: 176 FAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQTEYPDIDVSSIIVDNASMQAV 235

Query: 245 TNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIA 303
             P  +   V V P++YG I                  AN G   ++FE        DI 
Sbjct: 236 AKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIK 292

Query: 304 GKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTE 363
           G++ ANPTA++LSSV+MLNH+GL  +A +I  AV  TIA G ++ T D+ G+++T+ FT 
Sbjct: 293 GQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTN 351

Query: 364 AVIKRL 369
            VI +L
Sbjct: 352 EVINKL 357

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  253 bits (646), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 148/369 (40%), Positives = 212/369 (57%), Gaps = 19/369 (5%)

Query: 6   FLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVP 65
             R   RR ++++ +  +      P    GRYTV+ I GDG+G EI+ SV  IF A ++P
Sbjct: 1   MFRTVQRRGMASMAKELV-----LPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIP 55

Query: 66  INWEFCDVNPIFVNGLTTIPD--PAVQSITKNLVALKGPLATPIG-KGHRSLNLTLRKTF 122
           ++WE  D++         I D   AV+S+ +N + LKG   T      H S N+ LRK  
Sbjct: 56  VDWERVDIST-----SDNIQDVSQAVESLKRNKIGLKGIWHTSADIADHGSFNVALRKQL 110

Query: 123 GLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREASER 182
            +FA+V   KS+ G KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER
Sbjct: 111 DMFAHVAFFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKAKSER 170

Query: 183 VIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKEL-SKEYPDITFETELIDNKVL 241
           + R+AF++A+   R  +  VHK+ I ++ DGLF N   E+ + EYPDI   + ++DN  +
Sbjct: 171 IARFAFDFAKKYNRKSVCAVHKANIMKMGDGLFRNTVTEIGANEYPDIQTSSIIVDNASM 230

Query: 242 NVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAP 300
             V  P  +   V V P++YG I                  A+ G + ++FE        
Sbjct: 231 QAVAKPHQFD--VMVTPSMYGTI-IGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGL 287

Query: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360
           DI GK+ ANPTA++LSS +ML H+GLT  A +I  A    I+ G +  T D+ G+A+T+ 
Sbjct: 288 DIKGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLG-QVTTKDIGGSASTTE 346

Query: 361 FTEAVIKRL 369
           FTEA+IKRL
Sbjct: 347 FTEAIIKRL 355

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  252 bits (644), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 153/374 (40%), Positives = 218/374 (58%), Gaps = 23/374 (6%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLR    R  S+R L+T+ +      T  P+   GRYTV+ + GDG+G E + SV  +F+
Sbjct: 1   MLR----RLVSKRSLATLPE------TLFPNKYGGRYTVTLLPGDGVGKECTDSVVSVFN 50

Query: 61  AADVPINWEFCDVNPI-FVNGLTTIPDPAVQSITKNLVALKGPLATPIG--KGHRSLNLT 117
           A ++PI+WE  +++ +    G+      AVQS+ +N + LKG   T      GH SLN+ 
Sbjct: 51  AENIPIDWEIVNISGLDHKEGVAA----AVQSLRRNKIGLKGLWHTSNADQSGHGSLNVA 106

Query: 118 LRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITR 177
            RK   ++ANV   KS++G KT   +VDLV+IRENTEGE+SG+EH    GVV+S+K+ T 
Sbjct: 107 FRKQLDIYANVAVFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEGVVESLKVTTL 166

Query: 178 EASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELS-KEYPDITFETELI 236
             +ER+ R+AF YA+  GR  +  VHK+ I +L DGLF N    +  KEYPDI   + ++
Sbjct: 167 PKTERIARFAFNYAQKNGRKAVCAVHKANIMKLGDGLFRNTVTSIGEKEYPDIETSSIIV 226

Query: 237 DNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AV 295
           DN  +  V  P  +   V V P++YG I                  AN G + ++FE   
Sbjct: 227 DNASMQAVAKPHQFD--VLVTPSMYGTI-IGNIGAALIGGPGLVAGANFGREYAVFEPGS 283

Query: 296 HGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGT 355
                DI G++ ANPTA+LLSS +MLNH+GLT    +I +AV   IA G + RT D+ G 
Sbjct: 284 RHVGLDIKGQNIANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEG-DVRTKDIGGD 342

Query: 356 ATTSSFTEAVIKRL 369
           ATT+ FT+AVI++L
Sbjct: 343 ATTTEFTQAVIEKL 356

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  252 bits (644), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 148/364 (40%), Positives = 218/364 (59%), Gaps = 13/364 (3%)

Query: 11  SRRFLSTVKQPSI-GRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVPINWE 69
           ++R L+TV      G     P    GRYTV+ I GDG+G E++ SV  IF+A ++PI+WE
Sbjct: 7   AKRGLATVPATGFRGFLNPLPKEYGGRYTVTLIPGDGVGKEVTDSVVSIFNAENLPIDWE 66

Query: 70  FCDVNPI-FVNGLTTIPDPAVQSITKNLVALKGPLATPIGKG-HRSLNLTLRKTFGLFAN 127
             D++ +    G+    + AV S+ +N + LKG   T  G+  H SLN+ LRK   ++AN
Sbjct: 67  RVDISGLDHEEGV----EAAVNSLKRNKIGLKGIWHTSAGQSDHGSLNVALRKQLDIYAN 122

Query: 128 VRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREASERVIRYA 187
           V   K++ G KT   +VDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+E SER+ R+A
Sbjct: 123 VAHFKTLPGVKTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIITKEKSERIARFA 182

Query: 188 FEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSK-EYPDITFETELIDNKVLNVVTN 246
           F++A+   R  +  VHK+ I +L DGLF N    + + EYPDI   + ++DN  +  V  
Sbjct: 183 FDFAKRFDRKLVTAVHKANIMKLGDGLFRNSVTSIGETEYPDIKVSSIIVDNASMQSVAK 242

Query: 247 PSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGK 305
           P  +   V V P++YG I                  AN G + ++FE        DI G+
Sbjct: 243 PHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQ 299

Query: 306 DKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAV 365
           + ANPTA++LSS ++L H+GL + A +I++AV  TIA G +  T D+ G+A+T+ FT  +
Sbjct: 300 NVANPTAMILSSTLLLKHLGLNNEAKKIEDAVYKTIAEG-KVTTRDIGGSASTTEFTNEI 358

Query: 366 IKRL 369
           IK+L
Sbjct: 359 IKKL 362

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  249 bits (635), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 146/343 (42%), Positives = 205/343 (59%), Gaps = 10/343 (2%)

Query: 30  PDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVPINWEFCDVNPIFVNGLTTIPDPAV 89
           P    GRYTV+ I GDGIG E++ SV KIF++  +PI+WE  DV P   N        AV
Sbjct: 22  PKKYGGRYTVTLIPGDGIGKEVTDSVVKIFASQGLPIDWERIDV-PGMSN--ENEVKKAV 78

Query: 90  QSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVL 148
           +S+ +N + LKG   T   + G+ SLN+ LRK   +FANV   KS++G KT   +VDLV+
Sbjct: 79  ESLKRNKIGLKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLVV 138

Query: 149 IRENTEGEYSGIEHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRPRIIVVHKSTIQ 208
           IRENTEGEYSG+EH   PGVV+S+K+IT+  +ER+ R+AF++A    R  +  VHK+ I 
Sbjct: 139 IRENTEGEYSGLEHESVPGVVESLKIITKPKTERIARFAFDFALENNRSTVTAVHKANIM 198

Query: 209 RLADGLFVNVAKEL-SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXX 267
           +L+DGLF N   E+  KEYPDI   T ++DN  +  V  P  +   V V P++YG I   
Sbjct: 199 KLSDGLFKNTVAEVGEKEYPDIKVNTIIVDNASMQAVAKPHQFD--VMVTPSMYGTI-LG 255

Query: 268 XXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGKDKANPTALLLSSVMMLNHMGL 326
                          AN G + ++FE        DI  ++ ANPTA++LS+ +MLN +GL
Sbjct: 256 NIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNQLGL 315

Query: 327 TSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
              + +I NAV + I  G +  T D+ G A+T+ FT+AVI +L
Sbjct: 316 REESKRISNAVYAVIEEG-KTTTKDIGGNASTTEFTDAVIDKL 357

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  244 bits (623), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 149/371 (40%), Positives = 214/371 (57%), Gaps = 27/371 (7%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLRNT LR    R +ST+           P    GR+ ++ I G+GIG E++ SV+ IF 
Sbjct: 1   MLRNTLLR----RSISTIS----------PKKYGGRFQITLIPGNGIGKEVTDSVRSIFQ 46

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120
           A ++PI+WE  ++     +G+ T    AV SI +N +ALKG  ++    G  SLN+ LRK
Sbjct: 47  AENLPIDWEIVNIES-HRDGIKT----AVDSIKRNKIALKGIWSSDPIDG--SLNVALRK 99

Query: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180
              +FANV   KS +   T   NVDLV+IRENTEGE+SG+EH    GVV+S+K++T+  +
Sbjct: 100 QLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDGVVESLKIVTKPKT 159

Query: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKEL-SKEYPDITFETELIDNK 239
           ER+ R+AF++A+   R  +  VHK+ I +L DGLF N+   + + EYP+I   + ++DN 
Sbjct: 160 ERIARFAFDFAKKHNRNHVTAVHKANIMKLGDGLFKNIVAHIGNNEYPEIKNSSIIVDNA 219

Query: 240 VLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGS 298
            +  V  P  +   V V P++YG I                  AN G   ++FE      
Sbjct: 220 SMQAVAKPHQFD--VLVSPSMYGTI-LGNIGAALIGGPGLVPGANFGRDYAVFEPGSRHV 276

Query: 299 APDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATT 358
             DI G++ ANPTA++LS+  ML H+GLTS A++I NAV   IA G    T D+ GTA+T
Sbjct: 277 GLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQG-TTVTKDIGGTAST 335

Query: 359 SSFTEAVIKRL 369
           + FT+AVI  L
Sbjct: 336 TEFTDAVINEL 346

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  244 bits (623), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 141/347 (40%), Positives = 209/347 (60%), Gaps = 17/347 (4%)

Query: 30  PDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVPINWEFCDVNPI-FVNGLTTIPDPA 88
           P    GR+ V+ I GDG+G E++ SV  IF A ++PI+W+  D++ +    G+      A
Sbjct: 22  PKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENLPIDWDRVDISGLDHEEGVQA----A 77

Query: 89  VQSITKNLVALKG----PLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENV 144
           V S+ +N + LKG      A   GKG  SLN+ LRK   ++ANV   KS+ G KT   NV
Sbjct: 78  VDSLKRNKIGLKGIWHTSAADQAGKG--SLNVALRKELDIYANVALFKSVPGVKTKIPNV 135

Query: 145 DLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRPRIIVVHK 204
           DLV+IRENTEGEYSG+EH   PGVV+S+K++T + +ER+ R+AF++A+   R  +  VHK
Sbjct: 136 DLVVIRENTEGEYSGLEHESVPGVVESLKIMTEDKTERIARFAFDFAKKYNRHAVTAVHK 195

Query: 205 STIQRLADGLFVNVAKEL-SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGD 263
           + I +L DGLF NV   +  +EYPD+   + ++DN  +  V  P  +   V V P++YG 
Sbjct: 196 ANIMKLGDGLFRNVVTRVGEQEYPDVKVGSIIVDNASMQTVAKPHQFD--VLVTPSMYGT 253

Query: 264 IXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGKDKANPTALLLSSVMMLN 322
           I                  AN G + ++FE        DI  K+ ANPTA++LS+ +ML+
Sbjct: 254 I-LGNIGAALIGGPGLVAGANYGREYAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLD 312

Query: 323 HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           H+GL++ A +I NAV   IA G ++ T D+ G+A+T+ FT+AVI++L
Sbjct: 313 HLGLSTSATKISNAVHQVIAEG-KSTTPDIGGSASTTEFTQAVIEKL 358

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  244 bits (623), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 146/372 (39%), Positives = 212/372 (56%), Gaps = 19/372 (5%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           M RN     + R F S   + +I      P    GRYTV+ + GDG+G EI+ SV  IF 
Sbjct: 1   MFRNLI---SKRAFTSIASRENI-----IPKKYGGRYTVTLLPGDGVGREITDSVVSIFE 52

Query: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGK-GHRSLNLTLR 119
           A ++PI+WE  +++ +    + T    AV+S+ +N + LKG   T     GH S N+ LR
Sbjct: 53  AENLPIDWERVELSGLEQEDVHT----AVESLKRNKIGLKGIWHTSADHDGHTSWNVALR 108

Query: 120 KTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREA 179
           K   ++ANV   KS +G  T   +VDLV+IRENTEGEYSG+EH   PGVV+S+K++T + 
Sbjct: 109 KELDIYANVAIFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTAQK 168

Query: 180 SERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKEL-SKEYPDITFETELIDN 238
           +ER+ R+AF+YA    R  +  VHK+ I +L DGLF N+  E+ +KEYP++   + ++DN
Sbjct: 169 TERIARFAFDYAMKYNRKSVTAVHKANIMKLGDGLFRNLVTEIGAKEYPEVGVSSIIVDN 228

Query: 239 KVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHG 297
             +  V  P  +   V V P++YG I                  AN G   ++FE     
Sbjct: 229 ASMQAVAKPHQFD--VMVAPSMYGTI-LGNIGAALIGGPGLVPGANYGRDYAVFEPGSRH 285

Query: 298 SAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTAT 357
              DI  ++ ANPTA++LS+ +MLNH+G  + A +I  AV   IA G +  T D+ G+AT
Sbjct: 286 VGLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEG-KTTTRDIGGSAT 344

Query: 358 TSSFTEAVIKRL 369
           T+ FT AVI +L
Sbjct: 345 TTEFTNAVIAKL 356

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  243 bits (621), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 211/367 (57%), Gaps = 15/367 (4%)

Query: 6   FLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVP 65
           F +  ++R L+T     I + T  P    GR TV+ + GDG+G EI+ SV  IF A +VP
Sbjct: 2   FRQTIAKRTLATF----IPKETILPKKYGGRMTVTLLPGDGVGKEITDSVVSIFQAENVP 57

Query: 66  INWEFCDVNPI-FVNGLTTIPDPAVQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFG 123
           I+WE  D++ +   +G+    + AV+S+ +N + LKG   T   + GH SLN+  RK   
Sbjct: 58  IDWETVDISQLDHEDGV----NAAVESLKRNKIGLKGIWHTSADQVGHGSLNVAFRKQLD 113

Query: 124 LFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREASERV 183
           ++ANV   KSI G KT   NVDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+
Sbjct: 114 IYANVAFCKSIPGVKTKIPNVDLVIIRENTEGEYSGLEHESVPGVVESLKIVTKVNSERI 173

Query: 184 IRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNV 243
            ++AF++A    R  +  VHK+ I +L+DGLF N    + + YP I  ++ ++DN  +  
Sbjct: 174 AKFAFDFAMRHDRKMVTAVHKANIMKLSDGLFRNTVARVGEAYPQIKNDSIIVDNASMQA 233

Query: 244 VTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDI 302
           V  P  +   V V P++YG I                   N G + ++FE        DI
Sbjct: 234 VAKPHQFD--VMVTPSMYGTI-LGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDI 290

Query: 303 AGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFT 362
            G++ ANPTA++LSS ++L H+GL   A +I  AV   I  G    T D+ G A+T+ FT
Sbjct: 291 KGQNVANPTAMILSSTLLLQHLGLNDTASRISKAVYDVIKEGNAT-TKDIGGNASTTEFT 349

Query: 363 EAVIKRL 369
           +AVI +L
Sbjct: 350 KAVIDKL 356

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  205 bits (522), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 169/286 (59%), Gaps = 11/286 (3%)

Query: 30  PDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVPINWEFCDVNPI-FVNGLTTIPDPA 88
           P    GR+TV+ I GDG+G E++ SVK IF A ++PI+WE  ++       G+    + A
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAENIPIDWETINIKQTDHKEGV----NEA 77

Query: 89  VQSITKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLV 147
           V+S+ +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   ++DL+
Sbjct: 78  VESLRRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 148 LIRENTEGEYSGIEHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRPRIIVVHKSTI 207
           +IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++A+   R  +  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKIMTKPKTERIARFAFDFAKKYNRKAVTAVHKANI 197

Query: 208 QRLADGLFVNVAKEL-SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXX 266
            +L DGLF N+  E+  KEYPDI   + ++DN  +  V  P  +   V V P++YG I  
Sbjct: 198 MKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-L 254

Query: 267 XXXXXXXXXXXXXXXXANIGHKVSIFE-AVHGSAPDIAGKDKANPT 311
                           AN G   ++FE        DI G++ ANPT
Sbjct: 255 GNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPT 300

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  165 bits (418), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 118/353 (33%), Positives = 180/353 (50%), Gaps = 27/353 (7%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSAADVP--INWEFCDVNPIFVNGLTT---IPDPAVQSI 92
           T+  I GDGIG E+  + K++  + +    +N++F D+   F     T   +PD  VQ +
Sbjct: 26  TIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFIDLQAGFQTFQDTGKALPDETVQIL 85

Query: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149
            +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+EG  +    VD++++
Sbjct: 86  KEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLYANIRPVKSVEG--SNERPVDMIIV 143

Query: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITREASERVIRYAFEYA----RAIGRPRII 200
           RENTE  Y  IE           V ++ K I+  A++R+   A + A    +  G+  + 
Sbjct: 144 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQRIATIALDIALQRLQNNGKATLT 203

Query: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
           V HKS +   +DGLF  V +E+      +Y  IT+  +++D+ V  +   P  +   V V
Sbjct: 204 VTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQIVDSMVYRMFREPECFD--VIV 261

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLS 316
            PNLYGDI                  AN+G ++ I E  HGSAPDIAGK  ANP A + S
Sbjct: 262 APNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 320

Query: 317 SVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           + +ML  +G    A  I  AV + +  G   +T DL G ATT +  + ++ RL
Sbjct: 321 TALMLEFLGHNEAAQDIHKAVDANLRDGLV-KTADLGGNATTQNVVDDILARL 372

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  165 bits (417), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 119/390 (30%), Positives = 196/390 (50%), Gaps = 41/390 (10%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLRN   R  +RR +    + ++              T+  I GDGIG E+  + KK+  
Sbjct: 1   MLRNGVYRACARRTVVNGARSNL--------------TIGLIPGDGIGKEVIPAGKKVLE 46

Query: 61  --AADVPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112
                  I+++F D++     F++    +PD  V  + +    AL G + +P  K  G+ 
Sbjct: 47  TIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYS 106

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPG 167
           S  + LRK  GL+AN+RP KS+ G  T    VD+V++RENTE  Y     + I+      
Sbjct: 107 SPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTK 164

Query: 168 VVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKELS 223
           V ++ K I+  A+ ++ + A + A    +  G+  + V HKS +   +DGLF  V +++ 
Sbjct: 165 VAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVY 224

Query: 224 KE----YPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
           ++    Y ++++  +++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 225 EKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVVAPNLYGDILSDGAAALVGSLGVV 282

Query: 280 XXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLS 339
              AN+G  + I E  HGSAPDI+G+  +NP A + S+ +ML  +G    A  IQNAV  
Sbjct: 283 PS-ANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDE 341

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            I SG + +T DL G ++T+  T+ ++ +L
Sbjct: 342 NIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 123/355 (34%), Positives = 177/355 (49%), Gaps = 31/355 (8%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSAADVP--INWEFCDVNPIFVNGLTT---IPDPAVQSI 92
           T+  I GDGIG E+  + K++    +    + ++F D+   F   L T   +PD  VQ +
Sbjct: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86

Query: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149
                 AL G + +P  K  G+ S  + LRK  GLFANVRP KS+ G K     VD+V++
Sbjct: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144

Query: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITREASERVIRYAFEYA----RAIGRPRII 200
           RENTE  Y  IE           V ++ K I+  A+ R+   A + A    +  G+  + 
Sbjct: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204

Query: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
           V HKS +   +DGLF  + K++      +Y  IT+  +++D+ V  +   P  +   V V
Sbjct: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLS 316
            PNLYGDI                  AN+G ++ I E  HGSAPDIAGK  ANP A + S
Sbjct: 263 APNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321

Query: 317 SVMMLNHMGLTSHADQIQNAVLSTIASGPEN--RTGDLAGTATTSSFTEAVIKRL 369
           + +ML  +G    A  I  AV + +    EN  +T DL G +TT   TE V+ RL
Sbjct: 322 TALMLEFLGHNDAAQDIHRAVEANMR---ENKIKTPDLGGNSTTQQVTEDVLARL 373

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  162 bits (411), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 120/355 (33%), Positives = 181/355 (50%), Gaps = 30/355 (8%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSAADVP--INWEFCDVNPIFVNGLTT---IPDPAVQSI 92
           T+  I GDGIG E+  + K++    +    +N++F D+   F   L T   +PD  +Q +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQ-V 83

Query: 93  TKNLV--ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVL 148
            KN    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+EG  TT + VD+V+
Sbjct: 84  LKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVI 141

Query: 149 IRENTEG------EYSGIEHIVCPGVVQSIKLITREASERVIRYAFEYA----RAIGRPR 198
           +RENT        E + I+      V ++ K I+  A+ R+   A + A    +  G+  
Sbjct: 142 VRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKAT 201

Query: 199 IIVVHKSTIQRLADGLFVNVAKEL----SKEYPDITFETELIDNKVLNVVTNPSAYTNAV 254
           + V HKS +   +DGLF  + K++      +Y  I +  +++D+ V  +   P  +   V
Sbjct: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--V 259

Query: 255 SVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALL 314
            V PNLYGDI                  AN+G ++ I E  HGSAPDIAGK  +NP A +
Sbjct: 260 VVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATI 318

Query: 315 LSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            S+ +ML  +G    A  I  AV + +    + +T DL G +TT   TE V+ RL
Sbjct: 319 RSTALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  161 bits (408), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 129/391 (32%), Positives = 186/391 (47%), Gaps = 45/391 (11%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           M+R  F++ + R + S  K  +IG                 I GDGIG E+  + KKI  
Sbjct: 1   MMRTRFIQLSRRAYASNAKNLTIG----------------LIPGDGIGKEVIPAGKKILE 44

Query: 61  AAD--VPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GH 111
           + +    ++++F D+      F N    +PD  +  I KN    AL G + +P  K  G+
Sbjct: 45  SLNPKYGLSFKFIDLQAGWETFQNTGKALPDETI-DILKNQCEGALFGAVQSPTTKVEGY 103

Query: 112 RSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCP 166
            S  + LRK  GLFANVRP KS++G K     VDLV++RENTE  Y     S I+     
Sbjct: 104 SSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIVRENTEDLYIKLEKSYIDEATGT 161

Query: 167 GVVQSIKLITREASERVIRYAFEYARAI----GRPRIIVVHKSTIQRLADGLFVNVAKEL 222
            V  + K IT  A++ +   A + A+      G   + V HKS +   +DGLF  V +E 
Sbjct: 162 RVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRET 221

Query: 223 ----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXX 278
                 +Y  + +  +++D+ V  +   P  +   V V PNLYGDI              
Sbjct: 222 YEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGSLGV 279

Query: 279 XXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVL 338
               AN+G  + I E  HGSAPDIAGK  +NP A + S+ +ML  +G    A  I  AV 
Sbjct: 280 VPS-ANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVD 338

Query: 339 STIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           + I  G +  T DL G +TT    E V+ +L
Sbjct: 339 ANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  159 bits (401), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 188/386 (48%), Gaps = 39/386 (10%)

Query: 6   FLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVP 65
            LR + R+F  + +  S          S    T+  I GDGIG E+  + K++    +  
Sbjct: 1   MLRTSVRQFSVSARNAS----------SLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKK 50

Query: 66  --INWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GHRSLNL 116
             + +EF D+      F++    +P   V  I KN    AL G + +P  K  G+ S  +
Sbjct: 51  HGLAFEFIDLQAGYQTFLDTGAALPRDTV-DILKNKCQGALFGAVQSPTTKVEGYSSPIV 109

Query: 117 TLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVC-----PGVVQS 171
            LRK  GLFANVRP K++EG  T  + +DLV++RENTE  Y  IE           + ++
Sbjct: 110 QLRKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEA 167

Query: 172 IKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKE-- 225
            K IT  A++R+ + A + A    +  G   + V HKS +   +DGLF  V KE+ +   
Sbjct: 168 TKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNK 227

Query: 226 --YPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXA 283
             Y  + +  +++D+ V  +   P  +   V V PNLYGDI                  A
Sbjct: 228 SLYSGVAYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGSLGLVPS-A 284

Query: 284 NIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIAS 343
           N+G  + I E  HGSAPDIAGK  ANP A + S+  ML ++G ++ A  I  AV + I  
Sbjct: 285 NVGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRD 344

Query: 344 GPENRTGDLAGTATTSSFTEAVIKRL 369
             + +T DL G +TT    + ++ +L
Sbjct: 345 N-KIKTADLGGDSTTQQVIDDILGKL 369

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  159 bits (401), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 123/390 (31%), Positives = 190/390 (48%), Gaps = 39/390 (10%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLR +  R T+ R  S+ +             +    T+  I GDGIG E+  + K+I  
Sbjct: 1   MLRGSATRLTAMRGFSSTRL------------AQKALTIGLIPGDGIGKEVIPAGKQILE 48

Query: 61  --AADVPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112
                  ++++F D++     F N    +PD  V+ + ++   AL G + +P  K  G+ 
Sbjct: 49  KVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYS 108

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVC-PG---- 167
           S  + LRK  GLFANVRP K++EG  T    VD+V++RENTE  Y  IE     P     
Sbjct: 109 SPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTR 166

Query: 168 VVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKEL- 222
           V ++ K I+  A+ R+   A + A    ++ G   + V HKS +   +DGLF  + K++ 
Sbjct: 167 VAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVY 226

Query: 223 ---SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
                +Y  I +  +++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 227 ESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGSLGVV 284

Query: 280 XXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLS 339
              AN+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I  AV S
Sbjct: 285 PS-ANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDS 343

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            I    + +T DL G +TT    + ++ ++
Sbjct: 344 NIREN-QIKTPDLGGKSTTQQVVDDILSKI 372

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  158 bits (400), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 123/390 (31%), Positives = 190/390 (48%), Gaps = 43/390 (11%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLR+T  +   R + S  K  +IG                 I GDGIG E+  + K +  
Sbjct: 1   MLRSTVSQFARRSYASAAKPLTIG----------------LIPGDGIGKEVIPAGKLVLE 44

Query: 61  --AADVPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112
             ++   + + F D+      F++    +PD  ++ +  +   AL G + +P  K  G+ 
Sbjct: 45  NLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYS 104

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPG 167
           S  + LRK  GL+ANVRP KS++G  T    VD++++RENTE  Y     + I+      
Sbjct: 105 SPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTR 162

Query: 168 VVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAK--- 220
           V ++IK I+  A+  + + A E +    +A G+  + V HKS +   +DGLF  V K   
Sbjct: 163 VAEAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVY 222

Query: 221 ELSKE-YPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
           E +KE Y  I +  +++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 223 ESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGSLGVV 280

Query: 280 XXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLS 339
              AN+GH   + E  HGSAPDIAGK  +NP A + S+ +ML  MG T  A  I  AV +
Sbjct: 281 PS-ANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDT 339

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            I    + +T DL G +TT    + ++ ++
Sbjct: 340 NIREN-QIKTPDLGGKSTTQQVVDDILSKM 368

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  156 bits (395), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 113/353 (32%), Positives = 172/353 (48%), Gaps = 28/353 (7%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSA----ADVPINWEFCDVN-PIFVNGLTTIPDPAVQSI 92
           T+  I GDGIG E+  + +++  A     D+  ++E  D     F+     +P   V+++
Sbjct: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81

Query: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149
            +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G   T + VDLV++
Sbjct: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138

Query: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITREASERV----IRYAFEYARAIGRPRII 200
           RENTE  Y   E           V ++IK I+  A+ER+    +R A +  R  GR  + 
Sbjct: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198

Query: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
           V HKS +    DGLF  V +E+     K Y  I +  +++D+ V  +   P  +   V V
Sbjct: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLS 316
            PNLYGD+                   N+G+ + I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 APNLYGDLLSDGAAALVGSLGLVPS-VNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315

Query: 317 SVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
             +ML  +GL   A  I  AV   +    +  + DL G  TT    + ++ R+
Sbjct: 316 VSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  156 bits (395), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 125/390 (32%), Positives = 188/390 (48%), Gaps = 40/390 (10%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLR+   R ++ R L+T             + +    T+  I GDGIG E+  + K++  
Sbjct: 1   MLRSVATRLSTCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47

Query: 61  AADVP--INWEFCDVNPIFVNGLTT---IPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112
             +    +++ F D+   F     T   +PD  V+ + +    AL G + +P  K  G+ 
Sbjct: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYS 107

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167
           S  + LR+  GLFANVRP KS+EG K   + +D+V++RENTE  Y  IE           
Sbjct: 108 SPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165

Query: 168 VVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKEL- 222
           V  + K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF  + KE+ 
Sbjct: 166 VADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVY 225

Query: 223 ---SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
                +Y  I +  +++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVV 283

Query: 280 XXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLS 339
              AN+G ++ I E  HGSAPDIAGK  ANP A + S+ +ML  +G  + A  I  AV +
Sbjct: 284 PS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDA 342

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            +  G   +T DL G A+T    E V+ RL
Sbjct: 343 NLREGA-IKTPDLGGKASTQQVVEDVLSRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  155 bits (393), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/353 (33%), Positives = 175/353 (49%), Gaps = 27/353 (7%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSAADVP--INWEFCDVNPIFVNGLTT---IPDPAVQSI 92
           T+  I GDGIG E+  + K++    +    +++ F D+   F     T   +PD  V+ +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVL 84

Query: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149
            +    AL G + +P  K  G+ S  + LR+  GLFANVRP KS+EG K   + +D+V++
Sbjct: 85  KEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGEKG--KPIDMVIV 142

Query: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITREASERVIRYAFEYA----RAIGRPRII 200
           RENTE  Y  IE           V  + K I+  A+ R+   A + A    +  G+  + 
Sbjct: 143 RENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGQATLT 202

Query: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
           V HKS +   +DGLF  + KE+      +Y  I +  +++D+ V  +   P  +   V V
Sbjct: 203 VTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIV 260

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLS 316
            PNLYGDI                  AN+G ++ I E  HGSAPDIAGK  ANP A + S
Sbjct: 261 APNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 319

Query: 317 SVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           + +ML  +G    A  I  AV + +  G   +T DL G A+T    + V+ RL
Sbjct: 320 TALMLEFLGHNEAAQDIYKAVDANLREG-SIKTPDLGGKASTQQVVDDVLSRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  154 bits (390), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 117/390 (30%), Positives = 188/390 (48%), Gaps = 43/390 (11%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           M R++  +  +RR  S  K   IG                 I GDGIG E+  + K++  
Sbjct: 1   MFRSSVAKVAARRAYSAPKSMKIG----------------LIPGDGIGKEVIPAGKQVLE 44

Query: 61  A--ADVPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112
           A  +   + ++F D+      F      +PD  V+ + +    AL G + +P  K  G+ 
Sbjct: 45  ALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYS 104

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPG 167
           S  + LRK  GL+ANVRP KS+E  K    NVD++++RENTE  Y     + ++      
Sbjct: 105 SPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTR 162

Query: 168 VVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKEL- 222
           V ++IK I+  A+ ++   A + +    ++ G   + V HKS +   +DGLF  + K++ 
Sbjct: 163 VAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVY 222

Query: 223 ---SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXX 279
                +Y ++ +  +++D+ V  +   P  +   V V PNLYGDI               
Sbjct: 223 EKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGSLGVV 280

Query: 280 XXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLS 339
              AN+G ++ I E  HGSAPDIAGK  +NP A + S+ +ML  +G    A  I  AV +
Sbjct: 281 PS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDA 339

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            +  G  N T DL G ATT    + ++ ++
Sbjct: 340 NLIKGDVN-TPDLGGKATTQQVVDDILSKI 368

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  154 bits (390), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 116/353 (32%), Positives = 173/353 (49%), Gaps = 27/353 (7%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSAADVP--INWEFCDVNPIFVNGLTT---IPDPAVQSI 92
           T+  I GDGIG E+  + K+I    +    +++ F D+   F     T   +PD  ++ +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVL 84

Query: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149
                 AL G + +P  K  G+ S  + LR+  GL+ANVRP KS+EG K   + +D+V++
Sbjct: 85  KDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKD--KPIDMVIV 142

Query: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITREASERVIRYAFEYA----RAIGRPRII 200
           RENTE  Y  IE           V  +IK I+  A+ R+ + A + A    +  G   + 
Sbjct: 143 RENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLT 202

Query: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
           V HKS +   +DGLF  + K++      +Y  I +  +++D+ V  +   P  +   V V
Sbjct: 203 VTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIV 260

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLS 316
            PNLYGDI                  AN+G  + I E  HGSAPDIAGK  ANP A + S
Sbjct: 261 APNLYGDILSDGAAALVGSLGVVPS-ANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRS 319

Query: 317 SVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           + +ML  +G    A  I  AV + +  G    T DL G A+T    + V+ RL
Sbjct: 320 TALMLEFLGHNDAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  154 bits (390), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 126/396 (31%), Positives = 192/396 (48%), Gaps = 52/396 (13%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKI-- 58
           MLR +     +R+F     Q +IG  + K +      T+  I GDGIG E+  S +++  
Sbjct: 1   MLRRSVY---NRQF-----QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLE 47

Query: 59  ---------FSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIG 108
                    F+  D+   W+       F++    +P   V+++ +N   AL G + +P  
Sbjct: 48  TIGPKHGLTFNFIDLQAGWQ------TFLDTGKALPVETVKTLRENCDGALFGAVQSPTT 101

Query: 109 K--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCP 166
           K  G+ S  + LRK  GL+AN+RP KS++      + VD+V++RENTE  Y  +E     
Sbjct: 102 KVEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYID 159

Query: 167 G-----VVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVN 217
                 V  + K I+  A+ R+ + A + A    +  G  ++ V HKS +   +DGLF  
Sbjct: 160 EKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFRE 219

Query: 218 VAKELSKE----YPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXX 273
           V KE+ +     Y DI +  ++ID+ V  +   P  +   V V PNLYGDI         
Sbjct: 220 VCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALV 277

Query: 274 XXXXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQI 333
                    AN+G  + I E  HGSAPDIAGK  +NP A + S+ +ML  +G +  A  I
Sbjct: 278 GSLGVVPS-ANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDI 336

Query: 334 QNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           Q AV S +    + +T DL G  +TS     VI+RL
Sbjct: 337 QTAVDSNLRE-DKIKTPDLGGKNSTSDVVNDVIRRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  153 bits (387), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 117/353 (33%), Positives = 171/353 (48%), Gaps = 27/353 (7%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSAADVP--INWEFCDVNPIFVNGLTT---IPDPAVQSI 92
           T+  I GDGIG E+  + K++    +    +++ F D+   F     T   +PD  V  +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVNVL 84

Query: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149
            K    AL G + +P  K  G+ S  + LR+  GLFANVRP KS+EG +   + +D+V++
Sbjct: 85  KKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGSRN--KPIDMVIV 142

Query: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITREASERVIRYAFEYA----RAIGRPRII 200
           RENTE  Y  IE           V  + K I+  A+ R+   A + A    +  G   + 
Sbjct: 143 RENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGEATLT 202

Query: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
           V HKS +    DGLF  + KE+      +Y  I +  +++D+ V  +   P  +   V V
Sbjct: 203 VTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIV 260

Query: 257 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLS 316
            PNLYGDI                  AN+G ++ I E  HGSAPDIAGK  ANP A + S
Sbjct: 261 APNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 319

Query: 317 SVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           + +ML  +G    A  I  AV + +  G    T DL G A+T    + V+ RL
Sbjct: 320 TALMLEFLGHNGAAQDIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  151 bits (381), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 186/391 (47%), Gaps = 44/391 (11%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLR+   R  +RR  ++  +  +               +  I GDGIG E+  + K++  
Sbjct: 1   MLRSAIGRLATRRAYASAPKSMV---------------IGLIPGDGIGKEVIPAGKQVLE 45

Query: 61  --AADVPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GH 111
             +    +N++F D+      F      +P+  VQ + KN    AL G + +P  K  G+
Sbjct: 46  NLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQ-VLKNQCQGALFGAVQSPTTKVEGY 104

Query: 112 RSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG---- 167
            S  + LRK  GL+ANVRP KS+EG K     VD+V++RENTE  Y  +E          
Sbjct: 105 SSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGT 162

Query: 168 -VVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKEL 222
            V ++ K I+  A+ R+   A + A    +  G   + V HKS +   +DGLF  + K++
Sbjct: 163 RVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDV 222

Query: 223 ----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXX 278
                 +Y  + +  +++D+ V  +   P  +   V V PNLYGDI              
Sbjct: 223 YESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGSLGV 280

Query: 279 XXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVL 338
               AN+G ++ I E  HGSAPDIAGK  +NP A + S+ +ML  +G    A  I  AV 
Sbjct: 281 VPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVD 339

Query: 339 STIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           + +    + +T DL G +TT    E ++ +L
Sbjct: 340 ANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  147 bits (370), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 113/361 (31%), Positives = 173/361 (47%), Gaps = 42/361 (11%)

Query: 37  YTVSFIEGDGIGPEI----SKSVKKI-------FSAADVPINWEFCDVNPIFVNGLTTIP 85
           +T+  I GDGIG E+     K ++KI       F   D+   W+       F++    +P
Sbjct: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQ------TFLDTGKALP 73

Query: 86  DPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142
           D  V+ +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KS++G  T   
Sbjct: 74  DDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDR 131

Query: 143 NVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITREASERVIRYAFEYA----RA 193
            VDLV+ RENTE  Y     + I+      V ++IK I+  A+  +   A E A    + 
Sbjct: 132 PVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKE 191

Query: 194 IGRPRIIVVHKSTIQRLADGLFVNVAKEL---SKEYPDITFETELIDNKVLNVVTNPSAY 250
            G   + V HKS +   +DGLF  + K +   +K++ ++ +  +++D+ V  +   P  +
Sbjct: 192 KGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCF 251

Query: 251 TNAVSVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANP 310
              V V PNLYGDI                   N+G  + I E  HGSAPDI G+  ANP
Sbjct: 252 D--VIVAPNLYGDILSDGAAALVGSLGVVPS-VNVGPNIVIGEPCHGSAPDIVGQGIANP 308

Query: 311 TALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPEN--RTGDLAGTATTSSFTEAVIKR 368
            A + S+ ++L  +GL   A  I+  V   I    EN  +T DL G +T       ++ R
Sbjct: 309 IATIRSAALLLEFLGLPEAARHIEKVVDENIR---ENKIKTPDLGGNSTGEQVANDILSR 365

Query: 369 L 369
           +
Sbjct: 366 I 366

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  146 bits (369), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 120/391 (30%), Positives = 191/391 (48%), Gaps = 42/391 (10%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLR+   ++ + R LST     I +            T+  I GDGIG E+  + K++  
Sbjct: 1   MLRSVVTKSATIRHLST---KGINK----------SLTIGLIPGDGIGKEVIPAGKQVLQ 47

Query: 61  --AADVPINWEFCDVNPIFVNGLTT---IPDPAVQSITKNLVA-LKGPLATPIGK--GHR 112
             ++   +N+ F D+   F   L T   +PD  V+ + +     L G + +P  +   + 
Sbjct: 48  NLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYS 107

Query: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----V 168
           S  + LRK   L+AN+RP KS+ G  +  + VD+V++RENTE  Y  IE          V
Sbjct: 108 SPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIVRENTEDLYIKIEKSYKDQNGMRV 166

Query: 169 VQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKELSK 224
            ++ K IT  A+ ++ + A + A    +  G+  + V HKS +   +DGLF  + K++ +
Sbjct: 167 AEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQ 226

Query: 225 ----EYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXXXX 280
               +Y  I +  ++ID+ V  +   P  +   V V PNLYGDI                
Sbjct: 227 ANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIVAPNLYGDILSDGAAALVGSLGVVP 284

Query: 281 XXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLST 340
             AN+G  + + E  HGSAPDIAGK  ANP A + S+ +ML  +G    A  I  AV S 
Sbjct: 285 S-ANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESN 343

Query: 341 IASGPEN--RTGDLAGTATTSSFTEAVIKRL 369
           +    EN  +T DL G ++T +  + V+++L
Sbjct: 344 MR---ENKIKTPDLGGNSSTQNVVDDVLEKL 371

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  144 bits (363), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 118/391 (30%), Positives = 181/391 (46%), Gaps = 46/391 (11%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLR +F +   R + S  K  +IG                 I GDGIG E+  + +++  
Sbjct: 1   MLRASFTQLARRSYASASKSLTIG----------------LIPGDGIGKEVIPAGRQVLE 44

Query: 61  --AADVPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GH 111
             ++   + ++F D+      F      +PD  +  I +N    AL G + +P  K  G+
Sbjct: 45  NLSSKHGLKFDFIDLQAGWQTFQETGKALPDETI-DILRNQCQGALFGAVQSPTNKVEGY 103

Query: 112 RSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCP 166
            S  + LRK  GL+ANVRP KS+         VD++++RENTE  Y     + I+     
Sbjct: 104 SSPIVALRKKLGLYANVRPVKSV---LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGT 160

Query: 167 GVVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKEL 222
            V ++IK I+  A++ +   A E A    +  G   + V HKS +   +DGLF  V +++
Sbjct: 161 RVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQV 220

Query: 223 SKEYPD----ITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXX 278
            +   D    I +  +++D+ V  +   P  +   V V PNLYGDI              
Sbjct: 221 YESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAALVGSLGV 278

Query: 279 XXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVL 338
               AN+G    + E  HGSAPDIAGK  +NP A + S+ +ML  MG    A  I  AV 
Sbjct: 279 VPS-ANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVD 337

Query: 339 STIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           + +      +T DL G +TT    E V+ R+
Sbjct: 338 ANLRDN-SIKTPDLGGKSTTQQVVEDVLSRM 367

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  142 bits (359), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 118/391 (30%), Positives = 182/391 (46%), Gaps = 46/391 (11%)

Query: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60
           MLR +F +   R + S  K  +IG                 I GDGIG E+  + K +  
Sbjct: 1   MLRTSFNQLARRSYTSATKSLTIG----------------LIPGDGIGREVIPAGKLVLE 44

Query: 61  --AADVPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GH 111
             ++   + + F D+      F++    +PD  +  I KN    AL G + +P  K  G+
Sbjct: 45  NLSSKHGLKFNFIDLEAGWQTFLDTGKALPDETI-DILKNECQGALFGAVQSPTNKVEGY 103

Query: 112 RSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCP 166
            S  + LRK  GL+ANVRP KS+    +  + +D+V++RENTE  Y     + I+     
Sbjct: 104 SSPIVALRKKLGLYANVRPVKSV---LSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGT 160

Query: 167 GVVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKEL 222
            V ++IK I+  A+  +   A E A    +  G   + V HKS +   +DGLF  + +++
Sbjct: 161 RVAEAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQV 220

Query: 223 SKEYPD----ITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXXXXX 278
            +   D    I +  +++D+ V  +   P  +   V V PNLYGDI              
Sbjct: 221 YESNQDKFGSINYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVGSLGV 278

Query: 279 XXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVL 338
               AN+G    + E  HGSAPDIAGK  +NP A + S+ +ML  MG    A  I  AV 
Sbjct: 279 VPS-ANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVD 337

Query: 339 STIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           + +      +T DL G +TT    + V+ R+
Sbjct: 338 ANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 92/352 (26%), Positives = 159/352 (45%), Gaps = 34/352 (9%)

Query: 42  IEGDGIGPEISKSVKKIFSA-----ADVPINWEFCDVNPIFVNGL-TTIPDPAVQSITKN 95
           + GD IG E+ +   K+  A     +DV  ++++  V    ++   + +PD A+ +  + 
Sbjct: 10  LPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAAKEA 69

Query: 96  LVALKGPLATPIGKG-----HRSLNLTLRKTFGLFANVRP----AKSIEGFK----TTYE 142
              L G +  P  +G      + L L LR+  G++AN+RP    A S+            
Sbjct: 70  DAVLLGAVGGPKWQGGAVRPEQGL-LKLRQELGVYANLRPCNFAADSLLELSPLRPEIAR 128

Query: 143 NVDLVLIRENTEGEYSGIEH-IVCPGVVQSIKLITREASERVIRYAFEYARAIGRPR-II 200
           + D++++RE   G Y G  H     GV       T +  +R+ R A   A     P  + 
Sbjct: 129 DTDIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMAGFLALQHDPPLPVW 188

Query: 201 VVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNL 260
            + K+ +   +      V +    E+P++  + +LID+  + +V NP A+ N V V  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETFQSEFPNVQLQHQLIDSAAMILVKNPRAF-NGVVVTSNM 247

Query: 261 YGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDI-AGKDKANPTALL 314
           +GDI                        +      ++E  HGSAPD+ AG  KANP   +
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPDLPAG--KANPIGCI 305

Query: 315 LSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAV 365
           LS+ MML   + + +  + ++ AV   + SG   RTGDL G+++TS   +A+
Sbjct: 306 LSAAMMLKLSLNMVAAGEAVEQAVQEVLDSG--VRTGDLLGSSSTSEVGDAI 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 95/357 (26%), Positives = 158/357 (44%), Gaps = 34/357 (9%)

Query: 39  VSFIEGDGIGPEISKSVKKIFSA---ADVPINWEF----CDVNPIFVNGLTTIPDPAVQS 91
           +  + GD +G EI+    K+  A    D  IN++F         I   G+  +PD A+++
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVP-LPDEALEA 64

Query: 92  ITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEGFKTTYE 142
              +   L G +  P  G G     + L L +RK  GL+AN+RP    ++S+ G      
Sbjct: 65  SKNSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 143 NV----DLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRP 197
            +    D +++RE   G Y G  +     GV    +  +    +R+ R A   A     P
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNPP 183

Query: 198 R-IIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
             I  + K+ +   +      V + +  E+P +T + +LID+  + +V NP+   N + +
Sbjct: 184 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQNQLIDSAAMILVKNPTQL-NGIII 242

Query: 257 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPT 311
             N++GDI                        +      ++E  HGSAPD+  K K NP 
Sbjct: 243 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPI 301

Query: 312 ALLLSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           A +LS+ MML   + L    D I+ AV   + +G   RTGDL G+ +T+   +A+ K
Sbjct: 302 ATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAG--IRTGDLGGSNSTTEVGDAIAK 356

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 121/270 (44%), Gaps = 20/270 (7%)

Query: 116 LTLRKTFGLFANVRP----AKSIEGFK----TTYENVDLVLIRENTEGEYSGI-EHIVCP 166
           L +RK  GL+AN+RP    +KS+ G         +  D V++RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 167 GVVQSIKLITREASERVIRYAFEYARAIGRPR-IIVVHKSTIQRLADGLFVNVAKELSKE 225
           GV    +  T    ER+ R     A     P  +    K+ +   +      V + + +E
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRRTVNETIKRE 213

Query: 226 YPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P ++ + +LID+  + ++ NP  + N + +  N++GDI                     
Sbjct: 214 FPQLSVQHQLIDSAAMIMIKNPRKF-NGIVITSNIFGDIISDAASVIPGSLGLLPSASLA 272

Query: 281 XXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLN-HMGLTSHADQIQNAVLS 339
              +  +   ++E  HGSAPD+  K +ANP A +LS+ MML   + +      I+NAV  
Sbjct: 273 SEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQ 331

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            I SG   RTGDL G  TT+   +AV   L
Sbjct: 332 VIESGI--RTGDLGGNNTTTEVGDAVTHAL 359

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 88.2 bits (217), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 160/359 (44%), Gaps = 34/359 (9%)

Query: 39  VSFIEGDGIGPEISKSVKKIFSA-ADVPINWEFCDVNPIFVNGLTT------IPDPAVQS 91
           +  + GD +G EI+    K+  A +DV  N +F D     + G         +PD A+++
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKF-DFENHLIGGAAIDATGVPLPDEALEA 65

Query: 92  ITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKT 139
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 140 TY-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRP 197
            + +  D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGERKEDDGDGVAWDCEQYTVPEVQRITRMAAFMALQHEPP 184

Query: 198 R-IIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
             I  + K+ +   +      V + +  E+P +  + +LID+  + +V NP+ + N + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIII 243

Query: 257 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---VSIFEAVHGSAPDIAGKDKANPT 311
             N++GDI                    A++  K     ++E  HGSAPD+  K+K NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPV 302

Query: 312 ALLLSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           A +LS+ MML   + L      I++AV   + +G   RTGDL G+ +T+   +AV K +
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAG--IRTGDLGGSNSTTEVGDAVAKEV 359

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 97/357 (27%), Positives = 152/357 (42%), Gaps = 34/357 (9%)

Query: 39  VSFIEGDGIGPEISKSVKKIFSA-ADVPINWEFCDVNPIFVNGLTT------IPDPAVQS 91
           ++   GD IG EI +   K+  A A+V  N  F   N   + G         + D A+Q 
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSF-KYNYQLIGGAAIDATGEPLTDEALQV 65

Query: 92  ITKNLVALKGPLATPIGKGHRSLN-----LTLRKTFGLFANVRPAKSIEGF--------K 138
              +   L G +  P   GH  +      L +RK  G++AN+RP + +           +
Sbjct: 66  AKNSDAILLGAVGGP-KWGHGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLSPLKR 124

Query: 139 TTYENVDLVLIRENTEGEYSGIEHIVCP-GVVQSIKLITREASERVIRYAFEYARAIGRP 197
              +  D V++RE   G Y G        GV    +  +    +R+ R A   A     P
Sbjct: 125 EIVQGTDFVIVRELVGGIYFGERQEAGDDGVAWDKESYSVPEIQRITRMAAFLALQHNPP 184

Query: 198 R-IIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
             +  + K+ +   +      V + +  E+P +T    LID+  + +V NP+   N V +
Sbjct: 185 LPVWSLDKANVLATSRLWRKTVEETIKNEFPTLTINHHLIDSAAMTLVQNPTKL-NGVVI 243

Query: 257 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---VSIFEAVHGSAPDIAGKDKANPT 311
             N++GDI                    A++  K   + ++E  HGSAPD+   D ANP 
Sbjct: 244 TTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAPDLPA-DHANPI 302

Query: 312 ALLLSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           A +LS+ MM    + LT   + I+ AV  TI +G   +TGDL G  TT+    AV K
Sbjct: 303 ATILSAAMMCKLSLNLTKEGNAIEEAVKRTIDAGI--KTGDLGGKNTTTEVGNAVAK 357

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 98/362 (27%), Positives = 159/362 (43%), Gaps = 40/362 (11%)

Query: 39  VSFIEGDGIGPEISKSVKKIFSAADVPINWEFCDVNPIFVNGL----------TTIPDPA 88
           +  + GD +G EI+    K+  A    I+    DVN  F N L            +PD A
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKA----ISEVRSDVNFDFENHLIGGAAIDATGVPLPDEA 62

Query: 89  VQSITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEG 136
           +++  K    L G +  P  G G     + L L +RK   L+AN+RP          +  
Sbjct: 63  LEASKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSP 121

Query: 137 FKTTY-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAI 194
            K  + +  D V++RE   G Y G  +     GV    +  T    +R+ R A   A   
Sbjct: 122 IKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQH 181

Query: 195 GRPR-IIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNA 253
             P  I  + K+ +   +      V + +  E+P +  + +LID+  + +V NP+ + N 
Sbjct: 182 EPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNG 240

Query: 254 VSVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---VSIFEAVHGSAPDIAGKDKA 308
           + +  N++GDI                    A++  K     ++E  HGSAPD+  K+K 
Sbjct: 241 IIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKV 299

Query: 309 NPTALLLSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           NP A +LS+ MML   + L      I++AV   + +G   RTGDL G+ +T+   +AV K
Sbjct: 300 NPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG--IRTGDLGGSNSTTEVGDAVAK 357

Query: 368 RL 369
            +
Sbjct: 358 EV 359

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 85.9 bits (211), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 93/353 (26%), Positives = 155/353 (43%), Gaps = 33/353 (9%)

Query: 44  GDGIGPEISKSVKKIFSAAD-----VPINWEFCDVNPIFVNGLTT-IPDPAVQSITKNLV 97
           GD +G EI +   K+    +     V  N+++  +    ++     +PD  +++  ++  
Sbjct: 12  GDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEAAKQSDA 71

Query: 98  ALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAKSIE----GFKTTYENV---- 144
            L G +  P  G G     + L L +RK  GL+ N+RP K I     G     E V    
Sbjct: 72  VLLGAVGGPKWGTGKVRPEQGL-LKIRKELGLYGNLRPCKFISDKLIGLSPLKEEVCKGT 130

Query: 145 DLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRPRIIVVH 203
           D V++RE   G Y G  +     GV    +  + E  +R+ + A  +      P + +  
Sbjct: 131 DFVVVRELVGGIYFGERQEDDGSGVAWDSEKYSIEEVKRITKMA-AFLSLQNDPPLPIWS 189

Query: 204 KSTIQRLADG-LFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYG 262
                 LA   L+     E   E+P++  + +LID+  + +V NP+   N + +  N++G
Sbjct: 190 LDKANVLASSRLWRAAVDETIAEFPNLKVQHQLIDSAAMMLVKNPTQL-NGIILTNNMFG 248

Query: 263 DIXXXXXXXX--XXXXXXXXXXANIGHK---VSIFEAVHGSAPDIAGKDKANPTALLLSS 317
           DI                    A++  K     ++E  HGSAPD+A + K NP A +LS+
Sbjct: 249 DIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPDLA-RGKVNPVATILSA 307

Query: 318 VMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
            MML   + +    + I+ AV   +  G   RT DL G +TTS   +AV + L
Sbjct: 308 AMMLKLSLDMVQEGEAIERAVSVVLDRGI--RTADLGGNSTTSELGDAVAQEL 358

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score = 85.9 bits (211), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 160/359 (44%), Gaps = 34/359 (9%)

Query: 39  VSFIEGDGIGPEISKSVKKIFSA-ADVPINWEFCDVNPIFVNGLTT------IPDPAVQS 91
           +  + GD +G EI+    K+  A +DV  N +F D     + G         +PD A+++
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKF-DFENHLIGGAAIDATGVPLPDEALEA 65

Query: 92  ITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKT 139
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 140 TY-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRP 197
            + +  D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPP 184

Query: 198 R-IIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
             I  + K+ +   +      V + +  E+P +  + +LID+  + +V NP+ + N + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPT-HLNGIII 243

Query: 257 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---VSIFEAVHGSAPDIAGKDKANPT 311
             N++GDI                    A++  K     ++E  HGSAPD+  K+K NP 
Sbjct: 244 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPI 302

Query: 312 ALLLSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           A +LS+ MML   + L      I++AV   + +G   RTGDL G+ +T+   +AV + +
Sbjct: 303 ATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG--IRTGDLGGSNSTTEVGDAVAEEV 359

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score = 85.9 bits (211), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 95/354 (26%), Positives = 153/354 (43%), Gaps = 34/354 (9%)

Query: 42  IEGDGIGPEISKSVKKIFSA-ADVPINWEFCDVNPIFVNGLTT------IPDPAVQSITK 94
           + GD +G EI++   K+  A ++V  N  F +     + G         +PD A+++  K
Sbjct: 8   LPGDHVGQEITEEAIKVLKAISEVRPNATF-NFQHHLIGGAAIDATGVPLPDEALEASKK 66

Query: 95  NLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKTTY- 141
               L G +  P  G G     + L L +RK   L+AN+RP          +   K  Y 
Sbjct: 67  ADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLELSPLKAQYA 125

Query: 142 ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRPR-I 199
           +  D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  I
Sbjct: 126 QGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNPPLPI 185

Query: 200 IVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPN 259
             + K+ +   +      V K + +E+P ++   +LID+  + +V NP+   N + +  N
Sbjct: 186 WSLDKANVLASSRLWRKTVEKTIKEEFPTLSVNHQLIDSAAMILVKNPTQL-NGIIITSN 244

Query: 260 LYGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALL 314
           ++GDI                        +      ++E  HGSAPD+A K K NP A +
Sbjct: 245 MFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLA-KGKVNPVATI 303

Query: 315 LSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           LS+ MML   + +      I+ AV   +  G   RTGDL G+ +TS   +AV K
Sbjct: 304 LSAAMMLKLSLNMVEEGVAIEKAVKKVLDDG--IRTGDLGGSNSTSEVGDAVAK 355

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score = 85.5 bits (210), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 89/356 (25%), Positives = 157/356 (44%), Gaps = 32/356 (8%)

Query: 39  VSFIEGDGIGPEISKSVKKIFSA-----ADVPINWEFCDVNPIFVNGL-TTIPDPAVQSI 92
           +  + GD +G E++    K+ +A      ++  N++   +    ++   T +PD A+++ 
Sbjct: 5   IVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEALEAS 64

Query: 93  TKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKTT 140
            K    L G +  P  G G     + L L +RK  GL+AN+RP          +   K  
Sbjct: 65  KKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASDSLLDLSPLKPE 123

Query: 141 Y-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRPR 198
           Y +  D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P 
Sbjct: 124 YAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQQNPPL 183

Query: 199 -IIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVC 257
            I  + K+ +   +      V + +  E+P +T + +LID+  + +V +P+   N V + 
Sbjct: 184 PIWSLDKANVLASSRLWRKTVEETIKTEFPQLTVQHQLIDSAAMILVKSPTKL-NGVVIT 242

Query: 258 PNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTA 312
            N++GDI                        +      ++E  HGSAPD+   +K NP A
Sbjct: 243 NNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPDLPA-NKVNPIA 301

Query: 313 LLLSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
            +LS+ MML   + L      ++ AV + + +G   RTGDL G+ +T+   +A+ K
Sbjct: 302 TILSAAMMLKLSLDLVEEGRALEEAVRNVLDAG--VRTGDLGGSNSTTEVGDAIAK 355

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 94/356 (26%), Positives = 154/356 (43%), Gaps = 34/356 (9%)

Query: 42  IEGDGIGPEISKSVKKIFSA-ADVPINWEFCDVNPIFVNGLTT------IPDPAVQSITK 94
           + GD +G EI++   K+  A ++V    +F +     + G         +PD ++++  K
Sbjct: 10  LPGDHVGQEITEEAVKVLKAISEVRPEKQF-EFQYHLIGGAAIDATGEPLPDASLEAAKK 68

Query: 95  NLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFK-TTY 141
           +   L G +  P  G G     + L L +RK   L+AN+RP          +   K    
Sbjct: 69  SDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKPECA 127

Query: 142 ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRPR-I 199
              D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  +
Sbjct: 128 RGTDFVVVRELVGGIYFGERKEDTGDGVAWDSEQYSVPEVQRITRMAAFLALQHSPPLPV 187

Query: 200 IVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPN 259
             + K+ +   +      V + +  E+P +T + +LID+  + +V NP+   N V +  N
Sbjct: 188 WSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPTQL-NGVIITNN 246

Query: 260 LYGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALL 314
           ++GDI                        +      ++E  HGSAPD+  K K NP A +
Sbjct: 247 MFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KGKVNPIATI 305

Query: 315 LSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           LS+ MML   + +      ++ AV   + SG   RT DL GT+TTS   EAV+K L
Sbjct: 306 LSAAMMLKLSLDMFEEGAAVEEAVRKVLDSG--VRTADLKGTSTTSEVGEAVVKAL 359

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 94/359 (26%), Positives = 161/359 (44%), Gaps = 34/359 (9%)

Query: 39  VSFIEGDGIGPEISKSVKKIFSA-----ADVPINWEFCDVNPIFVNGLTTIP--DPAVQS 91
           +  + GD +G EI++   K+  A      +V  ++E+  +    ++  T +P  D A+++
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDA-TGVPLTDEALEA 65

Query: 92  ITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKT 139
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLELSPIKP 124

Query: 140 TY-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRP 197
            +    D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P
Sbjct: 125 QFARGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHQPP 184

Query: 198 R-IIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
             I  + K+ +   +      V + +  E+P +  + +LID+  + +V NP+   N + +
Sbjct: 185 LPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPTQL-NGIII 243

Query: 257 CPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---VSIFEAVHGSAPDIAGKDKANPT 311
             N++GDI                    A++  K     ++E  HGSAPD+  K+K NP 
Sbjct: 244 TSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPI 302

Query: 312 ALLLSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           A +LS+ MML   + +T+    I++AV   + +G   RTGDL G+ +T    +AV K +
Sbjct: 303 ATILSAAMMLKLSLNMTAEGQAIEDAVKKVLDAG--IRTGDLGGSNSTIEVGDAVAKEV 359

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 96/361 (26%), Positives = 158/361 (43%), Gaps = 39/361 (10%)

Query: 38  TVSFIEGDGIGPEISKSVKKIFSAADV----PINWEFCDVNPIFVNGLTT------IPDP 87
           T+  + GD +G EI++   K+ +A        +N++F   +   + G         +PD 
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKF---DHHLIGGAAIDATGVPLPDE 62

Query: 88  AVQSITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIE 135
           A+++  K    L G +  P  G G     + L L +RK   L+AN+RP          + 
Sbjct: 63  ALEASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLS 121

Query: 136 GFK-TTYENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARA 193
             K       D V++RE   G Y G  +     GV    +  +    +R+ R A   A  
Sbjct: 122 PLKPEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMALQ 181

Query: 194 IGRPR-IIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTN 252
              P  I  + K+ +   +      V + +  E+P +T + +LID+  + +V NP+ + N
Sbjct: 182 HNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLTVQHQLIDSAAMILVKNPT-HLN 240

Query: 253 AVSVCPNLYGDIXXXXXXXX--XXXXXXXXXXANIGHK---VSIFEAVHGSAPDIAGKDK 307
            + +  N++GDI                    A++  K     ++E  HGSAPD+  K K
Sbjct: 241 GIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KGK 299

Query: 308 ANPTALLLSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVI 366
            NP A +LS+ MML   + L    + I+ AV   + SG   RT DL GT +T+   +AV 
Sbjct: 300 VNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSG--IRTADLKGTNSTTEVGDAVA 357

Query: 367 K 367
           K
Sbjct: 358 K 358

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 119/268 (44%), Gaps = 20/268 (7%)

Query: 116 LTLRKTFGLFANVRPAK-------SIEGFKTTY-ENVDLVLIRENTEGEYSGI-EHIVCP 166
           L +RK   L+AN+RP          +   K  + +  D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 167 GVVQSIKLITREASERVIRYAFEYARAIGRPR-IIVVHKSTIQRLADGLFVNVAKELSKE 225
           GV    +  T+   +R+ R A   A     P  I  + K+ +   +      V + +  E
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 211

Query: 226 YPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDIXXXXXXXXXXX-----XXXXX 280
           +P +    +LID+  + +V +P+   N + +  NL+GDI                     
Sbjct: 212 FPQLKLNHQLIDSAAMILVKSPTQL-NGIVLTSNLFGDIISDEASVIPGSLGLLPSASLA 270

Query: 281 XXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLN-HMGLTSHADQIQNAVLS 339
              +      ++E  HGSAPD+  K K NP A++LS+ MML   + L+   + ++ AV  
Sbjct: 271 SLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQ 329

Query: 340 TIASGPENRTGDLAGTATTSSFTEAVIK 367
            + SG   RTGDL G+ +TS   +A+ K
Sbjct: 330 VLDSG--VRTGDLGGSNSTSEVGDAIAK 355

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 87/357 (24%), Positives = 156/357 (43%), Gaps = 33/357 (9%)

Query: 39  VSFIEGDGIGPEISKSVKKIFSA------ADVPINWEFCDVNPIFVNGL-TTIPDPAVQS 91
           +  + GD +G EI++   K+  A      + V  ++++  +    ++     + D A+++
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALEA 66

Query: 92  ITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEGFKTTYE 142
             K    L G +  P  G G     + L L +RK  GL+AN+RP    ++ + G      
Sbjct: 67  SKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASEPLLGLSPLRP 125

Query: 143 NV----DLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRP 197
            +    D +++RE   G Y G  +     GV    +  +    ER+ R A   A     P
Sbjct: 126 EIAKGTDFMVVRELVGGIYFGERKEDDGDGVAWDSEKYSVPEVERITRMAAFLALQHNPP 185

Query: 198 R-IIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
             I  + K+ +   +      V   +  E+P +T + +LID+  + +V NP+   N + +
Sbjct: 186 LPIWSLDKANVLASSRLWRKTVEATIKNEFPTLTVQNQLIDSAAMILVKNPTQL-NGIII 244

Query: 257 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPT 311
             N++GDI                        +      ++E  HGSAPD+  K+K NP 
Sbjct: 245 TSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPV 303

Query: 312 ALLLSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           A +LS+ MML   + +    + ++ AV   + +G   RTGDL G+ +T    +A+ K
Sbjct: 304 ATILSAAMMLKLSLNMVKEGEAVEEAVRRVLDAG--VRTGDLGGSNSTQEVGDAIAK 358

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 92/354 (25%), Positives = 152/354 (42%), Gaps = 34/354 (9%)

Query: 42  IEGDGIGPEISKSVKKIFSA-ADVPINWEFCDVNPIFVNGLTT------IPDPAVQSITK 94
           + GD +G EI++   K+ +A + V  N  F D     + G         +PD A+++  K
Sbjct: 93  LPGDHVGQEITEEAIKVLNAISSVRPNVNF-DFQHHLIGGAAIDATGVPLPDEALEASKK 151

Query: 95  NLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFK-TTY 141
               L G +  P  G G     + L L +RK   L+AN+RP          +   K    
Sbjct: 152 ADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLKPEIV 210

Query: 142 ENVDLVLIRENTEGEYSG-IEHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRPR-I 199
           +  D+ ++RE   G Y G  +     GV    +  +    +R+ R A   A     P  +
Sbjct: 211 KGTDICIVRELVGGIYFGERKEDEGDGVAWDSEKYSVSEVQRITRMAGFLALQHNPPLPV 270

Query: 200 IVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPN 259
             + K+ +   +      V + +  E+P +T + +LID+  + +V NP+ + N V +  N
Sbjct: 271 WSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPT-HLNGVVIANN 329

Query: 260 LYGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALL 314
           ++GDI                        +      ++E  HGSAPD+  K K NP A +
Sbjct: 330 MFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPVATI 388

Query: 315 LSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           LS  MML   + +T     ++ AV   + SG   RT DL G+ +TS   +A+ K
Sbjct: 389 LSVAMMLKLSLNMTEEGIAVEKAVKQVLDSGV--RTADLRGSNSTSEVGDAIAK 440

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 88/355 (24%), Positives = 152/355 (42%), Gaps = 30/355 (8%)

Query: 39  VSFIEGDGIGPEISKSVKKIFSA-----ADVPINWEFCDVNPIFVNGL-TTIPDPAVQSI 92
           +  + GD +G EI+    ++  A      DV  ++++  +    ++     +PD A+ + 
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEALDAA 66

Query: 93  TKNLVALKGPLATP-IGKGHRSLN---LTLRKTFGLFANVRPAK-------SIEGFKTTY 141
            K    L G +  P  G G        L +RK   L+AN+RP          +   K  Y
Sbjct: 67  KKADAVLLGAVGGPKWGTGQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKPEY 126

Query: 142 -ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRPR- 198
            +  D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  
Sbjct: 127 AKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQQNPPLP 186

Query: 199 IIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCP 258
           I  + K+ +   +      V + +  E+P +T + +LID+  + +V +P+   N + +  
Sbjct: 187 IWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKSPTKL-NGIVITS 245

Query: 259 NLYGDIXXXXXXXX-----XXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTAL 313
           N++GDI                        +      ++E  HGSAPD+  K+K NP A 
Sbjct: 246 NMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIAT 304

Query: 314 LLSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           +LS+ MML   + L    + ++ AV   + +G   RT DL G  +TS   +AV+K
Sbjct: 305 ILSAAMMLKLSLNLVEEGNAVEEAVRRVLDAG--IRTADLRGENSTSEVGDAVVK 357

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 90/352 (25%), Positives = 150/352 (42%), Gaps = 34/352 (9%)

Query: 44  GDGIGPEISKSVKKIFSA-ADVPINWEFCDVNPIFVNGLTT------IPDPAVQSITKNL 96
           GD +G EI+    K+  A ++V  + +F +     + G         +PD ++++  K  
Sbjct: 12  GDHVGQEITDEAIKVLKAISEVRSSVKF-EFQQHLIGGAAIDATGEPLPDASLEAAKKAD 70

Query: 97  VALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKTTY-EN 143
             L G +  P  G G     + L L +RK   L+AN+RP          +   K  +   
Sbjct: 71  AVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKAEHARG 129

Query: 144 VDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRPR-IIV 201
            D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  +  
Sbjct: 130 TDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQHNPPLPVWS 189

Query: 202 VHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLY 261
           + K+ +   +      V + +  E+P +T + +LID+  + +V NP+   N V +  N++
Sbjct: 190 LDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMIMVKNPTQL-NGVIITNNMF 248

Query: 262 GDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLS 316
           GDI                        +      ++E  HGSAPD+  K K NP A +LS
Sbjct: 249 GDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLE-KGKVNPIATILS 307

Query: 317 SVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           + MML   + +      ++ AV   + SG   RTGDL G+ +T    +AV K
Sbjct: 308 AAMMLELSLDMFEEGTAVEEAVRRVLDSG--IRTGDLRGSNSTQEVGDAVAK 357

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 92/360 (25%), Positives = 150/360 (41%), Gaps = 39/360 (10%)

Query: 39  VSFIEGDGIGPEISKSVKKIF----SAADVPINWEFCDVNPIFVNGL------TTIPDPA 88
           +  + GD +G EI     K+     S++   I +EF       + G       T +PD A
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEF---QRHLIGGASIDATGTPLPDEA 62

Query: 89  VQSITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEGFKT 139
           + +   +   L G +  P  G G     + L L +RK   L+AN+RP    + S+ G   
Sbjct: 63  LDAAKNSDAVLLGAVGGPKWGTGDVRPEQGL-LKIRKELQLYANLRPCNFVSDSLLGLSP 121

Query: 140 TYENV----DLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAI 194
             E +    D  ++RE   G Y G  +     G     +  T    +R+ R A   A   
Sbjct: 122 LKEEIAKGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMAAFLALQH 181

Query: 195 GRPR-IIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNA 253
             P  I  + K+ +   +      V + +  E+P++  + +LID+  + +V +P    N 
Sbjct: 182 DPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPNLKVQHQLIDSAAMILVKSPRQL-NG 240

Query: 254 VSVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKA 308
           + +  N++GDI                        +      ++E  HGSAPD+  K K 
Sbjct: 241 IIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKV 299

Query: 309 NPTALLLSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
           NP A +LS+ MML   + L      I+ AV   + +G   RT DL G+ +TS   +AV K
Sbjct: 300 NPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAG--IRTADLKGSNSTSEVGDAVAK 357

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 86/357 (24%), Positives = 148/357 (41%), Gaps = 33/357 (9%)

Query: 39  VSFIEGDGIGPEISKSVKKIFSAAD------VPINWEFCDVNPIFVNGL-TTIPDPAVQS 91
           +  + GD +G E+++   KI  A +      V  N+E+  +    ++     +PD ++++
Sbjct: 7   IVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLEA 66

Query: 92  ITKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGFKT 139
             +    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 67  SKRADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLKE 125

Query: 140 TY-ENVDLVLIRENTEGEYSGI-EHIVCPGVVQSIKLITREASERVIRYAFEYARAIGRP 197
            Y +  D  ++RE   G Y G  +     GV    +  +    +R+ R A   A     P
Sbjct: 126 KYAKGTDFTVVRELVGGIYFGKRKEDDGDGVAWDSEQYSVPEVQRITRMAAFLAMQHNPP 185

Query: 198 R-IIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256
             I  + K+ +   +      V + +  E+P +    +LID+  + +V NP+   N + +
Sbjct: 186 LPIWSLDKANVLASSRLWRKTVEETIQNEFPSLKVSHQLIDSAAMILVKNPTQL-NGIII 244

Query: 257 CPNLYGDIXXXXXXX-----XXXXXXXXXXXANIGHKVSIFEAVHGSAPDIAGKDKANPT 311
             N++GDI                        +      ++E  HGSAPD+  K K NP 
Sbjct: 245 TNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLYEPCHGSAPDLP-KGKVNPI 303

Query: 312 ALLLSSVMMLN-HMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIK 367
             +LS  MML   + L      ++ AV   + +    RT DL G+ +TS   +AV K
Sbjct: 304 GTILSVAMMLKLSLNLKEEGIAVEEAVRRVLDNNI--RTADLGGSNSTSDIGDAVAK 358

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 319 MMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           +MLNH+GL   A +I  AV  TIA G ++ T D+ G+++T+ FT  +I +L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTNEIINKL 50

>ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR089W
          Length = 832

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%)

Query: 312 ALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369
           AL L    ML   G       ++N  +S +AS   N  G+L   ATT S T AV  R+
Sbjct: 121 ALELFMAWMLQRFGRHHFKVPVENLAMSIVASSLVNDRGELLSYATTCSVTYAVTTRI 178

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 10/73 (13%)

Query: 199 IIVVHKSTIQRLADGLFVNVAKEL-----SKEYP--DITFETELIDNKVLNVVTNPSAYT 251
           + +  K+TI +  DG F ++ +E+      KE+   +IT+E  LID+ V  ++ +   Y 
Sbjct: 222 LFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQMIKSKGGYI 281

Query: 252 NAVSVCPNLYGDI 264
            A+    N  GD+
Sbjct: 282 MALK---NYDGDV 291

>NCAS0A05250 Chr1 (1038189..1038776) [588 bp, 195 aa] {ON} Anc_4.152
           YGR016W
          Length = 195

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 225 EYP-DITFETELIDNKVLNVVTNPSAYTNAVSVC 257
           EYP D   + ELI N  LN  +    Y NAVSVC
Sbjct: 36  EYPMDSEEQEELIQNFALNNYSRNQQYVNAVSVC 69

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,850,257
Number of extensions: 1303629
Number of successful extensions: 3839
Number of sequences better than 10.0: 90
Number of HSP's gapped: 3641
Number of HSP's successfully gapped: 90
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)