Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_8.1765.443ON1270127066260.0
Skud_15.2865.443ON1278127856470.0
YOR124C (UBP2)5.443ON1272127355800.0
Smik_15.3015.443ON1272127355440.0
ZYRO0G01606g5.443ON1305125737150.0
NCAS0H021005.443ON1269126636940.0
TDEL0D025805.443ON1272126236190.0
NDAI0C015505.443ON1295124335140.0
Kpol_1062.235.443ON1266123734560.0
KAFR0D050705.443ON1227122534230.0
KNAG0B041905.443ON1262123034170.0
SAKL0G02728g5.443ON1237123333930.0
TBLA0A064705.443ON1320127332370.0
TPHA0E017105.443ON1283122832280.0
KLTH0F15862g5.443ON1241124232230.0
CAGL0K10252g5.443ON1267125432210.0
Kwal_55.213935.443ON1233123031850.0
Ecym_45145.443ON1246124230120.0
KLLA0E02377g5.443ON1220124528530.0
ACL164C5.443ON138979219170.0
Kpol_1016.15.443ON1251122218380.0
TPHA0J026205.443ON1225125816320.0
KAFR0C045201.369ON4991531344e-07
KLTH0H13354g1.369ON4951131301e-06
SAKL0D10120g1.369ON492401282e-06
Kwal_34.162681.369ON449971272e-06
TBLA0C012001.369ON503361272e-06
KLLA0A10791g1.369ON4841091202e-05
ZYRO0G01188g1.369ON500331165e-05
Ecym_27171.369ON483901165e-05
TDEL0D024001.369ON494331148e-05
AEL029W1.369ON446901149e-05
TPHA0A025101.369ON505411121e-04
KNAG0C019401.369ON4991111122e-04
NCAS0D006001.369ON493961103e-04
Smik_7.3141.369ON499531094e-04
Skud_6.941.369ON499531084e-04
Suva_6.2761.137ON1256701095e-04
Suva_6.831.369ON500961075e-04
Kpol_534.231.369ON4961011076e-04
Kpol_2001.541.137ON1223621086e-04
YFR010W (UBP6)1.369ON499331050.001
ZYRO0C17908g1.137ON12041161050.001
TDEL0C056401.137ON1178391040.002
Smik_10.371.137ON1247511020.003
YJL197W (UBP12)1.137ON1254701020.003
Ecym_81401.137ON1264681020.003
Skud_10.221.137ON1255511010.005
CAGL0K10494g1.369ON49596990.005
NCAS0I031401.137ON1201108990.006
KAFR0D021605.712ON84652980.008
Kwal_33.136281.137ON116071980.008
KLTH0B09944g5.18ON1189125980.009
KLTH0F03674g1.137ON119851970.011
Ecym_46857.390ON77831970.013
Smik_2.497.390ON74531960.016
TPHA0A025401.137ON128628950.020
Suva_13.4955.18ON1230125950.023
NDAI0B034302.307ON85639940.023
NDAI0H035501.369ON50234930.028
YMR304W (UBP15)5.18ON1230128940.029
KLLA0A00396g5.712ON101239930.033
NDAI0B004801.137ON125369930.034
NDAI0E041807.390ON827218930.038
SAKL0C04246g1.137ON129764920.047
SAKL0E07106g2.307ON79139920.048
TBLA0E017605.712ON121233920.052
KAFR0I026005.18ON1213115910.054
KNAG0C021801.137ON123154910.055
CAGL0H10582g2.307ON79039910.055
AGR389C2.307ON77538910.059
KAFR0F015601.137ON117141910.062
NCAS0B061302.307ON77039900.067
KNAG0A054502.307ON76440900.068
Klac_YGOB_Anc_5.18b5.18ON1166122910.069
Smik_4.1152.307ON79039900.083
Smik_13.5215.18ON1231105900.089
YDL122W (UBP1)2.307ON80939890.094
Suva_4.1252.307ON79339890.094
Skud_4.1332.307ON78739890.097
YBL067C (UBP13)7.390ON74733890.10
AFR627C1.137ON128738890.10
Kwal_27.114442.307ON75739890.10
KAFR0A069102.307ON67839890.11
CAGL0M13783g5.18ON119696890.11
TDEL0B020805.712ON102593890.11
Skud_13.4785.18ON1231128890.11
KNAG0J008003.270ON76596880.11
KLTH0G10934g2.307ON75839880.12
Kpol_1003.532.307ON78840880.13
Kwal_27.108427.390ON71131880.13
CAGL0H06721g5.712ON108168880.13
Kwal_55.196455.712ON97031880.13
Skud_5.2237.390ON74831880.14
AFR296C5.712ON116949880.14
SAKL0D03322g3.270ON76557880.14
TBLA0J006001.137ON146248880.14
KAFR0C004103.270ON76963880.14
Ecym_40095.712ON151731880.14
Smik_5.2447.390ON74931870.16
KLLA0C03476g1.137ON125263870.17
KNAG0B023707.390ON75331870.18
ZYRO0A02420g2.307ON74539870.18
AGR370W7.390ON74031860.19
Kpol_1018.937.390ON75559860.21
NCAS0G001705.712ON103030860.22
Kwal_26.95985.18ON1191123860.22
Smik_9.135.712ON106067860.23
YER098W (UBP9)7.390ON75431860.24
Suva_5.2177.390ON75431860.24
TPHA0G008502.307ON78239850.26
ZYRO0D07062g5.18ON1193125860.26
Suva_2.507.390ON75051850.26
TBLA0B060802.307ON82439850.27
TPHA0D046605.712ON104526850.28
KAFR0L017307.390ON70131850.28
KLLA0E20351g7.390ON69731850.28
KNAG0L022005.712ON116133850.29
CAGL0G02563gsingletonON63129850.30
TPHA0E008707.390ON71531850.31
YIL156W (UBP7)5.712ON107131850.32
TDEL0G023702.307ON74739850.32
CAGL0L01639g1.137ON114738850.34
Skud_9.125.712ON106438850.34
TBLA0D006207.390ON117131850.35
Suva_9.305.712ON106231840.38
KLTH0E00814g5.712ON97431840.44
SAKL0E15136g5.712ON1037121840.45
Skud_2.387.390ON74836830.47
TPHA0L022905.18ON1193135830.48
NCAS0A143707.390ON72931830.50
NDAI0F002005.712ON110526830.54
TBLA0D010708.742ON48339820.59
Suva_4.2953.270ON782132820.61
NDAI0F034102.69ON87066810.85
NCAS0E026107.390ON71731810.92
TPHA0P006807.390ON72778801.0
ZYRO0F01276g3.270ON77663801.1
SAKL0F12430g7.390ON75431801.1
Kpol_1045.417.390ON71236801.2
ZYRO0B16544g5.712ON104439801.3
CAGL0A04477g7.390ON77031791.3
KLTH0C06732g7.390ON71431791.3
CAGL0G05247g8.188ON94775791.4
Skud_11.3385.712ON71230791.4
TBLA0C070205.18ON1247122791.4
KNAG0C035807.390ON77631791.5
KNAG0E012905.18ON119695791.5
NDAI0E008108.742ON49340781.7
NCAS0D023905.18ON1211128791.8
Kpol_1032.288.188ON88272781.8
CAGL0I06765g8.188ON88752781.8
KLLA0E08801g2.307ON77139782.1
NCAS0G036802.307ON48239772.1
Kpol_513.255.18ON119041782.2
Ecym_61848.188ON85176782.2
TDEL0G004105.18ON118695782.2
ZYRO0B03300g7.390ON81331772.9
Skud_2.1773.270ON78251763.0
TDEL0C015707.390ON76531763.2
NDAI0I025305.18ON119795763.3
ZYRO0G06798g8.188ON87775763.6
NDAI0A016707.390ON84635763.8
NCAS0B042808.188ON92275754.1
KAFR0K018107.390ON71433754.3
KAFR0H001505.712ON65626754.8
Suva_11.3355.712ON72489754.9
NDAI0G007802.307ON48639745.1
NDAI0A036808.188ON111631755.1
YKR098C (UBP11)5.712ON71741745.2
TPHA0O019302.16ON108178745.4
ZYRO0A05962g8.742ON46547745.5
CAGL0I05522g7.390ON72431745.6
NCAS0C021108.540ON49488745.8
CAGL0H05335g8.540ON48351736.5
NCAS0I016203.270ON79556736.9
Smik_13.4318.742ON47140737.4
NCAS0A039108.188ON79569738.1
KAFR0J017202.230ON461102728.4
KNAG0G029308.742ON45998728.6
TBLA0E025703.270ON78520728.8
SAKL0H00418g5.18ON119060729.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_8.176
         (1270 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...  2556   0.0  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...  2179   0.0  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...  2154   0.0  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...  2140   0.0  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...  1435   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...  1427   0.0  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....  1398   0.0  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....  1358   0.0  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...  1335   0.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...  1323   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....  1320   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...  1311   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...  1251   0.0  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....  1248   0.0  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...  1246   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...  1245   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...  1231   0.0  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  1164   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...  1103   0.0  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...   743   0.0  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   712   0.0  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   633   0.0  
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    56   4e-07
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    55   1e-06
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    54   2e-06
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    54   2e-06
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    54   2e-06
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    51   2e-05
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    49   5e-05
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    49   5e-05
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    49   8e-05
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    49   9e-05
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    48   1e-04
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    48   2e-04
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    47   3e-04
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    47   4e-04
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    46   4e-04
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    47   5e-04
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    46   5e-04
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    46   6e-04
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    46   6e-04
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    45   0.001
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    45   0.001
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    45   0.002
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    44   0.003
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    44   0.003
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    44   0.003
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    44   0.005
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    43   0.005
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    43   0.006
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    42   0.008
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    42   0.008
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    42   0.009
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    42   0.011
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    42   0.013
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    42   0.016
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    41   0.020
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    41   0.023
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     41   0.023
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    40   0.028
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    41   0.029
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    40   0.033
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    40   0.034
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    40   0.038
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    40   0.047
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    40   0.048
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    40   0.052
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    40   0.054
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    40   0.055
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...    40   0.055
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    40   0.059
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    40   0.062
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    39   0.067
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    39   0.068
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    40   0.069
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    39   0.083
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    39   0.089
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    39   0.094
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    39   0.094
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    39   0.097
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    39   0.10 
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    39   0.10 
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    39   0.10 
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    39   0.11 
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    39   0.11 
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    39   0.11 
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    39   0.11 
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    39   0.11 
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    39   0.12 
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    39   0.13 
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    39   0.13 
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    39   0.13 
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    39   0.13 
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    39   0.14 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    39   0.14 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    39   0.14 
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    39   0.14 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    39   0.14 
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    39   0.14 
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    38   0.16 
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    38   0.17 
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    38   0.18 
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    38   0.18 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    38   0.19 
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    38   0.21 
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      38   0.22 
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    38   0.22 
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    38   0.23 
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    38   0.24 
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    38   0.24 
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    37   0.26 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    38   0.26 
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    37   0.26 
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    37   0.27 
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    37   0.28 
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    37   0.28 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    37   0.28 
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    37   0.29 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    37   0.30 
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    37   0.31 
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    37   0.32 
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    37   0.32 
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    37   0.34 
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    37   0.34 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    37   0.35 
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    37   0.38 
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    37   0.44 
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    37   0.45 
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    37   0.47 
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    37   0.48 
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    37   0.50 
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      37   0.54 
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    36   0.59 
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    36   0.61 
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    36   0.85 
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    36   0.92 
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    35   1.0  
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    35   1.1  
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    35   1.1  
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    35   1.2  
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    35   1.3  
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    35   1.3  
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    35   1.3  
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    35   1.4  
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    35   1.4  
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    35   1.4  
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    35   1.5  
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    35   1.5  
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    35   1.7  
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    35   1.8  
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    35   1.8  
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    35   1.8  
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    35   2.1  
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    34   2.1  
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    35   2.2  
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...    35   2.2  
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    35   2.2  
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    34   2.9  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    34   3.0  
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    34   3.2  
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    34   3.3  
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    34   3.6  
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    34   3.8  
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     33   4.1  
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    33   4.3  
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    33   4.8  
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    33   4.9  
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               33   5.1  
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              33   5.1  
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...    33   5.2  
TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2...    33   5.4  
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    33   5.5  
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    33   5.6  
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    33   5.8  
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    33   6.5  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    33   6.9  
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    33   7.4  
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     33   8.1  
KAFR0J01720 Chr10 (330744..332129) [1386 bp, 461 aa] {ON} Anc_2....    32   8.4  
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    32   8.6  
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    32   8.8  
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    32   9.4  

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 2556 bits (6626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1246/1270 (98%), Positives = 1246/1270 (98%)

Query: 1    MPNEDNELQNAIEGDQNILSNHEKGHTVDNTTSIDDCPLYEASASQQSTRADVDDGKHLL 60
            MPNEDNELQNAIEGDQNILSNHEKGHTVDNTTSIDDCPLYEASASQQSTRADVDDGKHLL
Sbjct: 1    MPNEDNELQNAIEGDQNILSNHEKGHTVDNTTSIDDCPLYEASASQQSTRADVDDGKHLL 60

Query: 61   YPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYSNFRSRIR 120
            YPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYSNFRSRIR
Sbjct: 61   YPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYSNFRSRIR 120

Query: 121  PDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYH 180
            PDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYH
Sbjct: 121  PDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYH 180

Query: 181  LKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGIYVSDDTNK 240
            LKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGIYVSDDTNK
Sbjct: 181  LKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGIYVSDDTNK 240

Query: 241  LILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKG 300
            LILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKG
Sbjct: 241  LILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKG 300

Query: 301  PLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVD 360
            PLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVD
Sbjct: 301  PLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVD 360

Query: 361  YVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSSIQTSFSILPWF 420
            YVGDWKIRKIRESYVRKCLQLIFWGQ            KNTKSVKGLSSIQTSFSILPWF
Sbjct: 361  YVGDWKIRKIRESYVRKCLQLIFWGQLSASLLAPNSLLKNTKSVKGLSSIQTSFSILPWF 420

Query: 421  QLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLY 480
            QLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLY
Sbjct: 421  QLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLY 480

Query: 481  FDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYK 540
            FDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYK
Sbjct: 481  FDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYK 540

Query: 541  FETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDE 600
            FETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDE
Sbjct: 541  FETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDE 600

Query: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQ 660
            DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQ
Sbjct: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQ 660

Query: 661  EALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLL 720
            EALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLL
Sbjct: 661  EALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLL 720

Query: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSN 780
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSN
Sbjct: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSN 780

Query: 781  SEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840
            SEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV
Sbjct: 781  SEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840

Query: 841  EFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTNGDVEKDENNHEKTESN 900
            EFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTNGDVEKDENNHEKTESN
Sbjct: 841  EFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTNGDVEKDENNHEKTESN 900

Query: 901  DVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYD 960
            DVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYD
Sbjct: 901  DVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYD 960

Query: 961  EDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFR 1020
            EDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFR
Sbjct: 961  EDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFR 1020

Query: 1021 DEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1080
            DEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA
Sbjct: 1021 DEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1080

Query: 1081 DTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVENT 1140
            DTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVENT
Sbjct: 1081 DTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVENT 1140

Query: 1141 VLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHR 1200
            VLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHR
Sbjct: 1141 VLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHR 1200

Query: 1201 GEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEA 1260
            GEASYGHYWIYIKDRNQNGVWRKYNDETIS            GNTATPYFLVYVKQGQEA
Sbjct: 1201 GEASYGHYWIYIKDRNQNGVWRKYNDETISEVPEEEVFNFNEGNTATPYFLVYVKQGQEA 1260

Query: 1261 DIEPLKRILE 1270
            DIEPLKRILE
Sbjct: 1261 DIEPLKRILE 1270

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 2179 bits (5647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1063/1278 (83%), Positives = 1139/1278 (89%), Gaps = 8/1278 (0%)

Query: 1    MPNEDNELQNAIEGDQNILSNHEKGHTVDNTTSIDDCPLYEASASQQSTRADVDDGKHLL 60
            MP EDNELQ AIEG Q+ LSN EK +T ++ T IDD PLY   AS QS    VDDGKHLL
Sbjct: 1    MPYEDNELQTAIEGHQSQLSNQEKNNTPNDDTFIDDSPLYGTRASLQSAPVAVDDGKHLL 60

Query: 61   YPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYSNFRSRIR 120
            YPDIAT LPLKTSDRLLDD+LCDT F NSTDP+VIE+GLQTSGIL++SMLSYS+FRS IR
Sbjct: 61   YPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYSSFRSSIR 120

Query: 121  PDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYH 180
            P+ALGSLTDQV +QTKTEYDSISCP+YNKI V QAVI NPSL EQQI++FDDIV+IPIYH
Sbjct: 121  PNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDIVRIPIYH 180

Query: 181  LKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGIYVSDDTNK 240
            LKVTVKIRQELERLKKHVGVTQFH+LDHLHEYD  DLSTFDSSDP L DYGIYVSDDTNK
Sbjct: 181  LKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIYVSDDTNK 240

Query: 241  LILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKG 300
            LILIEIF PEF+SPEE +SFTT AI+KRYND+CLKNESLN+ E PSQPDCFYTLFKIFKG
Sbjct: 241  LILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYTLFKIFKG 300

Query: 301  PLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVD 360
            PL RKS  +PIKTIDSGN+VLNTHLN EWLTSKYGFQASSEIDEETN+ FTEYVPPDMV 
Sbjct: 301  PLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEYVPPDMVG 360

Query: 361  YVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSSIQTSFSILPWF 420
            YVGDW  RKIRES+V+KCLQLIFWGQ            KNTKSVKGLSS+QTSFS  PWF
Sbjct: 361  YVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQTSFSTSPWF 420

Query: 421  QLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLY 480
             LLGESRARILLN NEQAHSPLDAE HFINLSVSHYYTDRDIIRNYEALSSLDP+NIGLY
Sbjct: 421  HLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLDPDNIGLY 480

Query: 481  FDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYK 540
            FDALTYIANRKGAYQ+IAYCGKQ+IIGQEALENAL+ FKIDPK+++IAELNEATLLSIYK
Sbjct: 481  FDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELNEATLLSIYK 540

Query: 541  FETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDE 600
            FETSNK+K  SNHLTN KNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTL+IDESVDE
Sbjct: 541  FETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600

Query: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQ 660
            DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQF  YYGPEKL YQ
Sbjct: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYGPEKLHYQ 660

Query: 661  EALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLL 720
            EALKLLQVNENASDET+LKIFK KW+DE+V+EPDQFLIL+AALT+ISIERNSNLITNFLL
Sbjct: 661  EALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSNLITNFLL 720

Query: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSN 780
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLR YIL YQKTL+NFNDHLSN
Sbjct: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSN 780

Query: 781  SEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840
            S HVRR+GGREIS GEVERSIQFI+QLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV
Sbjct: 781  SGHVRRIGGREISRGEVERSIQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840

Query: 841  EFEVEGNKESNDATILKEEETG-----GANAINEQDPILIDFEVDENTNGDVEKDENN-- 893
            EFEVEGNK  ++   +  +  G      A    E+DP LID E+++ TN DV+KD  N  
Sbjct: 841  EFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSDVDKDIENVK 900

Query: 894  -HEKTESNDVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIES 952
             +E  E+ND+EI + ++ TDLASPTRVAKI SDQLENALEMGRQQDVTECIGNVLFQIES
Sbjct: 901  ANEANEANDIEITVGENITDLASPTRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIES 960

Query: 953  GSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIY 1012
            GSEPIRYDEDNEQYDLIKQLFYGTTKQ IVPLSATDKVRTKVERFLSLLVNIGDHPKDIY
Sbjct: 961  GSEPIRYDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIY 1020

Query: 1013 DAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE 1072
            DAFDSYF+DEYLTM EYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE
Sbjct: 1021 DAFDSYFKDEYLTMEEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKE 1080

Query: 1073 VIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLL 1132
            VIYMDRY+DT+N  LLAKKEETEQ+KQ  K MKNRQRELL+RD SGLTRKDAFLE+IKLL
Sbjct: 1081 VIYMDRYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLL 1140

Query: 1133 ESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYS 1192
            ES+IV     N ED K++I+ LK+ + DIDNELMSLY+DINSLEDKISHQFDDF+EYGYS
Sbjct: 1141 ESNIVVTEASNSEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYS 1200

Query: 1193 LFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLV 1252
            LFSVFIHRGEASYGHYWIYIKDRN  GVWRKYNDETIS            GNTATPYFLV
Sbjct: 1201 LFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISEVQEEEVFNFNEGNTATPYFLV 1260

Query: 1253 YVKQGQEADIEPLKRILE 1270
            YVKQGQE+DIEPLKRILE
Sbjct: 1261 YVKQGQESDIEPLKRILE 1278

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 2154 bits (5580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1047/1273 (82%), Positives = 1130/1273 (88%), Gaps = 4/1273 (0%)

Query: 1    MPNEDNELQNAIEGDQNILSNHEKGHTVDNTTSIDDCPLYEASASQQSTRADVDDGKHLL 60
            MPNEDNELQ AIE   N L N +K +   N + I+D PLY  S +QQST  DVDDGKHLL
Sbjct: 1    MPNEDNELQKAIENHHNQLLNQDKENADRNGSVIEDLPLYGTSINQQSTPGDVDDGKHLL 60

Query: 61   YPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYSNFRSRIR 120
            YPDIAT LPLKTSDRLLDDILCDT F NSTDP V+++GLQ+ GILK+SMLSYS FRS IR
Sbjct: 61   YPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYSTFRSSIR 120

Query: 121  PDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYH 180
            P+ LGSLTDQVV QTK+EYDSISCP+YNKI V QAVIFNPSL EQQI+ FDDIVKIPIYH
Sbjct: 121  PNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDIVKIPIYH 180

Query: 181  LKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGIYVSDDTNK 240
            LKV+VK+RQELERLKKHVGVTQFH+LDHLHEYD  DLSTFDSSDPNL DYGIYVSDDTNK
Sbjct: 181  LKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIYVSDDTNK 240

Query: 241  LILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKG 300
            LILIEIF PEF+SPEE +SFT  AI+KRYN +C+KNESL+++ETPSQ DCFYTLFKIFKG
Sbjct: 241  LILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYTLFKIFKG 300

Query: 301  PLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVD 360
            PL RKS A+P KTIDSGN+ LNTHLNPEWLTSKYGFQASSEIDEETNE FTEYVPPDMVD
Sbjct: 301  PLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEYVPPDMVD 360

Query: 361  YVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSSIQTSFSILPWF 420
            YV D + RKIRES+VRKCLQLIFWGQ            KNTKSVKG+SS+QTSFS LPWF
Sbjct: 361  YVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTSFSTLPWF 420

Query: 421  QLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLY 480
             LLGESRARILLN NEQ HSPLDAEPHFINLSVSHYYTDRDIIRNYE+LSSLDPENIGLY
Sbjct: 421  HLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLDPENIGLY 480

Query: 481  FDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYK 540
            FDALTYIANRKGAYQ+IAYCGKQDIIGQEALENAL++FKI+PK+ +I+ELNEATLLSIYK
Sbjct: 481  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEATLLSIYK 540

Query: 541  FETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDE 600
            +ETSNK++  SNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTL+IDESVDE
Sbjct: 541  YETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 600

Query: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQ 660
            DIIKTAYS+KINDSPGLKLDCDRALYTIAISKRSLDLFNFLT+ECPQF NYYGPEKLDYQ
Sbjct: 601  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYGPEKLDYQ 660

Query: 661  EALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLL 720
            EALKLLQVNENASDETILKIFK KWFDENVYEPDQFLIL+AALTKISIERNS LITNFLL
Sbjct: 661  EALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNSTLITNFLL 720

Query: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSN 780
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLR Y+L YQKT+ NFNDHLSN
Sbjct: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSN 780

Query: 781  SEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840
            S H+RR+GGREIS GEVERSIQFI+QLRNLFYAMVH+RERCVTPSKELAYLAFAPSNVEV
Sbjct: 781  SGHIRRIGGREISRGEVERSIQFIYQLRNLFYAMVHTRERCVTPSKELAYLAFAPSNVEV 840

Query: 841  EFEVEGNKESNDATIL---KEEETGGANAINEQDPILIDFEVDENTNGDVEKDENNHEKT 897
            EFEVEGNK  +   +L   K+E T  A     +D  LID E+++  NGDV  D  N +K 
Sbjct: 841  EFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDGLNGDVGTDA-NRKKN 899

Query: 898  ESNDVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 957
            ESND E+   +D T L SPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI
Sbjct: 900  ESNDAEVSENEDTTGLTSPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 959

Query: 958  RYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDS 1017
            RYDEDNEQYDL+KQLFYGTTKQ IVPLSAT+KVRTKVERFLSLL+NIGDHPKDIYDAFDS
Sbjct: 960  RYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDS 1019

Query: 1018 YFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD 1077
            YF+DEYLTM EYGDV RTVAVTTFPTILQVQIQRVYYDRER MPFKSIEPLPFKEVIYMD
Sbjct: 1020 YFKDEYLTMEEYGDVIRTVAVTTFPTILQVQIQRVYYDRERLMPFKSIEPLPFKEVIYMD 1079

Query: 1078 RYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIV 1137
            RYADT+N  LLAKK+ETE++KQK K MKNRQRELL+RD SGLTRKDAFLE+IKLLES  +
Sbjct: 1080 RYADTENPLLLAKKKETEEMKQKLKVMKNRQRELLSRDDSGLTRKDAFLESIKLLESDTI 1139

Query: 1138 ENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVF 1197
            + T L IE   ++IKTL+N V +IDNELM LY+DINSLE+KISHQFDDFKEYGYSLFSVF
Sbjct: 1140 KKTPLKIEAANDVIKTLRNNVQNIDNELMKLYNDINSLEEKISHQFDDFKEYGYSLFSVF 1199

Query: 1198 IHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQG 1257
            IHRGEASYGHYWIYIKDRN+NG+WRKYNDETIS            GNTATPYFLVYVKQG
Sbjct: 1200 IHRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFNFNEGNTATPYFLVYVKQG 1259

Query: 1258 QEADIEPLKRILE 1270
            QE DIEPLKRIL+
Sbjct: 1260 QEGDIEPLKRILK 1272

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 2140 bits (5544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1036/1273 (81%), Positives = 1132/1273 (88%), Gaps = 4/1273 (0%)

Query: 1    MPNEDNELQNAIEGDQNILSNHEKGHTVDNTTSIDDCPLYEASASQQSTRADVDDGKHLL 60
            M NED ELQNAIE  Q+  SN +K ++  N   I++CPLYE SAS QS   D DDGKHLL
Sbjct: 1    MANEDRELQNAIEDHQSEPSNQDKNNSASNGAVIEECPLYETSASHQSAPVDFDDGKHLL 60

Query: 61   YPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYSNFRSRIR 120
            YPDIAT LPLKTSDRLLDDILCDT F NSTDPSVIE+GLQT+GIL++SMLSYS+FRS IR
Sbjct: 61   YPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYSSFRSSIR 120

Query: 121  PDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYH 180
            P+ALGS+TDQVV+QTK EYDS SCP+YNKI V QAVI NPSL EQ +++FDDIVKIPIYH
Sbjct: 121  PNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDIVKIPIYH 180

Query: 181  LKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGIYVSDDTNK 240
            LKVTVKIRQELERLKKHVGVTQFH++D LHEYD  D STFDSSDPNL DYGIYVSDDTNK
Sbjct: 181  LKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIYVSDDTNK 240

Query: 241  LILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKG 300
            LILIEIF PEFDSPEE +SFT  AI++RY+D+CL NESL++N TPSQ DCFYTLFKIFKG
Sbjct: 241  LILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFYTLFKIFKG 300

Query: 301  PLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVD 360
            PL RKS  +P+KTIDSGN+ LNTHLNPEWLTSKYGFQ SSEIDEETNE FTEY+PPDMVD
Sbjct: 301  PLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEYLPPDMVD 360

Query: 361  YVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSSIQTSFSILPWF 420
            YV D K+RKIRES+VRKCLQL+FWGQ            KNTKSVKGLS +QTSFS LPWF
Sbjct: 361  YVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQTSFSSLPWF 420

Query: 421  QLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLY 480
             LLGESR+RILLN NE +HSPLDAEPHF+NLSVSHYYTDRDIIRNYE+LSSLDP+NIGLY
Sbjct: 421  HLLGESRSRILLNSNE-SHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDPKNIGLY 479

Query: 481  FDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYK 540
            FDALTYIANRKGAYQ+IAYCGKQDIIGQEALENAL+VFKI+PK+ +IAELNEATLLSIYK
Sbjct: 480  FDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNEATLLSIYK 539

Query: 541  FETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDE 600
            FETSNK++  S HLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTL+IDESVDE
Sbjct: 540  FETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSIDESVDE 599

Query: 601  DIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQ 660
            DIIKTAYS+KINDSPGLKLDCDRALYTIAISK+SLDLFNFLTDECPQF  YYG E+LDYQ
Sbjct: 600  DIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGAEQLDYQ 659

Query: 661  EALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLL 720
            EALKLLQVNENASDETILKIFK KWFDE+VYEPDQFL LKAALTKISIERNSNLI+NFLL
Sbjct: 660  EALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNSNLISNFLL 719

Query: 721  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSN 780
            TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLR YIL+YQKT+ NFNDHLSN
Sbjct: 720  TGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSN 779

Query: 781  SEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEV 840
            S HVRR+GGR+IS+GEVERS+QFI+QLRNLFYAMVHSRERCVTPSKELAYLAFAPSN+EV
Sbjct: 780  SGHVRRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNIEV 839

Query: 841  EFEVEGNKESNDATI---LKEEETGGANAINEQDPILIDFEVDENTNGDVEKDENNHEKT 897
            EFEVEGNK ++ A I   LKEE T  +    E DP  I  ++++NTN D  ++ +N EK 
Sbjct: 840  EFEVEGNKPADGAAIPIGLKEEATQESCTTKENDPKSIGSKMEDNTNRDTHRNPSNTEKN 899

Query: 898  ESNDVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 957
            E N+V+I+  DD TDL S TRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI
Sbjct: 900  EPNNVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPI 959

Query: 958  RYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDS 1017
            +YDEDNEQYDL+KQLFYGTTKQ IVPLSAT+KVRTKVERFLSLL+NIGDHPKDIYDAFDS
Sbjct: 960  KYDEDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDS 1019

Query: 1018 YFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD 1077
            YF+DEYLTM EYGDV RTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD
Sbjct: 1020 YFKDEYLTMEEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD 1079

Query: 1078 RYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIV 1137
            RYADT+N  LLAKK ETE++KQK + MKNRQRELL+RD SGLTRKDAFLE+IKLLESS+V
Sbjct: 1080 RYADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVV 1139

Query: 1138 ENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVF 1197
            E T L  E K ++I TL+  V +IDNELMSLY++IN+LE+KISHQFDDFKEYGYSLFSVF
Sbjct: 1140 EKTTLKTEVKIDVINTLRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVF 1199

Query: 1198 IHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQG 1257
            IHRGEASYGHYWIYIKDRN NGVWRKYNDET+S            GNTATPYFLVYVKQG
Sbjct: 1200 IHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQG 1259

Query: 1258 QEADIEPLKRILE 1270
            QEADIEPLKRIL+
Sbjct: 1260 QEADIEPLKRILQ 1272

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 1435 bits (3715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 717/1257 (57%), Positives = 909/1257 (72%), Gaps = 52/1257 (4%)

Query: 54   DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYS 113
            D GK  LYP+ A   P KT+DRLLDDIL D +F NS D S++   L ++GILK  +LSYS
Sbjct: 58   DSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDL-SNGILKSPVLSYS 116

Query: 114  NFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDI 173
                + R   LGSL DQVVLQTK EYDS+SCPQ+N +QV   V+ +  + +Q +A F+++
Sbjct: 117  RKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLID--VTQQNVATFNNL 174

Query: 174  VKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDH--LHEYDLADLSTFDSSDPNLKDYG 231
              +PI+HLKVTVK R  LER KK  G+T +H+LD   +H YD  DL TFDS DP L DY 
Sbjct: 175  ATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQLLDYA 234

Query: 232  IYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCF 291
            IYVS D+NKLILIEIF PEFDS EERD+F   +I  RY   C + +SL+    P+QPDC 
Sbjct: 235  IYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPTQPDCI 294

Query: 292  YTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFT 351
             TLFKIFKGPL RKS+ +P KTI+  N+ LN+H++P WLTSKYGF+   E DEET E   
Sbjct: 295  NTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEETGEDIL 354

Query: 352  EYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSSIQ 411
            EY PPD+ +Y  DWK+R++RES+ R+CL+LIF G+            +N K  +  S +Q
Sbjct: 355  EYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRIFSMMQ 414

Query: 412  TSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSS 471
            T+FS + WFQLLGE RA     F+ ++ SPLD++ HFI+LS  + Y DRDIIRNYEA  +
Sbjct: 415  TNFSTMFWFQLLGEYRAI----FSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQCT 470

Query: 472  LDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELN 531
            LDPEN+G+Y DAL +IANRKGAYQ+IAYCGKQD +GQEAL++AL VF+ID K++D   LN
Sbjct: 471  LDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNLN 530

Query: 532  EATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591
            ++ LLSIYK E+++      N    LKN+LRLLAK+ KS KLKFY D+EPYR ++QAY+ 
Sbjct: 531  DSVLLSIYKNESASTRNP--NRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEI 588

Query: 592  LAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNY 651
            L +DESVD+DII+TAY++K+NDSPGLK+DCDRALYTIA+  RSL LFNFL  +  +FQ Y
Sbjct: 589  LEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEY 648

Query: 652  YGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERN 711
            +GP++  YQ+AL +LQVNENA D+TIL+IF+ KW+ E V++ DQFL LK AL+KI  ERN
Sbjct: 649  FGPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERN 708

Query: 712  SNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTL 771
            S LI++F+ TGT+D + LP ENWPTG+NNIGNTCYLNSLLQYYFSI+ LR Y+L+Y+ T+
Sbjct: 709  SKLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTV 768

Query: 772  NNFNDHLSNSEHV-RRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAY 830
             +F   L+N E+  RR+GGREI+E EVERS+QF++QLR+LF +M+H+++RCVTP KELAY
Sbjct: 769  QHF---LNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAY 825

Query: 831  LAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILIDF------------- 877
            LAF PS + VEFE+    ++N    +++E     ++     P                  
Sbjct: 826  LAFVPSGLGVEFELPNASQANANAPVEKENYVNIDSEPSPPPNDEPLLIDLDDDSDPNNH 885

Query: 878  -EVDENTNGDVEKDENNHEKTESNDVE--IIMTDD---------------------ATDL 913
             ++++N+N D + +E ++ +   NDV+  I MTD                      A  +
Sbjct: 886  SKLNKNSNDDGKINEFDNSQAGENDVDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAM 945

Query: 914  ASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLF 973
             + TRVAKISSDQLENALEMGRQQDVTECIGNVLFQ+ES S+PI   +DNEQ DL+KQLF
Sbjct: 946  NTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLF 1005

Query: 974  YGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVK 1033
            YG  KQ I+PL    +VRTK ERFLSLLVNIGDHPKDIYDA D YFRDEYL + EYGDVK
Sbjct: 1006 YGNIKQNIIPLKDETQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVK 1065

Query: 1034 RTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEE 1093
            RTVAVT FPTILQ+QIQRVYYDRERFMPFKS+ PLPF E IYMDRY+DT+N  L+ +K E
Sbjct: 1066 RTVAVTDFPTILQIQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRE 1125

Query: 1094 TEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDKKNLIKT 1153
            TE+L Q+   +K RQRELL+++  GL+RK A +ET   L+S ++E   + I+++  L + 
Sbjct: 1126 TEKLVQELNGLKGRQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQE 1185

Query: 1154 LKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIK 1213
            L N V  I++EL  LY +I  LE KISHQFDDFK  GYSLF+VFIHRGEASYGHYWIYIK
Sbjct: 1186 LDNIVLGINDELSQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIK 1245

Query: 1214 DRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEADIEPLKRILE 1270
            DR ++G+WRKYNDETI+            GNTATPYFLVYVKQG E +IEPLKR+LE
Sbjct: 1246 DRYKSGIWRKYNDETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLE 1302

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 1427 bits (3694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/1266 (56%), Positives = 926/1266 (73%), Gaps = 34/1266 (2%)

Query: 30   NTTSIDDCPLYEASASQQSTRADV---DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAF 86
            ++T+ +  P+ + S  + + R +V   DDGK LLYP++  + P+KT++RL+DDI+ D +F
Sbjct: 9    SSTTENASPMLDVSERKDTQRIEVRVADDGKQLLYPNVENHFPMKTAERLIDDIIADLSF 68

Query: 87   FNSTDPSVIERG----LQTSGILKKSMLSYSNFRSRIRPDALGSLTDQVVLQTKTEYDSI 142
                      RG    +  +GILK+SML+YS  +++     +GSL DQV LQTK EY S+
Sbjct: 69   LTGIAVDNGSRGDIDTMLGNGILKQSMLNYSKVKNQPGSFEMGSLIDQVTLQTKYEYKSV 128

Query: 143  SCPQYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQ 202
            +CP+ NK+QV   V+FN S    QI   D++ + PIYHLKVTVK R  LE  KKH GVTQ
Sbjct: 129  TCPELNKLQVFFGVLFNNS---TQITNLDEVTQFPIYHLKVTVKTRNHLELTKKHAGVTQ 185

Query: 203  FHALDHLHEYDLADLSTFDSSDPNLKDYGIYVSDDTNKLILIEIFNPEFDSPEERDSFTT 262
            FH +D LH YD  D+ TF+  DPNL DY IYVS+DTNKLILIE+F PEF S +E +SF +
Sbjct: 186  FHLVDQLHVYDKQDIPTFNPEDPNLLDYAIYVSNDTNKLILIEVFKPEFQSADEIESFKS 245

Query: 263  AAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKGPLARKSTADPIKTIDSGNIVLN 322
              I +RY   C + ++LN NE P+Q DC  TLFK+FKGPL+RKS+ +P KTIDS N  LN
Sbjct: 246  ENINERYQKACEQFDTLNPNEPPTQLDCLNTLFKVFKGPLSRKSSDEPSKTIDSTNKTLN 305

Query: 323  THLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVDYVGDWKIRKIRESYVRKCLQLI 382
            +H+NPEWLTSKYGF    + D    +   EY PP++V+YV D+++R++RE+Y+R+CLQLI
Sbjct: 306  SHINPEWLTSKYGFNIVVDEDLPNAQQSVEYEPPELVNYVEDFEVRRLRETYIRRCLQLI 365

Query: 383  FWGQXXXXXXXXXXXXKNTKSVKGLSSIQTSFSILPWFQLLGESRARILLNFNEQAHSPL 442
            FWG+            KN+KS K ++++QT+F+I P  QL   S    L+    ++ SPL
Sbjct: 366  FWGKLSINLRINDPTLKNSKSYKSINALQTNFTITPLLQLFKGSGQNFLMG--PESRSPL 423

Query: 443  DAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLYFDALTYIANRKGAYQIIAYCGK 502
            D   HFINLS  ++YTDRD+IRNYE L  LDP+N+G+YFDAL YIAN KG+YQ+IAYCGK
Sbjct: 424  DFNFHFINLSACYHYTDRDVIRNYERLCHLDPQNVGVYFDALNYIANTKGSYQLIAYCGK 483

Query: 503  QDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYKFETSNKNKAASNHLTNLKNALR 562
            QDI+GQEAL+ AL  F +DP + DI ++N++ LL++YK    N+ K +++ + NLKNA+R
Sbjct: 484  QDIVGQEALDQALKSFNLDPMEVDITKINDSVLLTLYK----NELKISTSDIPNLKNAMR 539

Query: 563  LLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDEDIIKTAYSIKINDSPGLKLDCD 622
            L AK   S KLKFY+DHEPYR ++QAY+TL IDESVD+DI++TAY IK+ DSPGL +DCD
Sbjct: 540  LFAKVKHSSKLKFYIDHEPYRRVAQAYETLDIDESVDDDIVQTAYDIKVVDSPGLTMDCD 599

Query: 623  RALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQEALKLLQVNENASDETILKIFK 682
            RALYTIAI KRSL LF FL + CP FQ YY P++  Y +AL + QVNENA+DE I+K F+
Sbjct: 600  RALYTIAIHKRSLLLFTFLIERCPDFQEYYCPDRFTYHDALSMFQVNENAADELIIKNFQ 659

Query: 683  GKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIG 742
             +WF+E+V+EP+ F+I   AL +I ++RNS+LI+NFL TG IDPN LP ++WP GINNIG
Sbjct: 660  ARWFNESVFEPESFVICVHALVEIGLQRNSSLISNFLQTGKIDPNCLPIKDWPAGINNIG 719

Query: 743  NTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISEGEVERSIQ 802
            NTCYLNSLLQYYFSIAPLR+Y+L Y KT+ +F    +N+  VRR+GGRE+S  EVERSIQ
Sbjct: 720  NTCYLNSLLQYYFSIAPLRNYVLQYSKTIEDFKTLENNASTVRRIGGREVSNNEVERSIQ 779

Query: 803  FIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEVEFEVEGNKES--NDATILKEEE 860
            FI+QLR+LF+AMV+S ERCVTP +ELAYLAFAPSN+EVEFE   N+ +   D   +   E
Sbjct: 780  FIYQLRDLFHAMVYSNERCVTPRRELAYLAFAPSNIEVEFETNENQPATQQDNPEVTTAE 839

Query: 861  TGGANAINEQDPILIDFEVDEN-TNGDVEKDENN-HEKTESNDV---------EIIMTDD 909
             G      E+     D  + +N T  D E++E+   E  ++ DV         +IIMTD+
Sbjct: 840  LGQDKDEKERSVDSGDISMSDNITPKDAEEEEDQVAESNKNQDVSAIVSSPTKDIIMTDN 899

Query: 910  ATDLAS----PTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDE-DNE 964
               + S     T+VAKISSDQLENALEMGRQQDVTECIGNVLFQ+ESGSEP+   E DNE
Sbjct: 900  TDTVVSNEGTSTKVAKISSDQLENALEMGRQQDVTECIGNVLFQLESGSEPLDLHENDNE 959

Query: 965  QYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL 1024
            Q DL+KQLFYG  +Q IVPL+  D+ R K+ERFLSLLVNIGDHP+DIYDA D YF+DEYL
Sbjct: 960  QDDLVKQLFYGELEQTIVPLANPDQRRPKLERFLSLLVNIGDHPRDIYDALDLYFKDEYL 1019

Query: 1025 TMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDN 1084
             M EYGDVKRTVAVT FPTILQ+QIQRVYYDRE+FMPFKSIEPLPF+E IYMDRY+ TDN
Sbjct: 1020 KMEEYGDVKRTVAVTKFPTILQIQIQRVYYDREKFMPFKSIEPLPFEEKIYMDRYSVTDN 1079

Query: 1085 LTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNI 1144
              L+A+K ET  +K+K  ++K +QR+LL+R+  GL++KD+++E  KLL S  +E+  + +
Sbjct: 1080 PELIARKNETLLMKEKLVELKKKQRDLLSRNSVGLSKKDSYIELGKLLSSDSLESQGIIL 1139

Query: 1145 EDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEAS 1204
             +K  ++ +LK     ID+EL  LY++I+ LE+ I+ QF++FK  GYS+F+VFIHRGEAS
Sbjct: 1140 PEKDEMVSSLKTLTAGIDDELNQLYAEISQLEETINGQFNEFKGIGYSIFAVFIHRGEAS 1199

Query: 1205 YGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEADIEP 1264
            YGHYWIYIKDR+QNG+WRKYNDET+S            GNTATPYFLVYVK+G+E +IEP
Sbjct: 1200 YGHYWIYIKDRSQNGIWRKYNDETVSEVPEEEVYNFTEGNTATPYFLVYVKEGEEQEIEP 1259

Query: 1265 LKRILE 1270
            LKRI+E
Sbjct: 1260 LKRIIE 1265

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 1398 bits (3619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 707/1262 (56%), Positives = 911/1262 (72%), Gaps = 43/1262 (3%)

Query: 23   EKGHTVDNTTSIDDCPLYEASASQQSTRADVDDGKHLLYPDIATYLPLKTSDRLLDDILC 82
            E  H V NT   D             T    D GK +LY +++T  P KTSDRLLDD++ 
Sbjct: 38   ETDHMVGNTKQAD----------HLDTLTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIH 87

Query: 83   DTAFFNSTDPSVIERGLQTSGILKKSMLSYSNFRSRIRPDALGSLTDQVVLQTKTEYDSI 142
            D AF NS D  ++   L  +GILK  +L+YS   S++ P + G+L DQ+ LQT  EY SI
Sbjct: 88   DLAFINSKDHDILYSDLH-NGILKAPVLAYSRRISQLYPYSFGTLVDQITLQTSFEYPSI 146

Query: 143  SCPQYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQ 202
            SCP +NK+ V   V+ +  +P         + +  +YHLKVTVK R  LE  KK  GVT 
Sbjct: 147  SCPGHNKLNVYMGVLID--VPHDYKITSSTLSENTVYHLKVTVKTRSILEHTKKKAGVTH 204

Query: 203  FHALDH--LHEYDLADLSTFDSSDPNLKDYGIYVSDDTNKLILIEIFNPEFDSPEERDSF 260
            +H +    LH++D  DL  FD +DP L D+ IYVS DTNKL+LIE+F PEFD  E+ + +
Sbjct: 205  YHCISEADLHQFDRQDLE-FDPTDPRLVDHAIYVSSDTNKLVLIEVFLPEFDREEKTECW 263

Query: 261  TTAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKGPLARKSTADPIKTIDSGNIV 320
            +  AI+ RY++ C + ++L+ +E P+Q DC  TL KIF+GPL R+++ +P+KTI+S N+V
Sbjct: 264  SGTAIKTRYSEACQRFDTLDPSEIPTQADCINTLLKIFRGPLNRQNSEEPLKTINSDNVV 323

Query: 321  LNTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVDYVGDWKIRKIRESYVRKCLQ 380
            LN+ +NP WLTSKYGF+   E DE T ES+ E+ PP++ +Y+ D K+R++RES++RKC++
Sbjct: 324  LNSRINPNWLTSKYGFELHVEKDESTGESYFEFEPPNLTNYIEDRKVRRLRESFIRKCIE 383

Query: 381  LIFWGQXXXXXXXXXXXXKNTKSVKGLSSIQTSFSILPWFQLLGESRARILLNFNEQAHS 440
            LIF G+              +K  +  ++IQ +FS   WF++LGE R+     F+ ++ S
Sbjct: 384  LIFLGKTAIELLGKDAKT-TSKVYRTFNAIQIAFSKTTWFKMLGEHRSI----FSFESAS 438

Query: 441  PLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLYFDALTYIANRKGAYQIIAYC 500
            PLDA  +FINLS   YY DRDII+NYEA  +LDPEN G+YFDALTYIANRKGAYQ++AYC
Sbjct: 439  PLDANYNFINLSACFYYIDRDIIKNYEAQCALDPENTGIYFDALTYIANRKGAYQLVAYC 498

Query: 501  GKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYKFET-SNKNKAASNHLTNLKN 559
            GKQD++GQEAL+ AL +F ID KD D+A ++++ L+SIYK ET +N N+   N  T+LKN
Sbjct: 499  GKQDVVGQEALDQALKLFGIDSKDVDVATIDDSLLVSIYKSETMANPNE---NRHTDLKN 555

Query: 560  ALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDEDIIKTAYSIKINDSPGLKL 619
            ALRLLAKY KSDKLKF+ D+EPY+ +S+AY+ L +DESVD+DII+TAYSI INDSPGLK+
Sbjct: 556  ALRLLAKYKKSDKLKFFADYEPYKNVSRAYEILEVDESVDDDIIETAYSISINDSPGLKI 615

Query: 620  DCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQEALKLLQVNENASDETILK 679
            DCDRALYTI + KRSL L N+L  +CP FQ YYGP  L Y EAL +LQ+NENA DET+L+
Sbjct: 616  DCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGTLLYSEALSMLQLNENAGDETVLE 675

Query: 680  IFKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLLTGTIDPNSLPPENWPTGIN 739
            +F+ KW  E  +E D  L LKAALTKI IERNS LI +F+ TGTID + LP +NWPTG+N
Sbjct: 676  VFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLILHFIDTGTIDASCLPADNWPTGLN 735

Query: 740  NIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISEGEVER 799
            NIGNTCYLNSLLQYYFS+APLR Y+L YQ+T+ +F  H  N   +RR+GGRE+SE EVER
Sbjct: 736  NIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRHHTGN--ELRRIGGREVSEAEVER 793

Query: 800  SIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEVEFE---------VEGNKES 850
            S+QF++QLR+LF AM++S+ERCVTP KELAYLAFAPSN EVEFE         V    ES
Sbjct: 794  SVQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFAPSNFEVEFEPTTVNAQHEVSKIAES 853

Query: 851  NDATILKEEETGGANAINEQDPILIDFEVDENTNGDVEKDENNHEKTESNDVEIIMTDDA 910
             +  IL    T  ++  ++  PI +D    ++ N D++      E +E    +I M+D  
Sbjct: 854  TNNDILMYGPTNRSDN-DQTGPIELD---SDSGNEDIDVSMTK-EPSEEYKEDIPMSDAE 908

Query: 911  TD--LASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDL 968
             D  +++ TRVAKISSDQLENALEMGRQQDVTECIGNVLFQ+ES S+PI  DEDNEQ DL
Sbjct: 909  KDNIISTSTRVAKISSDQLENALEMGRQQDVTECIGNVLFQLESASDPINLDEDNEQNDL 968

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMAE 1028
            +KQLFYG  KQ I+PL+ + +++TK+ER+LSLLVNIGDHPKDIYDA DSYF DE LTMAE
Sbjct: 969  VKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGDHPKDIYDALDSYFSDERLTMAE 1028

Query: 1029 YGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLL 1088
            YGDVKRTVAVT FPTILQ+QIQRVYYDRERFMPFKSIEPLPF EV+YMDRY+D+ +  ++
Sbjct: 1029 YGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFNEVLYMDRYSDSQDPKMV 1088

Query: 1089 AKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDKK 1148
             KK+E+EQLK +   +K RQ+ELL+ +  GL+RK A++ETI  L+S ++++  L   +  
Sbjct: 1089 EKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAYMETINYLKSDLIKSQELKGLNND 1148

Query: 1149 NLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHY 1208
             LI+ LK  + DID EL SLY DI  LE+ I  QF++FK+ GYSLF+VFIHRGEASYGHY
Sbjct: 1149 FLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQFEEFKKIGYSLFAVFIHRGEASYGHY 1208

Query: 1209 WIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEADIEPLKRI 1268
            W+YIKDR++NG WRKYNDETI+            GNTATPYFLVYV+QG E DIEPLKRI
Sbjct: 1209 WVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATPYFLVYVRQGHEHDIEPLKRI 1268

Query: 1269 LE 1270
            ++
Sbjct: 1269 ID 1270

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 1358 bits (3514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1243 (55%), Positives = 879/1243 (70%), Gaps = 41/1243 (3%)

Query: 49   TRADVDDGKHLLYPDIATY-LPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKK 107
            T  D+D G  LLYPD+ T   P+KTS+R++DDILCD +F N  + S        +GIL++
Sbjct: 71   TTQDIDPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLSF------KNGILQE 124

Query: 108  SMLSYSNFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQI 167
            SM+ YS  R   +    GS+ DQV LQTK EY+S++CP  NK++V   ++ N  LP   I
Sbjct: 125  SMIMYSKERINNQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMN--LP-SNI 181

Query: 168  AAFDDIV-KIPIYHLKVTVKIRQELERLKKHVGVTQFHALDH--LHEYDLADLSTFDSSD 224
               D+I+ K+PIYHLK+TVK RQ LE  KK  G+TQ+H LD   LH +D  DL TFD  +
Sbjct: 182  TNVDEIISKVPIYHLKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDN 241

Query: 225  PNLKDYGIYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENET 284
            P+L DY IYVS DTN+LILIEIF+ EFDS EER+SF TA I+ RY + C K ++L+    
Sbjct: 242  PDLLDYAIYVSSDTNRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAV 301

Query: 285  PSQPDCFYTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDE 344
            P+  DC  T+ K+ K PL RK+  D I+T+ S N +L++H NPEWL  KY F      DE
Sbjct: 302  PTGIDCLNTVLKLLKQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDE 361

Query: 345  ETNESFTEYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXX--XXKNTK 402
             T +   EY PPD++ YV  +K+R +RE Y+R+CLQLIFWG+              + +K
Sbjct: 362  TTGQEVLEYEPPDLISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSK 421

Query: 403  SVKGLSSIQTSFSILPWFQLLGESRARILLNF-NEQAHSPLDAEPHFINLSVSHYYTDRD 461
            S +  + + T+ S  P +QLL +S++  L +  N+     LD   HFINLS S YYTDRD
Sbjct: 422  SYRAFNLLNTTTSTNPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRD 481

Query: 462  IIRNYEALSSLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKID 521
            II+NYE L +LDP NIG YFDAL+YIANRKG+YQ+IAYCGKQD++GQE +  AL  F ID
Sbjct: 482  IIKNYERLIALDPPNIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNID 541

Query: 522  PKDYDIAELNEATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEP 581
            P   ++  ++++ LLSIYK    N++        NLKNA+RL AK   S +LKFYVDHEP
Sbjct: 542  PNVVNLESIDDSLLLSIYK----NESVKEGADFVNLKNAMRLFAKIRNSPQLKFYVDHEP 597

Query: 582  YRALSQAYDTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFL 641
            YR ++QAY+TL ID SVD+DII+TAYSIK  D+PGLK+DCDRALYTIAI +RS+ LFNFL
Sbjct: 598  YRNVNQAYETLEIDSSVDDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFL 657

Query: 642  TDECPQFQNYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKA 701
             + C +FQ YY   + DY++AL +LQVNENA+DE ILK F+ KWF+E ++E DQFL  K 
Sbjct: 658  LENCSEFQAYYNIGRYDYRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKC 717

Query: 702  ALTKISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLR 761
            AL K+ +ERNS LI NFL+ G IDP+ LP ENWPTGINNIGNTCYLNSLLQYYFSI+PLR
Sbjct: 718  ALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLR 777

Query: 762  SYILNYQKTLNNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERC 821
             Y+L Y KT  +F D   N++ +RR+GGRE+ + EVERSIQFI+QLR+LFYAM+++ +RC
Sbjct: 778  EYVLGYSKTYEDFYDAKRNAKTIRRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRC 837

Query: 822  VTPSKELAYLAFAPSNVEVEFE--VEGNKE-----SNDAT------ILKEEETGGANAIN 868
            VTP +ELAYLAFAPSNVEVEFE  V   KE     ++D T      I + +E  G     
Sbjct: 838  VTPRRELAYLAFAPSNVEVEFENGVTDAKEDVSHYNDDKTSDTLIKIGEGDEDLGEAERT 897

Query: 869  EQDPILIDFEVDENTNGDVEKDENNHEKTESNDVEIIMTDDATDLASPTRVAKISSDQLE 928
            E  P    +  D++  G  +  +  +++ ES       T++  D+   T+VAKISSDQLE
Sbjct: 898  EASPTEDIYMTDDDMLGAAKATDGINKEDES-------TENGIDILPSTKVAKISSDQLE 950

Query: 929  NALEMGRQQDVTECIGNVLFQIESGSEPIRYD-EDNEQYDLIKQLFYGTTKQCIVPLSAT 987
            NALEMGRQQDVTECIGNVL+Q+ESGSEP++ + EDNEQ DL+KQLFYG  KQ I+PLS  
Sbjct: 951  NALEMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGV 1010

Query: 988  DKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQV 1047
             + R K+ERFLSLLVN+GDHP+DIYDA D YF+DE+LTM EYG+VKRTVA+T FPTILQV
Sbjct: 1011 GETRPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEYGEVKRTVAITKFPTILQV 1070

Query: 1048 QIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNR 1107
            QIQRVYYDRERFMPFKSIEPLPF   IYMDRY DT +  +L  +E T ++K +   +K R
Sbjct: 1071 QIQRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKR 1130

Query: 1108 QRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELMS 1167
            Q+ELL+R+  GL+RK+A+ ET+  L+S+ ++   +  E +  L   LK   TDID+EL +
Sbjct: 1131 QQELLSRNEVGLSRKEAYSETVNFLQSNALQLQGIVFEGQDELSTILKKAGTDIDDELST 1190

Query: 1168 LYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDE 1227
            +Y+ I  LE+ ISHQF+ FK+ GYSLF+VFIHRGEASYGHYW+YIKD NQNG+WRKYNDE
Sbjct: 1191 IYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDE 1250

Query: 1228 TISXXXXXXXXXXXXGNTATPYFLVYVKQGQEADIEPLKRILE 1270
            T+S            GNTATPYFLVYVK+G E DIEPLKRI+E
Sbjct: 1251 TVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRIIE 1293

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 1335 bits (3456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/1237 (53%), Positives = 884/1237 (71%), Gaps = 43/1237 (3%)

Query: 54   DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAF--FNSTDPSVIERGLQTSGILKKSMLS 111
            DDGK LLYPD     P KTS+RLLD+I+C   +   +  D S  E    ++G+LKK +LS
Sbjct: 52   DDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEF---SNGLLKKQLLS 108

Query: 112  YSNFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFD 171
            YS  R  ++P ++G++ DQ++LQTK EY S +CP++N I V   V+ + +   Q ++ FD
Sbjct: 109  YSKSRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTN--HQPLSTFD 166

Query: 172  DIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYG 231
            D+  + IYHLK+TVK+R  LER K+HVGV ++H LD LH +D  DL  FD  DP L D+ 
Sbjct: 167  DVADLKIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHA 226

Query: 232  IYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCF 291
            IYVSDDTNKL+L+EIF PEFDS EER+S T  AI++R+     K ++L+++E P+Q DC 
Sbjct: 227  IYVSDDTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCI 286

Query: 292  YTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFT 351
             T+FKIFKGPL RKS  +P+KT+ S N+VLN+ +NP+WL +KYGFQ   E +EET E   
Sbjct: 287  NTMFKIFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFQELIETEEETEEQLI 346

Query: 352  EYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSSIQ 411
            +Y+PP++VD+  D  +RK RE+  RKCL+LI+ G+              +KS++  + +Q
Sbjct: 347  DYLPPNLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQ 406

Query: 412  TSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSS 471
            TSFS L W Q+L E++    +  N Q    ++ + H I+LS S++YTDRDII+NYE    
Sbjct: 407  TSFSTLFWSQILDENKNIATMKENPQ----MNLDYHLIDLSASYHYTDRDIIQNYELQCK 462

Query: 472  LDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELN 531
            LDP NIG+YFD+L +IAN +G+Y +I YC KQDI+GQEALE AL  F +DP   D+++ N
Sbjct: 463  LDPANIGIYFDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTN 522

Query: 532  EATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591
            +A  ++IYK E        +  LTNL+NALR+LAK+  S +LKFYVD+EPY ++ +A++ 
Sbjct: 523  DAIFMTIYKNEVKLHGNDPT-RLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNI 581

Query: 592  LAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNY 651
            L +DESVD+DII+TAYSIK+ND+PGLK+DCDRALYT+A+SKRS+ L NFL  ECP FQ++
Sbjct: 582  LEVDESVDDDIIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDF 641

Query: 652  YGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERN 711
            YGP++  Y EAL+ LQVNENA+D+TIL+IF+ +W  ++V + D+ L LK+ LTKI+ ERN
Sbjct: 642  YGPDQYTYSEALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERN 701

Query: 712  SNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTL 771
            S LI+++L TG ++P  LP +NWP G+NNIGNTCYLNSLLQYYF I+PLR+Y+ +YQKTL
Sbjct: 702  SKLISSYLETGVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTL 761

Query: 772  NNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYL 831
                + L +    RR+GGREI++ EVERS+QF++QLR+LF  M+HS  RCVTP+KELAYL
Sbjct: 762  EAVENCLEDGWDKRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYL 821

Query: 832  AFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTNGDVEKDE 891
            AFAPSNVEVEF+     +S +      E+  G       D + ID ++ E     +  DE
Sbjct: 822  AFAPSNVEVEFDQPNELQSGNG-----EDVDG-------DIVFIDEDISEPKGKSLVLDE 869

Query: 892  NNHEKTESNDVEIIMTDDATDLA-------------------SPTRVAKISSDQLENALE 932
             N +   S + ++I  DD++D +                   + TRVAKIS DQLENALE
Sbjct: 870  ENSKVENSPENQLIEIDDSSDSSGHKKVEEISQNPCFGKSTDTSTRVAKISFDQLENALE 929

Query: 933  MGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRT 992
            +GRQQDVTECIGNVLFQ+ES S PI  +ED+EQYDLIK+LFYG TKQ I+PL   +++R 
Sbjct: 930  LGRQQDVTECIGNVLFQLESASNPISLEEDDEQYDLIKKLFYGKTKQSIIPLKNNNEIRN 989

Query: 993  KVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRV 1052
            K+ERF+SLLVN+ DHPKD+YDA D YF DEYLTM EYG+VK+++AVT FPTILQ+QIQRV
Sbjct: 990  KIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDEYGEVKKSLAVTEFPTILQIQIQRV 1049

Query: 1053 YYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELL 1112
            YYDRERFMPFKSIEPLPF E IYMDRY +T +  LL KK+ET +LK++  +M+ RQ+ELL
Sbjct: 1050 YYDRERFMPFKSIEPLPFSETIYMDRYTETTDADLLKKKDETFELKKQLSEMRKRQKELL 1109

Query: 1113 NRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDI 1172
            +R+  GL+RK+AF+ET K L S  +E   +  E+K+ LI  L   + DID+EL  LY+DI
Sbjct: 1110 SRNELGLSRKEAFMETRKFLSSDALEKQGIETENKQMLIDRLTGALKDIDDELTKLYNDI 1169

Query: 1173 NSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXX 1232
             ++E KI  QFD F+  GYSLF+VFIHRGEASYGHYW+YIKD  +NG+WRKYNDETI+  
Sbjct: 1170 VNIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEV 1229

Query: 1233 XXXXXXXXXXGNTATPYFLVYVKQGQEADIEPLKRIL 1269
                      GNTATPYFLVYVKQ    +IEPLKRI+
Sbjct: 1230 PEAEVFNFTEGNTATPYFLVYVKQENLNEIEPLKRIV 1266

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 1323 bits (3423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/1225 (55%), Positives = 868/1225 (70%), Gaps = 45/1225 (3%)

Query: 54   DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYS 113
            DDGK LLYP +   LP KT DRL+DDI+ D AF N +D S      +  GILK S L+YS
Sbjct: 36   DDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSDLSS-----EFKGILKSSPLTYS 90

Query: 114  NFRSRIRPD-ALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDD 172
              R  +RP   LG+  DQ+ LQTK EY+SISCP +N+I V   V+ + ++  +   +FD 
Sbjct: 91   KRRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNM--ENPTSFDA 148

Query: 173  IVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGI 232
            + + PIYHLKVTVK R +LE LKKHVG++ +H +  LH +D  DL TFD SD NL D+  
Sbjct: 149  VAETPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQDLLTFDESDENLIDFAA 208

Query: 233  YVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFY 292
            YVS DTNKLILIEIF PEF S EE +SF T  I  RY  VC + +SLN +  PSQ DCF 
Sbjct: 209  YVSSDTNKLILIEIFKPEFSSEEEIESFKTEHITSRYQLVCEQYDSLNSDTIPSQVDCFR 268

Query: 293  TLFKIFKGPLARKST-ADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFT 351
            TLF++FKGPL RKS   DPIKTI++ N  LN+H++ +WL SKYGFQ +S  + E N+   
Sbjct: 269  TLFRVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGL 328

Query: 352  EYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSSIQ 411
            EY PPD++D+  DWKIRK+R+SY RKCLQL FWG+            K  KS +  + + 
Sbjct: 329  EYEPPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFFNKMH 388

Query: 412  TSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSS 471
            T  S    FQ+  +S  R  L  ++ + SPLD   HFINLS S+YYTDRDII+NYE L +
Sbjct: 389  THTSTTALFQIFNDSARR--LQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCN 446

Query: 472  LDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELN 531
            +D  N G+YFDALTYIAN KG+YQ+I+YCGKQD++GQE L+N+L V  +D    DI  LN
Sbjct: 447  IDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKSLN 506

Query: 532  EATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDT 591
            ++ L SIYK E  N ++     LT LK+A+R++ K  +S KL+F++DHEPY  +  AY+ 
Sbjct: 507  DSLLFSIYKQE-QNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNL 565

Query: 592  LAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNY 651
            L IDESVD+DI++TAY+I+INDSPGLK+DCD+ALYTIAI  RS+ LFNFL ++CP F  Y
Sbjct: 566  LDIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITY 625

Query: 652  YGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERN 711
            YGP+ L +Q+AL LLQVNENA+DE ++KIF+ +W  + + E DQ LILKAALTKI+ E+N
Sbjct: 626  YGPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQLLILKAALTKIASEKN 685

Query: 712  SNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTL 771
            S LI+ FL TG ID N L PENWP G+NNIGNTCYLNSLLQYYFSIAPLR YILNY+ ++
Sbjct: 686  SKLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSI 745

Query: 772  NNFN-DHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAY 830
            +N+  D  SN    RR+GGRE+SE EVERSIQF++QLR+LF  M++S+ RC+TP  ELAY
Sbjct: 746  SNYEIDETSNK---RRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAY 802

Query: 831  LAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTNGDVEKD 890
            LAFAPSN+EVEF                       A +E +   +D   D+  + D+   
Sbjct: 803  LAFAPSNIEVEF-----------------------AASEVERTTVDLPFDKEGDIDLVDL 839

Query: 891  ENNHEKTESNDVEI-----IMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGN 945
             N++  T +N  E+     + T+D     + T+ AKISSDQLENALEMGRQQDVTECIGN
Sbjct: 840  SNDNLNTTNNAQEVTSDISVATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTECIGN 899

Query: 946  VLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIG 1005
            VL+Q+ES S+PI+ DED EQYDLIK+LFYG TKQ IVPLS   K RTK E F SLLVNI 
Sbjct: 900  VLYQMESASKPIKLDEDFEQYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNIS 959

Query: 1006 DHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSI 1065
            DHP+DIYDA +S F  E+L M EYGDV+RTV++T FP ILQ+QIQRVYYDRERFMPFKSI
Sbjct: 960  DHPRDIYDALESSFASEFLKMDEYGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSI 1019

Query: 1066 EPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAF 1125
            EPLPF   IYMDRYA  DN  L  KK ET++L+ K K +K RQ ELLNR+  GL+RK+++
Sbjct: 1020 EPLPFSNTIYMDRYAALDNELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESY 1079

Query: 1126 LETIKLL-ESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFD 1184
            LETI  L + + V +  L++ ++  +I+ L+  +++ID+EL  +Y +IN +E+KI HQFD
Sbjct: 1080 LETINFLSDEATVTSQGLSVLNRGQIIEKLRKAISNIDSELSQIYDEINLIENKIDHQFD 1139

Query: 1185 DFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGN 1244
            +F++ GYSLF+VFIHRGEASYGHYW+YIKD  ++G+WRKYNDET++            GN
Sbjct: 1140 EFRDIGYSLFAVFIHRGEASYGHYWVYIKDPERSGIWRKYNDETVTEVNEEEVFNFTEGN 1199

Query: 1245 TATPYFLVYVKQGQEADIEPLKRIL 1269
            TATPYFLV+VK   + DIEPLKRI+
Sbjct: 1200 TATPYFLVFVKDYYKGDIEPLKRII 1224

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 1320 bits (3417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/1230 (54%), Positives = 879/1230 (71%), Gaps = 36/1230 (2%)

Query: 54   DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYS 113
            DDGKHLLY D+    P+KTSDRL+DDILCD +    +   + E   Q+ GILK   + YS
Sbjct: 52   DDGKHLLYTDLKNGSPMKTSDRLIDDILCDLSLNGQSQCLLSE---QSQGILKLLPIIYS 108

Query: 114  NFRSRIR-PDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDD 172
              R +++    LGSL DQV+ QTK EY S+SCPQ+NK+QV   V+ N S       + DD
Sbjct: 109  KQRQQLQNVSILGSLLDQVLFQTKFEYSSVSCPQHNKLQVFLGVLLNVS---SSFESTDD 165

Query: 173  IVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGI 232
            +V+ P++HLKVTVK R +LE  KKH GV+QF ++D LH YD  DL TFD  D  L DY I
Sbjct: 166  VVRSPLFHLKVTVKTRSQLELYKKHAGVSQFFSVDSLHSYDKEDLGTFDPEDTRLIDYAI 225

Query: 233  YVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFY 292
            YVS DTNKL+LIEIF+PEF++ EE +SFT   I+KRY D C + +SLN  + P+Q DC  
Sbjct: 226  YVSSDTNKLVLIEIFHPEFNTSEEIESFTVDGIRKRYVDTCSRLDSLNPEDIPNQFDCLN 285

Query: 293  TLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTE 352
            TL+K FK P+ +   + P++TI + N +LN+H+N  WLT +YGF   + +  E  +   E
Sbjct: 286  TLYKTFKNPINKTDPSAPLQTIKASNPILNSHMNANWLTERYGF---TLLPGENEDDEDE 342

Query: 353  YVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXK---NTKSVKGLSS 409
            Y PP+   Y+ D K+RK++E Y+RKCLQLIFW +            K   ++KS K LS 
Sbjct: 343  YEPPNFTTYIMDPKVRKMKECYIRKCLQLIFWAKLMIEVVDNTQRSKLAASSKSFKSLSG 402

Query: 410  IQTSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEAL 469
            I    +  P +QL GES+    LN N+Q +   D   HFI LS S++Y DRDII NYE  
Sbjct: 403  IAVQNTSKPLYQLFGESK-NAFLNSNDQNYM-WDTNYHFIALSASYHYNDRDIIMNYETY 460

Query: 470  SSLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAE 529
            S +D  NIG+YFDA+ +IANRKG+YQ++AYCGKQ+I+G EALE A+  FK+DP   DI +
Sbjct: 461  SVIDKGNIGIYFDAIQFIANRKGSYQLLAYCGKQNIVGHEALEAAMRAFKLDPAAIDINK 520

Query: 530  LNEATLLSIYKFE-TSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQA 588
            L+ + LLS+YK E  SN+N   ++HL++LKNALR+LAK+  +  +KFYVDHEPY+ +SQA
Sbjct: 521  LDISLLLSMYKHEQISNQN---TSHLSDLKNALRVLAKFKDNRFVKFYVDHEPYKTVSQA 577

Query: 589  YDTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQF 648
            Y+ L +DESVD+DII+TAYSIK+NDSPGLK++C RALYTIAI+KRS+ LFN+L +ECP+F
Sbjct: 578  YNELEVDESVDDDIIQTAYSIKVNDSPGLKIECIRALYTIAINKRSMALFNYLIEECPEF 637

Query: 649  QNYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISI 708
            Q++YGPEK  Y++AL ++QVNENASDE IL+IF+ KW DE + E DQFL LKAAL K+ I
Sbjct: 638  QDFYGPEKYSYEQALAIIQVNENASDEMILQIFQKKWNDEPLVEYDQFLSLKAALLKLCI 697

Query: 709  ERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQ 768
            E+NS LI++FL TG IDP+ LP ENWP G+NNIGNTCYLNSLLQYYF+IAPLR+YI +YQ
Sbjct: 698  EKNSKLISHFLTTGLIDPSCLPVENWPIGLNNIGNTCYLNSLLQYYFAIAPLRNYICSYQ 757

Query: 769  KTLNNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKEL 828
             T  +F    ++++  RR+GGR++   EVERSIQF +QLR+LF  M+ S  RCV+P++EL
Sbjct: 758  STTESFEATDTDAKINRRIGGRQVCASEVERSIQFTYQLRDLFNGMIFSNSRCVSPTQEL 817

Query: 829  AYLAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAIN--EQDPILIDFEVDENTN-- 884
            AYLAF+PSN+EVEF+      S         E+GG  ++N  + D  L D  ++E+    
Sbjct: 818  AYLAFSPSNIEVEFDAGSGIAS---------ESGGTFSLNGKDTDAPLTDMPLNEDVTMT 868

Query: 885  --GDVEKDENNHEKTESNDVEIIMTDDATDLA-SPTRVAKISSDQLENALEMGRQQDVTE 941
              G+ + D+         DV +     A ++  S T+VAKI SDQLENALE+GRQQDVTE
Sbjct: 869  EAGEPQLDDTGLLAPVEADVPVDQMKLAKEVINSSTKVAKIGSDQLENALELGRQQDVTE 928

Query: 942  CIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLL 1001
            CIGNVL+Q+ES S+PI+ DEDNEQYDLIK LFYG T+Q IVPLS +  VR+K ERFLSLL
Sbjct: 929  CIGNVLYQLESASDPIKLDEDNEQYDLIKHLFYGKTRQDIVPLSNSTDVRSKYERFLSLL 988

Query: 1002 VNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMP 1061
            VN+ DHPKDIYDA DSYF +EYLT+ EYGDV+RTVA+T FPTILQ+QIQRVYYDRERFMP
Sbjct: 989  VNVSDHPKDIYDALDSYFMEEYLTLEEYGDVRRTVAITEFPTILQIQIQRVYYDRERFMP 1048

Query: 1062 FKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTR 1121
            FKSIEP+PF   +YMDRYA TD+  +L K+ ET +LK + ++ K RQ+ELL+R+  GL+R
Sbjct: 1049 FKSIEPIPFNSTLYMDRYAATDDPVMLTKRRETSELKTRLRECKVRQQELLSRNDMGLSR 1108

Query: 1122 KDAFLETIKLLESSIVENT-VLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKIS 1180
            K+A+ ET+K+L+S  +E    +  ED+  ++  L + V  ID EL+ LY++I  LE +I 
Sbjct: 1109 KEAYTETMKMLQSDFLEQVPSVRGEDQTAVVSGLSDMVASIDEELVQLYTEIGQLETQID 1168

Query: 1181 HQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXX 1240
            HQFD F++ GYSLF+VFIHRGEASYGHYW+Y+KD   +G+WRKYNDET+S          
Sbjct: 1169 HQFDSFQKVGYSLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKYNDETVSEVPEEEVFNF 1228

Query: 1241 XXGNTATPYFLVYVKQGQEADIEPLKRILE 1270
              GN ATPYFLV VKQ  E DIEPL RI++
Sbjct: 1229 TEGNNATPYFLVLVKQTHEQDIEPLHRIID 1258

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 1311 bits (3393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1233 (54%), Positives = 867/1233 (70%), Gaps = 44/1233 (3%)

Query: 53   VDDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSY 112
            +DDGK LLYP +    P KTSDRLLDDI  D  F NS +  ++   L  +G+L+  ML Y
Sbjct: 33   IDDGKTLLYPGVHLNFPFKTSDRLLDDIRSDMFFLNSEEHDILYSQLH-NGVLRLPMLEY 91

Query: 113  SNFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSL-PEQQIAAFD 171
            S  +   +P ++G L DQV L+TK EY+S +CP+ NKI V   V+ +  + PE    + D
Sbjct: 92   SR-KKTTQPCSVGYLLDQVTLKTKYEYESKTCPELNKINVFMGVLVDQHIRPE----SLD 146

Query: 172  DIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYG 231
            D++ +PIYHLK+TVK R  LER+KKHVGVT +H +D LH +D  D+     S+  L D  
Sbjct: 147  DVINVPIYHLKITVKTRLHLERVKKHVGVTHYHLIDQLHSFDKQDIFMTTESE-QLVDSA 205

Query: 232  IYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCF 291
             YVS DTN+L+ IEIF PEF + E+   F+   +++RY   C K + L+    P+Q +C 
Sbjct: 206  TYVSSDTNRLLRIEIFKPEF-TKEDLAIFSQEKVKERYASACEKFQDLDPTSVPTQVECL 264

Query: 292  YTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFT 351
             TLFKIFKGPL R+S+ D +KTI + N  LN+ ++P WLT KY F+     DEET E   
Sbjct: 265  NTLFKIFKGPLNRRSSEDILKTISADNKFLNSQIDPSWLTEKYDFKLVETTDEETGELIR 324

Query: 352  EYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSSIQ 411
            E+ PPD+ DYV DW +R  RESY RKCL+LIF G+            K++KS +  +  Q
Sbjct: 325  EFEPPDLTDYVQDWSVRSKRESYTRKCLELIFLGKTSAQLLPKDILSKDSKS-RSFNLYQ 383

Query: 412  TSFSILPWFQLLGESRARILLNFNEQ-AHSPLDAEPHFINLSVSHYYTDRDIIRNYEALS 470
            T+FS   WF LLG+ R     NF +     P D + HFINLS S YY+D+DII+NYE   
Sbjct: 384  TNFSTSFWFHLLGDGR-----NFQDHNLQQPFDNDYHFINLSASSYYSDKDIIKNYETQI 438

Query: 471  SLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAEL 530
            SLDPEN+G+YFDAL YIAN KG YQ+IAYCGKQ+I+G+EAL+ AL VF ID KD D+  +
Sbjct: 439  SLDPENVGIYFDALNYIANTKGGYQLIAYCGKQNIVGKEALDGALTVFGIDSKDTDVKSI 498

Query: 531  NEATLLSIYKFETSNKNKAAS-NHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAY 589
             +  LLSIYK    N+ KAAS    T+LKNALRLLAK+ +S KLKF+VD+EPY + S+AY
Sbjct: 499  TDELLLSIYK----NELKAASVQKRTDLKNALRLLAKFKESKKLKFHVDYEPYTSTSKAY 554

Query: 590  DTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQ 649
              L I ESVD DII+TAY+I++ D+PGLK+DCDRALYT+A++KRSL LFNFLT ECP FQ
Sbjct: 555  QLLEIGESVDLDIIQTAYTIRVADAPGLKIDCDRALYTLAVAKRSLVLFNFLTQECPIFQ 614

Query: 650  NYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIE 709
             +Y  +   Y+EAL LLQVNENA+D+ IL+IF+ KW  E +  PDQFLILK ALTK+ IE
Sbjct: 615  EFYNIDNWSYKEALSLLQVNENATDDVILEIFQRKWSQEPMTSPDQFLILKTALTKLGIE 674

Query: 710  RNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQK 769
            RNS LI NF+ TG +D + LP  NWPTG+NNIGNTCYLNSLLQYYFSI+PLR Y+LNYQK
Sbjct: 675  RNSKLINNFIDTGIVDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYVLNYQK 734

Query: 770  TLNNFND---HLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSK 826
             LN F D           RR+G RE+S+ EVERS+QF++QLR+LF  MVH++ER VTP+K
Sbjct: 735  MLNCFRDIEDATGGEISKRRIGSREVSKPEVERSVQFVYQLRDLFRDMVHTKERFVTPTK 794

Query: 827  ELAYLAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTNGD 886
            ELAYLAFAPSN+EVEFE          T+  E+     N ++     +ID   D   + +
Sbjct: 795  ELAYLAFAPSNIEVEFEA-----PTITTVAPEDLDERTNKLD-----IIDLAAD-GIDNE 843

Query: 887  VEK-------DENNHEKTESNDVEIIM--TDDATDLASPTRVAKISSDQLENALEMGRQQ 937
             EK       D +N +K E    +IIM  T +   + +  RVAKISSDQLEN LE+GRQQ
Sbjct: 844  TEKGSKSSLLDVHNQQKPEEQTEDIIMGGTQEEEAVNASMRVAKISSDQLENTLELGRQQ 903

Query: 938  DVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERF 997
            DVTECIGNVLFQ+ES S+P   +EDNEQ+DLIK+LFYG  KQ ++P+    K+RTK+ERF
Sbjct: 904  DVTECIGNVLFQLESASDPWSLEEDNEQHDLIKELFYGKIKQHLIPVKNPSKIRTKIERF 963

Query: 998  LSLLVNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRE 1057
            +SLLVNIGDHPKDIYDA D YF+D+ L + E G+VKRTVAVT  P ILQ+QIQRVYYDRE
Sbjct: 964  VSLLVNIGDHPKDIYDALDLYFKDDLLQLDEDGEVKRTVAVTNLPKILQIQIQRVYYDRE 1023

Query: 1058 RFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGS 1117
            RFMPFKSIEPLPF E IYMDRY DTD+  +LAK+++T++LK++ + +K+RQ +LL+++ +
Sbjct: 1024 RFMPFKSIEPLPFSETIYMDRYMDTDDPVMLAKRDDTKKLKEELRALKDRQHQLLSKNDT 1083

Query: 1118 GLTRKDAFLETIKLLESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLED 1177
            GL+ K + L+T K L+S +++   + +E+K  L+  + + +T ID EL SLY  I +LE 
Sbjct: 1084 GLSFKGSLLQTKKFLQSEVLDKHEIAVENKGALVCHIDSMITKIDGELSSLYQKITALEV 1143

Query: 1178 KISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXX 1237
            +I++QF++F + GYSLF+ FIHRGEASYGHYWIYIKDR +NG+WRKYNDE+++       
Sbjct: 1144 QIANQFNEFTKIGYSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESVTEVPQSEV 1203

Query: 1238 XXXXXGNTATPYFLVYVKQGQEADIEPLKRILE 1270
                 GNTATPYFLVY+K+G E +IEPLKR+++
Sbjct: 1204 FNFTEGNTATPYFLVYIKEGHEDEIEPLKRVIK 1236

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 1251 bits (3237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/1273 (49%), Positives = 873/1273 (68%), Gaps = 70/1273 (5%)

Query: 52   DVDDGKHLLYPDIATYLPLKTSDRLLDDILCDTAF--FNSTDPSVI-------------- 95
            +VDDGKH+LY   + +   KT+DRLLDD++ D ++  FN++   +               
Sbjct: 60   EVDDGKHILYDSFSNHSFFKTADRLLDDLMIDLSYMLFNNSSEHINDNNNNNDNNHNNNN 119

Query: 96   ----------ERGLQTSGILKKSMLSYSNFRSRIRPDALGSLTDQVVLQTKTEYDSISCP 145
                      E     +GIL+     YS  R      A+G++ DQ+ LQT+ E+ S++CP
Sbjct: 120  NTSNSNNDTNEIKTYINGILRLPSHQYSKDRYSKFTFAMGTIVDQINLQTRFEFKSVTCP 179

Query: 146  QYNKIQVLQAVIFNPSLPEQQIAAFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHA 205
            ++N + VL  V+ + +  +  +  F     +P+YH K+TVK R  LE+ KKHVG++ FH 
Sbjct: 180  EFNDVHVLLGVLMD-NRSQAPLGTF-----LPVYHFKITVKTRSYLEKTKKHVGISHFHL 233

Query: 206  LDH--LHEYDLADL--STFDSSDPNLKDYGIYVSDDTNKLILIEIFNPEFDSPEERDSFT 261
            +D   LHE+D  DL  +  D +  +L D  I++S+DTNKL+++EIF PEF+  EE +SF+
Sbjct: 234  IDFDDLHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEIFKPEFNELEEIESFS 293

Query: 262  TAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKGPLARKSTADPIKTIDSGNIVL 321
              +I +RY + C +  +L++ + P+Q +C  T+FKIFKGPL  K+  +P+K I++ N +L
Sbjct: 294  QESIAERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKNINEPLKAINADNPLL 353

Query: 322  NTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVDYVGDWKIRKIRESYVRKCLQL 381
            N+H NP WL +KYGF  + + + +T E F EY+PP++ DY+ D   R +RESY+RKCL+L
Sbjct: 354  NSHWNPNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDINTRALRESYIRKCLEL 413

Query: 382  IFWGQXXXXXXXXXXXXKNTKSVKGLSSIQTSFSILPWFQLLGESRARILLNFNEQAHSP 441
            IF  +             N+K+++  + +QT F+   W Q L E + ++        ++ 
Sbjct: 414  IFISKRNISLMGPNDLQYNSKAIRSFNILQTVFTTSFWHQFLYEHKPQL------DTYNK 467

Query: 442  LDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLYFDALTYIANRKGAYQIIAYCG 501
            LD E H+INL  S YYT+RDIIRNY  L++LDP NIG+Y+DAL YIA  K +YQ+I++  
Sbjct: 468  LDYEYHYINLLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYIAQSKNSYQLISFVS 527

Query: 502  KQDIIGQEALENALMVFKIDPKDYD-IAELNEATLLSIYKFETSNKNKAASNHLTNLKNA 560
            KQD+IGQEAL  AL +F ID  D   I+ L E+ + +IYK E    N  +S  L  +KNA
Sbjct: 528  KQDVIGQEALNQALTLFNIDNNDSSAISTLTESMIFTIYKTERKQAN-ISSARLAEMKNA 586

Query: 561  LRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDEDIIKTAYSIKINDSPGLKLD 620
            LRLLAKY  SD+LKFY D+EPY + SQ Y+TL +DESVD+DII+TAY+IK+ND+PGLK+D
Sbjct: 587  LRLLAKYKHSDRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAYTIKVNDAPGLKID 646

Query: 621  CDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQEALKLLQVNENASDETILKI 680
            CDRAL T+A  ++SL LF FL  ECPQF  +YG ++ DY +AL  LQVNENA+DETIL+I
Sbjct: 647  CDRALLTVATRRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQVNENATDETILEI 706

Query: 681  FKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLLTGTIDPNSLPPENWPTGINN 740
            F+ +W ++   + D  L L++AL+KI+ E+NS LI+NF+ TG +DP  LP ENWP G+NN
Sbjct: 707  FQQRWSNDKSLDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPTCLPVENWPAGLNN 766

Query: 741  IGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHL---SNSEHVRRVGGREISEGEV 797
            IGNTCYLNSLLQYYFSI PLR +IL YQ T+ +F + +      E  RR+GGRE++E EV
Sbjct: 767  IGNTCYLNSLLQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEKRRRIGGREVNELEV 826

Query: 798  ERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEVEFEVEGNKE-------S 850
            ERS+QFI+Q+R+LF  M+ S+ RCV+P +ELAYLAF PSN+EVEFE    ++       +
Sbjct: 827  ERSVQFIYQVRDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFESASTEDDMGDKSNA 886

Query: 851  NDATILKEEETGGANAINEQDPILIDFEV--------DENTNGDVE----KDENNHEKTE 898
             DA +L++E     + IN  +  LID E         D+ T   +E     D  + E ++
Sbjct: 887  QDAVVLQDEAKNDTD-INLTEVNLIDLEPATKVSTSNDQPTMDAIEILTNSDNKSKELSK 945

Query: 899  SNDVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIR 958
            +N    +  ++  D+   TRVAKISSDQLENA EMGRQQDVTECIGNVLFQ+E+G +PI 
Sbjct: 946  TNPFREVSPNE--DITISTRVAKISSDQLENAFEMGRQQDVTECIGNVLFQLETGFDPIS 1003

Query: 959  YD-EDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDS 1017
             D EDNEQYDL+K+LFYG TKQ I+PL+     R KVERFLSLLVNI DHPKDIYDA + 
Sbjct: 1004 LDNEDNEQYDLVKELFYGKTKQSIIPLNHNSNERIKVERFLSLLVNITDHPKDIYDALNQ 1063

Query: 1018 YFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD 1077
            YF DE+LTM EYGDVK+T+++T +P ILQ+QIQRVYYDRERFMPFKSIEPLPF++VIYMD
Sbjct: 1064 YFADEFLTMEEYGDVKKTLSMTEYPKILQIQIQRVYYDRERFMPFKSIEPLPFEQVIYMD 1123

Query: 1078 RYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIV 1137
            RYA++ +  L++KKEET QLK K K+ + RQ+ELL+++  GL+RK+A +ETIK L+S ++
Sbjct: 1124 RYAESSDPELISKKEETAQLKLKLKEYRARQKELLSKNELGLSRKEAMMETIKFLKSPVI 1183

Query: 1138 ENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVF 1197
                ++  +K  L++ L+  V  I+NEL +LY+ IN L+++I HQFDDFK+  YSLF+VF
Sbjct: 1184 LENGIDTTNKDVLVRELQQYVDGINNELSNLYNKINQLQNRIDHQFDDFKKLAYSLFAVF 1243

Query: 1198 IHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQG 1257
            IHRGEASYGHYW+YIKD ++NG+WRKYNDE+++            GNTATPYFLVYVKQ 
Sbjct: 1244 IHRGEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTATPYFLVYVKQD 1303

Query: 1258 QEADIEPLKRILE 1270
              +DIEPLKRI++
Sbjct: 1304 SLSDIEPLKRIIQ 1316

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 1248 bits (3228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/1228 (52%), Positives = 854/1228 (69%), Gaps = 24/1228 (1%)

Query: 52   DVDDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQ-----TSGILK 106
            ++DDG  LLY ++    PLKTS+R+LDDIL +       +       L+      + ILK
Sbjct: 66   ELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSILK 125

Query: 107  KSMLSYSNFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQ 166
            + M+ YS  R+ + PD++GS+ DQ+V+Q+K EY S++CP +NKI+V   V+ + +   Q+
Sbjct: 126  QPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDST---QK 182

Query: 167  IAAFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPN 226
                DD+  I I H+K+TVK R  LER ++ +G+++FH +  LH +D  DL TFD +  N
Sbjct: 183  ANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAAN 242

Query: 227  LKDYGIYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPS 286
            L D+ IYVS+DTNKLILIEIFNPEFDS EER  FT   I +RY     + E  +  + P+
Sbjct: 243  LIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIPT 302

Query: 287  QPDCFYTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEET 346
              +C  TLFK+FKGPL RKS+ DPIK I+S N +L  H+NPEWL SKYGF    E D ET
Sbjct: 303  GIECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMVLEKDVET 362

Query: 347  NESFTEYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKG 406
             + FTEY PPD+ DYV + + RKIRES  RKCL+LIF+G+            K++KS++ 
Sbjct: 363  GDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINLLSKEELEKSSKSLRT 422

Query: 407  LSSIQTSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNY 466
             + +QTSFS   +F+LL + R  + L    Q++  +D   HFINLSVS++Y++RDII+ +
Sbjct: 423  FNLLQTSFST-SFFKLLIQERG-VGLPIENQSNYNIDY--HFINLSVSYHYSERDIIQMF 478

Query: 467  EALSSLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYD 526
            E +S +DP+NIG Y+D+L +IAN KG+YQ+IAYC K DI+GQE+LE A+  F +D     
Sbjct: 479  EVISKVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTA 538

Query: 527  IAELNEATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALS 586
            ++ L ++ ++SIY+ E  NK+ +   H+ NL+NAL++LA Y KS KLKF+VD+EPY    
Sbjct: 539  LSSLEDSVIMSIYQAELKNKSLSQERHV-NLRNALQVLASYKKSKKLKFFVDYEPYLNTR 597

Query: 587  QAYDTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECP 646
             AY+ L IDES+D+DII+TAYSIK+ND+PGLKLDCDRALYTIAI++RS+ LFNFL +   
Sbjct: 598  TAYNMLEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISLFNFLLENNL 657

Query: 647  QFQNYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKI 706
             FQ YY  +   Y  AL LLQVNENASDE IL++F+ KWF+E +   D  L LKAALTKI
Sbjct: 658  IFQEYYTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHLLKLKAALTKI 717

Query: 707  SIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILN 766
            + +RNS LI+NFL TG IDP+ LP ENWPTG+NNIGNTCYLNSLLQYYF+I+PLR  I+N
Sbjct: 718  AFQRNSKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777

Query: 767  YQKTLNNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSK 826
            Y KT+++  ++L      RRVGGR  +  EVERS+QF++QLR+LF  M++S  RCVTP K
Sbjct: 778  YTKTVDDIENNLQLQGITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKK 837

Query: 827  ELAYLAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTNGD 886
            ELAYLAFAPSNVEVEF+ E  K   D       ET    A  + D +L+DF+ +   NG 
Sbjct: 838  ELAYLAFAPSNVEVEFDSEDGKSQRDNI---STETVDVGADGKNDNLLVDFDSNIGANGR 894

Query: 887  VEK-----DENNHEKTESNDVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTE 941
             EK     D N  +K +  +V+ I T       + TRVAKIS DQLENALEMGRQQDVTE
Sbjct: 895  DEKLLVDLDSNISDKIKEEEVKKINTLKP---VTSTRVAKISPDQLENALEMGRQQDVTE 951

Query: 942  CIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLL 1001
            CIGNVL Q+ES S P+  D+D EQ DL+K  F   TKQ I+PL  +   R K+ERFLSLL
Sbjct: 952  CIGNVLNQLESASIPLSLDDDEEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSLL 1011

Query: 1002 VNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMP 1061
            VNIGDHPK+IYDA D YF DE L M EYG+V++T+++T FP+ILQ+QIQRVYYDRE+F+P
Sbjct: 1012 VNIGDHPKNIYDALDLYFNDELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKFIP 1071

Query: 1062 FKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTR 1121
            FKSIEPLPF  V+YMDRYA+ DN  L+  K +   +K++  +MK RQ+ELL+R+  GL+R
Sbjct: 1072 FKSIEPLPFGNVLYMDRYAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGLSR 1131

Query: 1122 KDAFLETIKLLESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISH 1181
            K++ +ET +LL S +++N  +++  K +LI  ++  + +ID EL +L+++I  +E  IS+
Sbjct: 1132 KESLIETKRLLMSDVLDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNISN 1191

Query: 1182 QFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXX 1241
             F +F+   Y+LF+VFIHRGEASYGHYW YIKD  QN +WRKYNDETI+           
Sbjct: 1192 MFKEFQSIKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFI 1251

Query: 1242 XGNTATPYFLVYVKQGQEADIEPLKRIL 1269
             GNTATPYFLVYVK     DIEPLKRI+
Sbjct: 1252 EGNTATPYFLVYVKNENIDDIEPLKRIV 1279

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 1246 bits (3223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/1242 (51%), Positives = 845/1242 (68%), Gaps = 36/1242 (2%)

Query: 34   IDDCPLYEASASQQSTRADVDDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPS 93
            IDD  L +  ++Q       D+GK LLYPD  +  P KTS+RLLD+I  + A+ NS    
Sbjct: 23   IDDGGLEDGGSTQ-------DNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHD 75

Query: 94   VIERGLQTSGILKKSMLSYSNFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVL 153
            ++   L  SG+LK  +L YS  +    P ++G L DQVVL+T+ EY+S +CP  NK+ V 
Sbjct: 76   ILYSALH-SGVLKLPVLEYSR-KPVPDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVF 133

Query: 154  QAVIFNPSLPEQQIAAFDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYD 213
              V+ +PS+  ++    +D+   PIYHLK+TVK R  LE  +K  GV Q+H L  LH  D
Sbjct: 134  MGVLVSPSIVPREP---EDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSD 190

Query: 214  LADLSTFDSSDPNLKDYGIYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVC 273
              DL   + SDP+L D  +YVS DTNKL+ IEIF PEF S E+  +F+  +I++R+ + C
Sbjct: 191  KQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEF-SHEDLATFSPDSIRRRFAEAC 249

Query: 274  LKNESLNENETPSQPDCFYTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSK 333
             K   L+  + PSQ +CF TL KIFKGPL R+S  D +KTI + N  LN+ + P WLT +
Sbjct: 250  GKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTER 309

Query: 334  YGFQASSEIDEETNESFTEYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXX 393
            + FQ       E  E+  EY PPD+ DYV +  +RK+RE Y RKCL+L+F G+       
Sbjct: 310  FQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMS 369

Query: 394  XXXXXKNTKSVKGLSSIQTSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSV 453
                 +++++ +     Q S+S   +F LLGE+R   ++++  Q    +D   HFINLS 
Sbjct: 370  KDDVAQDSRA-RSFHLYQISYSPSFFFHLLGETRG--VMDYGTQE---IDKNYHFINLSA 423

Query: 454  SHYYTDRDIIRNYEALSSLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALEN 513
             HYY+D+DII+NYE  + LDPENIG+YFDAL +IAN KG+YQ+I YC KQD++G+EAL++
Sbjct: 424  CHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEALDS 483

Query: 514  ALMVFKIDPKDYDIAELNEATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKL 573
            AL +F ID  D D++ + +  LL IY+ E+S   +A+    ++LKN+LRL+AK  KS  L
Sbjct: 484  ALSLFGIDASDTDLSTVPDDLLLGIYRKESS---QASQQKRSSLKNSLRLIAKAKKSQIL 540

Query: 574  KFYVDHEPYRALSQAYDTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKR 633
            +FY  +EPY    QAY  L ++ESVD DII+TAY++K+ DSPGLK+DCDRA+YTIA+S+R
Sbjct: 541  QFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRR 600

Query: 634  SLDLFNFLTDECPQFQNYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEP 693
            S+ LFNFL ++CP F  +Y  +KL YQEAL LLQVNENASD+ IL++F+ KW  E V  P
Sbjct: 601  SMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSP 660

Query: 694  DQFLILKAALTKISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQY 753
            DQFLI  +ALTKI   RNS LI  +L TG ID + LP  NWPTG+NNIGNTCYLNSLLQY
Sbjct: 661  DQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQY 720

Query: 754  YFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYA 813
            YF I+PLR  I+ YQKTL+ F+  + + E  RR+GGRE+SE EVERSIQF++QLR+LF  
Sbjct: 721  YFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTD 780

Query: 814  MVHSRERCVTPSKELAYLAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPI 873
            MVH+  R VTP+KELAYLAFAPSN+EVEF  EG   S      ++EE G      E    
Sbjct: 781  MVHTENRYVTPTKELAYLAFAPSNIEVEF--EGTPSSGSVGEAEDEEEGAIKETTE---- 834

Query: 874  LIDFEVDENTNGDVEKDENNHEKTESNDVEII-------MTDDATDLASPTRVAKISSDQ 926
            +ID     N   D+E  +    ++E    + +         D A  + + TRVAKISSDQ
Sbjct: 835  VIDLTSVPNAEQDIEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSDQ 894

Query: 927  LENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSA 986
            LENALEMGRQQDVTECIGNVLFQ+ES SEP   D D EQ DLIKQLF+G  +Q + PL+ 
Sbjct: 895  LENALEMGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLND 954

Query: 987  TDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQ 1046
              KVRTK+ERF+SLLVN+GDHPKD+YDA D YF+++ L + E GDV R+VA+   P +LQ
Sbjct: 955  PTKVRTKIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQL-EDGDVNRSVAIKELPAVLQ 1013

Query: 1047 VQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKN 1106
            +QIQRVYYDRERFMPFKSIEPLPF++ IYMDRY DT++  +L K+EE   LK++   +K 
Sbjct: 1014 IQIQRVYYDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAATLKKELVTLKE 1073

Query: 1107 RQRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELM 1166
            +QR LL+++GSG++ K + LET + L+S ++EN  +   +K+  I+T+ + +  ID EL 
Sbjct: 1074 KQRSLLDKNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELA 1133

Query: 1167 SLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYND 1226
            S+Y  I  LE K+S  FDDFK+ GYSLF+VFIHRGEASYGHYWIYIKD  +NG+WRKYND
Sbjct: 1134 SVYHRIAFLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYND 1193

Query: 1227 ETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEADIEPLKRI 1268
            E+++            GNTATPYFLVYVK GQE+ IEPL R+
Sbjct: 1194 ESVTEAPESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRV 1235

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 1245 bits (3221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/1254 (51%), Positives = 871/1254 (69%), Gaps = 64/1254 (5%)

Query: 54   DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYS 113
            DDG+ LLYP+I T+LPLKTSDRLLDDILC   F  S D            IL  + L YS
Sbjct: 39   DDGRQLLYPNIGTHLPLKTSDRLLDDILCSVGFLTSGD---------NKSILNSNTLEYS 89

Query: 114  NFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPS-LPEQQIAAFDD 172
              R  I+  A+G   DQV++QTK EY S SCP++NKI V+  ++     L + +     +
Sbjct: 90   KQRPHIKGSAVGFFQDQVIIQTKYEYPSKSCPEHNKIFVIMGILIGTDYLEKAEKKQISE 149

Query: 173  IVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGI 232
            + +IPIYH+K++VK+R  LE  KK VGV++++ LD LH+YD  D  ++D +D  L D  +
Sbjct: 150  VTEIPIYHVKISVKVRSILENSKKLVGVSRYYKLDQLHDYDRVDFPSYDPTDSKLLDSAL 209

Query: 233  YVSDDTNKLILIEIFNPEFDSPEERD-SFTTAAIQKRYNDVCLKNESLNENETPSQPDCF 291
            Y +DDTNK++LIEI+ PEFD PE++D S ++  I+ R+     K   L + E+P+Q D  
Sbjct: 210  YATDDTNKIVLIEIYKPEFD-PEDKDLSVSSVQIKNRFAQAKEKFPQLAKEESPTQLDSI 268

Query: 292  YTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFT 351
             TLFK+FKGPL RKS   P K+I++ + +L +++NP  L + +GF  ++E     N    
Sbjct: 269  NTLFKLFKGPLKRKSDDAPQKSIEAEHPLLISNMNPSALVTHFGFTYTNE-----NIPGG 323

Query: 352  EYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXX--XXXXXXXKNTKSVKGLSS 409
            EY+ PD+V+Y+GD  I+K+R+++ RKCL+LI +G               + +K  + L +
Sbjct: 324  EYMAPDLVNYLGDPNIQKLRDTFTRKCLELIAYGNIIISSLPQNITSTAEFSKKYRILRT 383

Query: 410  IQTSFSILPWFQLLGESRAR--ILLNFNEQA------------HSPLDAEPHFINLSVSH 455
            IQ  FS+  W QLLG+ ++R   LLN NE              +SP D + +F NLSV  
Sbjct: 384  IQPEFSLFSWLQLLGDFKSRNIELLNVNEHKGYHLQEAQKRVYYSPFDIDSNFTNLSVCL 443

Query: 456  YYTDRDIIRNYEALSSLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENAL 515
            +Y +RDII+NYE L +LD  NIG+YFD+L+ +ANRKG+YQ+++YCGKQD+IGQEAL+N+L
Sbjct: 444  HYAERDIIQNYERLITLDEPNIGIYFDSLSVVANRKGSYQLLSYCGKQDVIGQEALQNSL 503

Query: 516  MVFKIDPKDYDIAELNEATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKF 575
             VF ID     +  L+E  LLS+YK E   K    +N +++LKNALRLLAKY  SD LKF
Sbjct: 504  AVFGIDYTKVTLESLDENLLLSVYKHEW--KENPDNNRISDLKNALRLLAKYFTSDYLKF 561

Query: 576  YVDHEPYRALSQAYDTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSL 635
            YVD+EPYR + +AYD L IDESVDEDII+TAY+IKIND+PGLK+DCDRALYTIA S+RSL
Sbjct: 562  YVDYEPYRIIQKAYDLLEIDESVDEDIIQTAYTIKINDAPGLKIDCDRALYTIAYSRRSL 621

Query: 636  DLFNFLTDECPQFQNYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQ 695
             LFNFL D+CP+FQ YYG + L Y ++ ++LQ+NEN ++  +L +F+ KW +  + EPDQ
Sbjct: 622  MLFNFLFDQCPEFQRYYGAQSLGYHQSFEILQINENITEPNLLHVFQQKWKNTLLEEPDQ 681

Query: 696  FLILKAALTKISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYF 755
             L  +AALTKI++ERNSNL+ NFL TG I+PNSLP ENWPTGINNIGNTCYLNSLLQ+YF
Sbjct: 682  LLKYRAALTKIALERNSNLLLNFLETGNINPNSLPAENWPTGINNIGNTCYLNSLLQFYF 741

Query: 756  SIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMV 815
            +I+PLR YI+ YQKT+ + + +  +    RR+GGR++ + E+ERS+QF++QLR+L+  M+
Sbjct: 742  AISPLREYIVQYQKTIADLSSNPDSIISKRRIGGRQVGKNEIERSVQFLYQLRDLYNDMI 801

Query: 816  HSRERCVTPSKELAYLAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILI 875
             S +RCVTP +ELAYLAFAPS+++VEFE       N  T        G+N+  +  P+  
Sbjct: 802  FSSQRCVTPKRELAYLAFAPSSIDVEFE-------NAKTKSPISNIEGSNSTTDSQPMPS 854

Query: 876  DFE-VDENTNGDVEKDENNHEKTES-------------NDVEIIMTDDATDLA-----SP 916
              E +D N   D+E++E N+E+  S             +D+E++ TD   +       + 
Sbjct: 855  TGENIDHNM--DIEQEERNNEEINSTNNIESNDLVSNNHDIEMLDTDKENEGNMEIEDTA 912

Query: 917  TRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGT 976
             +VAKI  +QLENALE+GRQQDVTECIGNVLFQ+ES S P    ED+EQ DLIK+LF+G 
Sbjct: 913  IKVAKIDPEQLENALELGRQQDVTECIGNVLFQLESSSSPTSLSEDHEQNDLIKELFFGE 972

Query: 977  TKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTV 1036
            T Q I PL A    RTKVERF+SLLVNI DHPKD+YDA D YF++EYLTM EYG+VKR +
Sbjct: 973  TNQHIKPLKADSVTRTKVERFVSLLVNIADHPKDVYDALDLYFKEEYLTMEEYGEVKREL 1032

Query: 1037 AVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQ 1096
            A+  FPTILQ+QIQRVYYDRERFMP+KSIEPLPF+  IY+DRYADTD++ LL K+EET +
Sbjct: 1033 AIKKFPTILQIQIQRVYYDRERFMPYKSIEPLPFESDIYLDRYADTDDVKLLQKREETAE 1092

Query: 1097 LKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDKKNLIKTLKN 1156
            LK++ +  K RQ+ELL+R+  GL+R+DA+ ET   L S +++NT ++I D   L   L+ 
Sbjct: 1093 LKRQLRSFKERQKELLSRNELGLSRRDAYKETANFLRSEVLQNTNISISDPDLLATKLEE 1152

Query: 1157 KVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRN 1216
              + + +EL  LY  I +LE+KI+HQFDDF E+GY+LF+VFIHRGEASYGHYW+YIKD  
Sbjct: 1153 SASKVADELSDLYVKITNLEEKINHQFDDFTEHGYTLFAVFIHRGEASYGHYWVYIKDF- 1211

Query: 1217 QNGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEADIEPLKRILE 1270
             N +WRKYNDET++            GNTATPYF+V+VK+G E DIEPLKR++E
Sbjct: 1212 VNSIWRKYNDETVTEVPEEEVMNFTEGNTATPYFIVFVKKGHEKDIEPLKRMIE 1265

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 1231 bits (3185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/1230 (51%), Positives = 833/1230 (67%), Gaps = 51/1230 (4%)

Query: 54   DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYS 113
            D GK LLY D     P KTS+RLLDDI  + A+ NS +  ++   L   G+L+  +L YS
Sbjct: 36   DTGKTLLYADAGNLFPFKTSERLLDDIKLELAYKNSIEHDILYSELH-KGVLRLPILEYS 94

Query: 114  NFRSRIRPD----ALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAA 169
                  +P      +G L DQVVL+T+ EYDS +CP  NKI V   V+ N S   Q    
Sbjct: 95   R-----KPTDDVYNIGHLVDQVVLKTRYEYDSKTCPGLNKITVFMGVLLNSS---QMPKI 146

Query: 170  FDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKD 229
            +DD+ +  +YHLKVTVK R  LER +K  GV Q+H L  LH +D  DL   D+ DP+L D
Sbjct: 147  YDDVTQASVYHLKVTVKTRLHLERTRKQAGVPQYHLLPELHPFDKEDLLLTDAEDPHLID 206

Query: 230  YGIYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPD 289
              +YVS DTNKLI IEIF PEF S  +   F   AI+KRY+  C K   L+ +  PSQ +
Sbjct: 207  SVMYVSSDTNKLICIEIFKPEF-SQADLTEFCPDAIKKRYSSACDKYPDLDPDMIPSQAE 265

Query: 290  CFYTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNES 349
            CF TL KIFKGPL R+   D +KTI + N  LN+ L+P+WLT K+ F+     D +   S
Sbjct: 266  CFSTLLKIFKGPLNRRGPEDVLKTISADNKFLNSQLDPKWLTEKFAFKLCQANDTDEAGS 325

Query: 350  FTEYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSS 409
              E+ PPD+ +YV D  +R++RESY RKCL+LIF G+            K++++ +    
Sbjct: 326  AMEFQPPDLTNYVDDVSVRELRESYTRKCLELIFLGKMSSSLMTKEDIAKDSRA-RSFQL 384

Query: 410  IQTSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEAL 469
             QTS S+  +F LL E+R   ++++  Q    +D   +F+NLS  +YYTD+DII+NYE  
Sbjct: 385  YQTSNSLSFFFHLLNETRG--VMDYGSQE---IDRNYNFMNLSSCYYYTDKDIIKNYETQ 439

Query: 470  SSLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAE 529
            + LD ENIG+YFDALTYIAN KG+Y +IAYC KQD++G+EAL++AL +F IDP D  +  
Sbjct: 440  ALLDRENIGIYFDALTYIANLKGSYALIAYCRKQDVVGKEALDSALSLFGIDPSDTSLMT 499

Query: 530  LNEATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAY 589
            + +  LL +Y+ E S   + ++     LKNALRLLAK   S  L+FY  +EPY  + QAY
Sbjct: 500  IPDELLLGVYRKECS---QGSTQKHATLKNALRLLAKAKNSSTLQFYAAYEPYDNVHQAY 556

Query: 590  DTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQ 649
              L +DESVD D+I+TAY+IK+ DSPGLK+DCDRA+YT+A++KRS+ LFNFL ++CP F+
Sbjct: 557  SLLEVDESVDVDVIQTAYTIKVADSPGLKIDCDRAIYTLAVTKRSMPLFNFLVEQCPVFE 616

Query: 650  NYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIE 709
             +Y  +KL Y +AL LLQVNENASD+ IL++F+ KW  E V  PDQFL   +ALTKI   
Sbjct: 617  EFYSADKLTYHDALSLLQVNENASDDIILEVFQRKWNHETVLSPDQFLKSSSALTKIGQV 676

Query: 710  RNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQK 769
            RNS LI  +L TGTID   LP  NWPTG+NNIGNTCYLNSLLQYYF I+PLR +I++YQK
Sbjct: 677  RNSLLINRYLETGTIDVRCLPARNWPTGLNNIGNTCYLNSLLQYYFCISPLRQFIVDYQK 736

Query: 770  TLNNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELA 829
            TL  F+D + N    RR+GGRE+SE EVERS+QF++QLR+LF  M+H+  R VTP KELA
Sbjct: 737  TLAEFHDSIGNLGSKRRIGGREVSESEVERSVQFVYQLRDLFTDMIHTESRFVTPRKELA 796

Query: 830  YLAFAPSNVEVEFE----VEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTNG 885
            YLAFAPSN+EVEFE    VE  KE+                 +E D  +ID   +   + 
Sbjct: 797  YLAFAPSNIEVEFEGTPTVEPAKEN-----------------SENDVEVIDLTAEGEASE 839

Query: 886  DVE-----KDENNHEKTESNDVEIIMTDDATD-LASPTRVAKISSDQLENALEMGRQQDV 939
            DV+     + E     T+ N+  ++    AT+ + S TRVAKIS+DQLENALEMGRQQDV
Sbjct: 840  DVDMLKPAESETQVVTTQLNEDTVMNDVIATEPMVSSTRVAKISTDQLENALEMGRQQDV 899

Query: 940  TECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLS 999
            TECIGNVLFQ+ES S+PI  D D EQ DLIK+LF+G  KQ + PL    K+RTK+ERF+S
Sbjct: 900  TECIGNVLFQLESASDPINLDSDGEQRDLIKELFFGKLKQDLAPLKDPSKIRTKIERFVS 959

Query: 1000 LLVNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERF 1059
            LLVN+GDHPK++YDA D YF+D+ L + E GDVKRT+A+   P +LQ+QIQRVYYDRE+F
Sbjct: 960  LLVNVGDHPKNVYDALDQYFKDDVLQL-EDGDVKRTLAIKELPVVLQIQIQRVYYDREKF 1018

Query: 1060 MPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGL 1119
            MPFKSIEPLPF++ IYMDRY DT +  +  K++E  + K + + +K RQ+ LL ++G+G+
Sbjct: 1019 MPFKSIEPLPFRDTIYMDRYMDTQDAEMQQKRQEAAKYKNELESLKLRQKALLEKNGNGM 1078

Query: 1120 TRKDAFLETIKLLESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKI 1179
            + K + LET + LES ++E   + I+ K + +K +++ +  IDNEL  +YS I +L+ K+
Sbjct: 1079 SFKTSLLETERFLESGVLEQNAIEIQKKDSALKAIESMLLKIDNELSEIYSRITALDQKL 1138

Query: 1180 SHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXX 1239
            S  FD+FKE GYSLF+VFIHRGEASYGHYW+YIKD N+NG+WRKYNDET++         
Sbjct: 1139 SSHFDNFKELGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYNDETVTEAPENEVFN 1198

Query: 1240 XXXGNTATPYFLVYVKQGQEADIEPLKRIL 1269
               GNTATPYFLVYVK G E++I+PL R++
Sbjct: 1199 FTEGNTATPYFLVYVKNGHESEIQPLHRVI 1228

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 1164 bits (3012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1242 (49%), Positives = 819/1242 (65%), Gaps = 59/1242 (4%)

Query: 56   GKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYSNF 115
            GK +LYP ++   P KTSDRLLDDI    +F       V+E G++ +G+LK  ML YS  
Sbjct: 30   GKTVLYPLVSGNYPFKTSDRLLDDIRSTLSF-------VLE-GVRGNGVLKSPMLDYSKE 81

Query: 116  RSRIRPDALGSLTDQVVLQTKTEYDSISCP------QYNKIQVLQAVIFNPSLPEQQIAA 169
            R  +R  ++G L DQV+LQT  EY S+         +++KI V   ++ +P +   ++ +
Sbjct: 82   RGELRAWSIGYLLDQVLLQTSYEYASLGGSGGGGGDKHSKINVFMGLLCDPMV---KLCS 138

Query: 170  FDDIVKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKD 229
             DDIV    YHL+VTVK R  LER K+  G+ Q+H ++ LH  D  DL  F+  D  + D
Sbjct: 139  EDDIVNYSGYHLRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDDECVID 198

Query: 230  YGIYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPD 289
               YVS  TN+L+ IEI  PEF + EE   FT  +I+KRY  +C K   LN    P+Q +
Sbjct: 199  SATYVSSGTNRLVRIEILKPEF-TAEEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAE 257

Query: 290  CFYTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNES 349
            C  TLFK+FK PL+R+ + D +KTI + N VLN+ L+P WL  K+GF+   E+ EE    
Sbjct: 258  CLNTLFKVFKNPLSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELC-EVQEEDGRK 316

Query: 350  FTEYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSS 409
              EY PPD  +YV DW +R +RE Y+RK L+L+F G+             ++K ++    
Sbjct: 317  EYEYKPPDFTNYVNDWNVRHLRERYIRKSLELLFVGKQSIRLLPKEVVAASSK-LRSFQL 375

Query: 410  IQTSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEAL 469
             QT FS   WFQLLGE       +FN+Q   P D  PHFINLSV++YY DRDIIRNYE+ 
Sbjct: 376  YQTHFSHTFWFQLLGEFDRN---DFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQ 432

Query: 470  SSLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAE 529
              LDP+N G+Y+D LT+IAN KG++Q++ +  KQ+I+GQEAL +AL +F IDP + D  +
Sbjct: 433  ILLDPKNAGIYYDDLTFIANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQ 492

Query: 530  LNEATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAY 589
            + +  LLS YK E    N   +    +L+NALRLLAKY +S+KLKFYV+ EP++  SQAY
Sbjct: 493  IPDEMLLSCYKEECKYGN---TRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAY 549

Query: 590  DTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQ 649
              L IDESVD DII+TAY+IK++D+PGLK+DCDRALYT+AI+KRS+DLFN+L   CP+FQ
Sbjct: 550  SILEIDESVDIDIIETAYTIKVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQ 609

Query: 650  NYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIE 709
             +Y      Y  AL+ LQVN NA+D+ IL+IF+ KW +E V  PDQFL LK AL KI+ E
Sbjct: 610  QFYHISYWSYTSALQYLQVNVNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHE 669

Query: 710  RNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQK 769
            RNS LI +FL TG ID N L   NWPTG+NNIGNTCYLNSLLQYYF+I+PLR YI NY+ 
Sbjct: 670  RNSKLINHFLETGIIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYED 729

Query: 770  TLNN--FNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKE 827
            T ++   N + S +   RR+GGR +++ EVERS+QF++QLR+LF  M HS+ERCVTPS+E
Sbjct: 730  TASDLLLNMNQSGAMTKRRIGGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRE 789

Query: 828  LAYLAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVD------E 881
            LAYL+F+PS   VEFE        D TIL E+E         +D  + D  ++      E
Sbjct: 790  LAYLSFSPSTTNVEFESAAQVPFRDTTILLEQEPPN------EDTEVFDISIEGSNVETE 843

Query: 882  NTNGDVEKDENNHEKTE---------------SNDVEIIMTDDATDLASPTRVAKISSDQ 926
                D+  D+N   K E                N +  I+ ++     + T VAKIS DQ
Sbjct: 844  AAAEDIIADDNIDTKDESSSLSPSTSTSSSQKGNSMSNIVEENEP--ITSTCVAKISPDQ 901

Query: 927  LENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSA 986
            LEN LE+GRQQDVTECIGNVL+QIES S P+ +DE +EQYDL+KQLFYG  KQ ++P+  
Sbjct: 902  LENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEGHEQYDLVKQLFYGKLKQDLIPIEN 961

Query: 987  TDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMA-EYGDVKRTVAVTTFPTIL 1045
             +K RTK ERF+SLLVN+GDHPKDIYDA D YFRD+ L +  +   V+R+VAV   PTIL
Sbjct: 962  PEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDDLLALGDDNARVRRSVAVEELPTIL 1021

Query: 1046 QVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMK 1105
            Q+QIQRVYYDRE+ MPFKS EPLPF E +YMDRY  +    LLAKK+E+ QL +  + +K
Sbjct: 1022 QIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMASTESELLAKKQESLQLHETLEAIK 1081

Query: 1106 NRQRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIE-DKKNLIKTLKNKVTDIDNE 1164
             R++++L+++ +GLT KD+  ET   LESS++  +   I  +K+NLIK L +   +ID E
Sbjct: 1082 QRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESEGKIRIEKRNLIKQLDSFSLEIDKE 1141

Query: 1165 LMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKY 1224
            L +L   I  +E+ ISH+FD F  +GY+LF+VFIHRGEASYGHYW+YIKDR  +G+WRKY
Sbjct: 1142 LSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKY 1201

Query: 1225 NDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEADIEPLK 1266
            NDE+++             NTATPYFLVY+K G E +IEPLK
Sbjct: 1202 NDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEHEIEPLK 1243

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 1103 bits (2853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/1245 (47%), Positives = 786/1245 (63%), Gaps = 72/1245 (5%)

Query: 43   SASQQSTRADVDDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTS 102
            S S +S    VDDGK LLY DI+   P KT DR+LDDI     F      SV        
Sbjct: 28   SKSLESFSDLVDDGKTLLYGDISKSFPFKTCDRILDDIRISPWFLKKFGSSV-------- 79

Query: 103  GILKKSMLSYSNFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSL 162
              +K+ ML YS  R +++P  L  L DQV L+++ +YDS++CP  N I V+ A++ +P+ 
Sbjct: 80   --MKQPMLQYSRERQQLQPWNLVHLIDQVNLRSRYDYDSMTCPGKNTISVMFALLVDPNF 137

Query: 163  PEQQIAAFDDIVKIP--IYHLKVTVKIRQELERLKKHVGVTQFHALD--HLHEYDLADLS 218
                   FDDI K P   +HLK+TVK R  LE   +HVG+T +H L+   LH +D  D+ 
Sbjct: 138  TPND---FDDIDKFPEYFFHLKITVKRRSYLENFNRHVGITHYHVLEPESLHPFDKRDIF 194

Query: 219  TFDSSDPNLKDYGIYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNES 278
              +  D  L D  I+VS DTNKLIL+EI  PEF+S E    + TA I++RY + C + + 
Sbjct: 195  IMEEKDCRLVDQSIFVSADTNKLILVEIIKPEFNS-ENLAEYRTAKIEERYKNACQEFDL 253

Query: 279  LNENETPSQPDCFYTLFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQA 338
            LN ++ PSQ +C  TLF IFK PL RKS     K I   ++ LN+ +N +WLT+ + F  
Sbjct: 254  LNPDDIPSQAECLKTLFMIFKNPLQRKSANSEFKIISRDSVALNSQINTDWLTTMFDFSL 313

Query: 339  SSEIDEETNESFTEYVPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXX 398
                 E+  +S  EY PPD+VDY+ D+K+R IRE+Y RK ++++  G+            
Sbjct: 314  QKTAVEDNVQSGEEYKPPDLVDYITDFKVRGIREAYTRKSMEVVLIGKQSMLLENELGTE 373

Query: 399  KNTKSVKGLSSIQTSFSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYT 458
            K T + K  S+   S S   WF +L                 P D   HFINLSV+  Y 
Sbjct: 374  KKTVA-KCFSNQHFSASHTWWFNILNHQHIEPF---------PYDINYHFINLSVAFKYI 423

Query: 459  DRDIIRNYEALSSLDPENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVF 518
            D+DII+NYE   +LD ENI  YFDAL Y+ N KG+YQ+IAYCGKQD++G E L NAL VF
Sbjct: 424  DKDIIKNYETQIALDQENISHYFDALQYVTNAKGSYQLIAYCGKQDVVGYEDLNNALQVF 483

Query: 519  KIDPKDYDIAELNEATLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVD 578
             +DP D D + L+  T++  Y    S+  +++ N   +L+NALR+L KY  S K+ F V+
Sbjct: 484  GLDPTDIDASLLDANTMIEYY---NSHLLRSSDNQRKDLRNALRVLGKYLGSQKMLFLVE 540

Query: 579  HEPYRALSQAYDTLAIDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLF 638
            +EPY  + QAY  L +DE+VD+DII+TAY+I I D+PGLK D DRA++TIA+ +RS+ L 
Sbjct: 541  YEPYYNVQQAYTLLKVDETVDDDIIQTAYTINIADAPGLKKDYDRAIFTIALDRRSIFLL 600

Query: 639  NFLTDECPQFQNYYGPEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLI 698
            N LTDECP+F  YY    + Y EAL +++++ NASD+ IL++F+ KW    +  PD  L 
Sbjct: 601  NVLTDECPEFAQYYNCTDISYDEALNIIEIDMNASDDVILEVFQKKWSHGIMTGPDYLLK 660

Query: 699  LKAALTKISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIA 758
            LK AL  I   RNS LI +FL TG +D + LP   WP GINN+GNTCYLNSLLQ++F+I 
Sbjct: 661  LKMALQNIGFTRNSKLINHFLDTGIVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIK 720

Query: 759  PLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSR 818
            PLR +ILNY        D  S     RR+GGRE+S+ E  RS+QF++ LR+LF  M+H+ 
Sbjct: 721  PLRDFILNYDDDSAKLLD-ASEYHSRRRIGGREVSKQEELRSVQFVYHLRDLFNDMIHTN 779

Query: 819  ERCVTPSKELAYLAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILIDFE 878
             RCVTP+KEL YLAFAPSNVEVEF         D T+ ++E              LID  
Sbjct: 780  SRCVTPTKELVYLAFAPSNVEVEF--------GDDTVAQKE--------------LIDLT 817

Query: 879  VDENTNGDVEKDENNHEKTESNDVEIIMTDDATDLAS------------PTRVAKISSDQ 926
             D      VE   +      S D +IIM      L                +VAKIS+DQ
Sbjct: 818  TDV-----VEDPTDTTRHLASCDDDIIMCQSPVALPEHKTSSEAGTQQYSVQVAKISADQ 872

Query: 927  LENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSA 986
            LEN LE+GRQQDVTECIGNVL Q+E  SEP+  ++D EQ DL+KQLFYG  KQ ++P++ 
Sbjct: 873  LENTLEIGRQQDVTECIGNVLAQLEIASEPLSLEDDLEQNDLVKQLFYGRIKQDLIPVND 932

Query: 987  TDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQ 1046
               VRTK ERFLSLLVN GDHPKDIYDA D YF+++YL + EYGDVKRTV+++  P +LQ
Sbjct: 933  EASVRTKYERFLSLLVNTGDHPKDIYDALDFYFQNDYLNLEEYGDVKRTVSISELPAVLQ 992

Query: 1047 VQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKN 1106
            +QIQRVYYDRE+FMPFKSIEPLPF E +YMDRY  T++  LLA+ ++  +LKQK +D+K 
Sbjct: 993  IQIQRVYYDREKFMPFKSIEPLPFGETLYMDRYMATEDPKLLAEIQQNAELKQKLQDLKQ 1052

Query: 1107 RQRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDKKNLIKTLKNKVTDIDNELM 1166
            RQR+LL+++  GLT K + +ET K L+S  ++   ++ ++  + I  +   + +ID EL 
Sbjct: 1053 RQRKLLSQNEIGLTLKSSLIETKKFLQSGTLKAHDIDADNIPSSIAYIDILINNIDEELK 1112

Query: 1167 SLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYND 1226
            SL++ I  LE  IS QF +FK  GYSLF+VFIHRGEASYGHYW+YIKD  +NG+WRKYND
Sbjct: 1113 SLFNKITDLETTISQQFSEFKHIGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYND 1172

Query: 1227 ETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEAD-IEPLKRILE 1270
            ++++            GNTATPYFLVYV++GQE + IEPLKRIL+
Sbjct: 1173 DSVTEVPQSEVFNFTEGNTATPYFLVYVREGQEQETIEPLKRILQ 1217

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/792 (48%), Positives = 530/792 (66%), Gaps = 28/792 (3%)

Query: 54  DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYS 113
           DDG+ +LY ++A   P+KTSDRLLDD+            S+ E G +   +L+  ML Y+
Sbjct: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVTV--------SLSEEGRE---VLRAPMLEYA 69

Query: 114 NFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDI 173
             R+  R  ++G L DQVVLQT  EY S +C Q N++ V   V+ +P    Q+ A+ D++
Sbjct: 70  RQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPG---QRFASQDEL 125

Query: 174 VKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGIY 233
           V   IYHL+VTVKIR +LER ++H GV Q+H +D LH +D  D   F+  DP + D   Y
Sbjct: 126 VNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATY 185

Query: 234 VSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFYT 293
           V+  TN+L+ IE+  PEF  P+E   FT   I+ RY +VC ++  L+ ++ PSQ +C  T
Sbjct: 186 VASGTNRLVRIEVLRPEF-GPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNT 244

Query: 294 LFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTEY 353
           LFK+FK PL+R+   D +KTI + N VLN+ L   WL +K+GF+   EI EE  +   EY
Sbjct: 245 LFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELC-EI-EEDGQKIYEY 302

Query: 354 VPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSSIQTS 413
            PPD  ++V +W++R+ RESY+RK L+LIF G+             N+K ++     QT 
Sbjct: 303 KPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRSFQLYQTH 361

Query: 414 FSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLD 473
           FS   W+ L+GE       +FN+Q H P D   HF++LS ++YY+DRDII+NYEA  +LD
Sbjct: 362 FSHSFWYHLMGEYDHN---DFNQQMH-PYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALD 417

Query: 474 PENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELNEA 533
           P N  +Y+D L+++AN KG+ Q++ Y  KQ+++G EAL +AL +F +DP   D  +L++ 
Sbjct: 418 PANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDE 477

Query: 534 TLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLA 593
            LL  YK     K+     H  +L+NALRLLA+Y +SDKLKFYV+ EP+    QAY  L 
Sbjct: 478 FLLESYK--EVCKDSGPQKH-ADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKLLE 534

Query: 594 IDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYG 653
           IDESVD DII+TAYSIK++D+PGLK+DC RALYT+A++KRS+ LFN L  +CP+F  +Y 
Sbjct: 535 IDESVDIDIIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYH 594

Query: 654 PEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERNSN 713
              L YQ AL+ L VN NA+D+ IL+IF+ KW  + +  P+Q L LK ALTKI  ERNS 
Sbjct: 595 MSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSK 654

Query: 714 LITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNN 773
           LI +FL TG +D N LP  NWPTGINNIGNTCYLNSLLQYYF+I+PLR YIL Y  T +N
Sbjct: 655 LINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTASN 714

Query: 774 -FNDHLSNSEH-VRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYL 831
             N+ +S+S+   RR+GGR IS+ EVERS+QF++QLR+LF+ MVHSRER VTP++EL YL
Sbjct: 715 LLNNAVSSSDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYL 774

Query: 832 AFAPSNVEVEFE 843
           +F+PS+ EVEFE
Sbjct: 775 SFSPSSTEVEFE 786

 Score =  387 bits (995), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/371 (53%), Positives = 263/371 (70%), Gaps = 2/371 (0%)

Query: 901  DVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYD 960
            D+ ++ + +A    + T VAKISSDQLEN LE+GRQQDVTECIGNVL+QIES S P+  D
Sbjct: 1018 DITMVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLD 1077

Query: 961  EDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFR 1020
            E+ EQ+DL+KQLFYG  KQ ++PL   D+ RTK+ERF+SLLVNIGDHPKDIYDA DSYF+
Sbjct: 1078 EEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFK 1137

Query: 1021 -DEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRY 1079
             D      + G V+R+VAV   P +LQ+QIQRVYYDRE+FMPFKS EPLPF E +YMDRY
Sbjct: 1138 DDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRY 1197

Query: 1080 ADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVEN 1139
              TDN  L AKK++   L+++ + ++ R+R LL ++  G+T   A  +T + L+++ + +
Sbjct: 1198 LATDNAELNAKKQQAIGLREELERLRERRRRLLAKNDHGVTLSAALADTRRFLDAAELTS 1257

Query: 1140 TVLNIEDKKNLIKT-LKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFI 1198
                ++++ +   + L      +D EL +L + I S++D I+H+FD F  YGYSL +VFI
Sbjct: 1258 GSRQLQEQYHATTSHLDALRVALDEELAALDAHIASVQDAIAHRFDAFSSYGYSLGAVFI 1317

Query: 1199 HRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQ 1258
            HRGEASYGHYW+YIKD    G+WRKYNDE+++             NTATPYFLVYVK+  
Sbjct: 1318 HRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAH 1377

Query: 1259 EADIEPLKRIL 1269
            E DIEPLKR+L
Sbjct: 1378 ELDIEPLKRLL 1388

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
            [3756 nt, 1252 aa]
          Length = 1251

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1222 (38%), Positives = 679/1222 (55%), Gaps = 110/1222 (9%)

Query: 70   LKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYSNFRSRIRPDALGSLTD 129
             KTSDR++DDIL D +F NS+   + E GL   GIL+     YS FRS      + +L++
Sbjct: 106  FKTSDRIIDDILIDLSFINSSADEIKELGL-NKGILRLPTTDYSKFRSSFSEYKIINLSN 164

Query: 130  QV-VLQTKTEYDSISCPQYNKIQVLQAVIFNP----SLPEQQIAAFDDIVKIPIYHLKVT 184
            +  ++  + EY+S +  Q NKI    +++  P    +L  + +A F    +   YHLKV+
Sbjct: 165  KNNLINYRFEYESKTNHQDNKILEFFSILHKPKDASNLDYESMAKF--WSQNEFYHLKVS 222

Query: 185  VKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGIYVSDDTNKLILI 244
            +K R +LE  KKH  +  F+ +D  +E D  D   F+  +PNL DY I++S +TNK++L+
Sbjct: 223  IKTRNQLELSKKHTPIQHFYVIDEFNEEDKLDFINFNPDNPNLLDYAIFISSNTNKVVLV 282

Query: 245  EIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFYTLFKIFKGPLAR 304
            EIF  EF+  ++        +   Y      N  L   + P+Q D    L   F      
Sbjct: 283  EIFKSEFNLNDKLIILDDLQVLNNYEKYKNSNHKL---KLPTQTDVLLVLMYCFNKQQNF 339

Query: 305  ---KSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTEYVPPDMVDY 361
                S+ D IK  DS  I ++  LNP WLT ++  +       + +ES    +  ++ + 
Sbjct: 340  DNIHSSEDEIKLKDSKAIKIS--LNPSWLTERFSLKF------QEDESL---IFMNLRNN 388

Query: 362  VGDWKIRKIRESYVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSSIQTSFSILPWFQ 421
            +   K  K R     +CL  +F               K+T  +K + +I  + S+  W Q
Sbjct: 389  LNLIKKEKRRFDVFTRCLLELFVLIKSAPQKLVKCNSKDTNIIKVVDTISINSSLSFWSQ 448

Query: 422  LLGESRARILLN-FNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLY 480
            +LGE ++ +  N FN+ +         FINLS+   YT+ +I++NYE L+ L+P+ IG+Y
Sbjct: 449  ILGEYKSILSQNNFNQYS-----KHAEFINLSILPTYTESEIVKNYEILTILNPDKIGVY 503

Query: 481  FDALTYIANRKGAYQIIA-YCGKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIY 539
            FD+L +++     Y+ +A Y  K +IIG E    +L +FK+D  ++     +++ L   Y
Sbjct: 504  FDSLKFVSQCLTQYENLADYVNKNEIIGNEEFNQSLKIFKMDKLEF--TNCSDSVLWEKY 561

Query: 540  KFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVD 599
                 +KN    NH   L+N+++ L+    S  LKF   +EPY+    A+ TL I ESVD
Sbjct: 562  LTYYEDKN-FDYNHAI-LRNSIKSLSIVKNSPILKFLCKYEPYKNPDNAFVTLNIHESVD 619

Query: 600  EDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDY 659
             D I  +Y+ KIND    K   D+AL TIAI ++ L LF+ L + C  F N Y    ++Y
Sbjct: 620  SDTIIVSYTTKINDMKDKKQHLDKALLTIAIDRKDLSLFHTLYENCKDFVNLYHSMNIEY 679

Query: 660  QEALKLLQVNENASDETILKIFKGKWFDENVYEPDQF-------LILKAALTKISIERNS 712
            + AL+ +  +E  SD  ++  FK +W+  +V   D F       L L+  +  IS  RNS
Sbjct: 680  KTALQAIDSSELNSDNELILSFKKRWYRIDV-NNDTFGDDTVNLLTLRKVMMVISSNRNS 738

Query: 713  NLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLN 772
             L+ N++  G ++P  LP ++WP G+NNIGNTCYLNSLLQYYF+I+PLR Y++N      
Sbjct: 739  LLLNNYIEYGIVNPKFLPSKSWPVGLNNIGNTCYLNSLLQYYFAISPLREYLIN------ 792

Query: 773  NFND------HLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSK 826
             FND       + N E  RRVGGR +S  E  RSIQF++QLR+L+  MVHS  R V+P  
Sbjct: 793  -FNDIELDGREMKNLEK-RRVGGRNLSIAEFHRSIQFVYQLRDLYGEMVHSSSRKVSPRL 850

Query: 827  ELAYLAFAPSNVEVEFEVEGNKESNDATILKEEETGGANAINEQDPILIDFEVDENTNGD 886
            +LAYLAFAPS+  +EF  +G + +        ++T G +  +    +  +   D + +  
Sbjct: 851  QLAYLAFAPSDTPIEFR-DGIQNAIGKNDYYSDKTNGGSESSSIKGLNSNLNSDSDADSS 909

Query: 887  VEKDENNHEKTESNDVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNV 946
            ++ D  +   T  N + II T   T+L  PT + KISS QLE  LEMG QQDVTECI NV
Sbjct: 910  LDSDSESSLLTFDN-LPIIKTS-TTNL--PTLIPKISSSQLETTLEMGSQQDVTECIENV 965

Query: 947  LFQIESGSEPIRYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGD 1006
            LFQIE+ S PI  DEDNEQ DL+KQLF+G T+Q I P +   KV  K ERFLSLLV++ D
Sbjct: 966  LFQIEAASNPISIDEDNEQVDLVKQLFFGKTEQKIKPFNEVSKVHPKRERFLSLLVSVSD 1025

Query: 1007 HPKDIYDAFDSYFRDEYLTMAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIE 1066
             P+DIYDA D+YF+DE   M EYG VK+++ +++FPTILQVQIQRVYYD E+ +PFK +E
Sbjct: 1026 KPRDIYDALDTYFKDEVFDMEEYGKVKKSLTISSFPTILQVQIQRVYYDIEKGVPFKDLE 1085

Query: 1067 PLPFKEVIYMDRYADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFL 1126
            PL F E +Y+DRYA+  +  L  KK E   LK++ K +   ++EL               
Sbjct: 1086 PLRFSESLYLDRYANDIDEKLAEKKIEVASLKKRLKGLITIKKEL--------------- 1130

Query: 1127 ETIKLLESSIVENTVLNIEDKKNLIKTLKNKVTDIDN-ELMSLYSDINSLEDKISHQFDD 1185
                               +KKN            DN E+ ++  +IN +E KI   F +
Sbjct: 1131 -------------------EKKN------------DNVEIRTISKEINDVETKIDTAFSE 1159

Query: 1186 FKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNT 1245
            F ++GYSLF+VFIHRG+A++GHYWIYIKD   +G WRKYND  ++            GN+
Sbjct: 1160 FHKHGYSLFAVFIHRGQATFGHYWIYIKDFKNHGTWRKYNDHEVTEILPIEVFNFSEGNS 1219

Query: 1246 ATPYFLVYVKQGQEADIEPLKR 1267
            +TPYFLVY+K G E D+EPLKR
Sbjct: 1220 STPYFLVYIKNGSEFDVEPLKR 1241

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1258 (33%), Positives = 649/1258 (51%), Gaps = 127/1258 (10%)

Query: 43   SASQQSTRAD--VDDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQ 100
            S++Q   + D  +DDG HLLY +I      KTS R+LDDIL D AF  S D    +    
Sbjct: 56   SSAQNVEKNDTSIDDGMHLLYQNIEKEGVFKTSQRILDDILTDIAFM-SLDSEKSDDIDF 114

Query: 101  TSGILKKSMLSYSNFRSRIRPDALGSL-TDQVVLQTKTEYDSISCPQYNKIQVLQAVIFN 159
              G+L    + YS +R  I+P  +    T+  V+  K ++ S++ P+ N I  L  ++  
Sbjct: 115  KDGVLNLPTIKYSLWRKYIKPFKIILFNTNNPVVDVKLQHKSVTSPKNNTITELYGLLV- 173

Query: 160  PSLPEQ-QIAAFDDIVKI-PIYHLKVTVKIRQELERLKKHVGVTQFHALD---HLHEYDL 214
            P +P + ++  FD+ ++  P+Y +++TVK R  LE  KKH+ +T +  LD    LHE D 
Sbjct: 174  PKIPRRSELNTFDEYIRSKPLYSIRITVKTRHRLEHKKKHIALTPYFLLDDFDKLHEVDK 233

Query: 215  ADLSTFDSSDPNLKDYGIYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCL 274
            +D   F+    +L D+ IY+S DTNK+ILIEIF P F+  E     ++A++  R N++  
Sbjct: 234  SDFPKFNKDSKDLLDFSIYISSDTNKIILIEIFKPAFNQTELDYLLSSASVLNRSNEL-- 291

Query: 275  KNESLNENETPSQPDC------------FYTLFKIFKGPLARKSTADPIKTIDSGNIVLN 322
              ++L+E   P   D              + + +  KG   R+        + S ++ L 
Sbjct: 292  --DNLHEELQPDYNDAIVEEQIDTIEILLHCIMQNLKGSPERELEKQKTSFLLSDDVKLG 349

Query: 323  THLNPEWLTSKYGFQASSE---------IDEETNESFTEYVPPDMVDYVGDWKIRKIRES 373
            T+++ +WL   +  +   +         +DE    SF +  P +   +          + 
Sbjct: 350  TYVDIKWLEENFDIKVKEQKRKDHVSITLDEALKLSFDDPNPKNQAKF----------DK 399

Query: 374  YVRKCLQLIFWGQXXXXXXXXXXXXKNTKSVKGLSSIQTSFSILPWFQLLGESRARILLN 433
              R  ++L++ G+            +          ++   +   W Q+L E ++     
Sbjct: 400  ITRYAMELMYLGKVLQSFYSNEEEIEEYMEDTIFKQVKVHHTTSFWTQILNEYQSI---- 455

Query: 434  FNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLDPENIGLYFDALTYIANRKGA 493
            F+ Q  S    + HFINL +    +++DII NYE     DP+N   YF++L Y++ +   
Sbjct: 456  FSSQKTSTRCVDEHFINLCIDSNVSEKDIITNYEIQLRTDPDNDSKYFESLKYVSRKFPD 515

Query: 494  YQII-AYCGKQDIIGQEALENALMVFKIDPKDYDIAELNEATLLSIYKFETSNKNKAASN 552
            Y ++  YC +  II + A  +AL +FK   + ++  E + + +   Y     + N     
Sbjct: 516  YIVLEKYCKENVIISKAAYLHALEIFKYSEEYFNAIE-HVSEIWDKYTELVQSNNNNDDQ 574

Query: 553  HLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLAIDESVDEDIIKTAYSIKIN 612
            +  +L ++   LA   KS  L +   +EP+     AY  L +D  +D + I  AY+++I 
Sbjct: 575  YRVDLVDSFYSLATVKKSSPLIYITKYEPFFHPVTAYLKLNVDAKLDSENIVLAYTMQIR 634

Query: 613  DSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQEALKLLQVNENA 672
            + P  K+  DRAL+ IAI +  L L   L   C  F        L   +A +++ + + +
Sbjct: 635  EVPEHKIQFDRALFAIAIQRHDLSLLYVLKQNCSAFNECISNIILTSDDAFEIIGMPKTS 694

Query: 673  SDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLLTGTIDPNSLPPE 732
            S+ +I+  F   W + +   P  F++  AAL ++S  R S L+ +F   G ++P  +  E
Sbjct: 695  SELSIINTFTKYWKETDDSNPVNFILASAALREVSKHRASALLRHFYEFGKVNPKMIDSE 754

Query: 733  NWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKT---LNNFNDHLSNSEHVRRVGG 789
             WPTGINNIGNTCYLNSLLQYYFSI   R +I NYQ     L N N  +S     RRVGG
Sbjct: 755  LWPTGINNIGNTCYLNSLLQYYFSITLFREFIENYQSIESDLLNSNAEMSK----RRVGG 810

Query: 790  REISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEVEFEVEGNKE 849
            REI   E+ RS+QFI+Q+++LF  MVH++ R VTPS +LAYLAFAP+N E++F+ +   E
Sbjct: 811  REIQNNEINRSVQFIYQVQDLFKLMVHTKSRKVTPSNQLAYLAFAPNNAEIKFKHKSELE 870

Query: 850  SNDATILKEEETGGANAINEQDPILIDFEVDENTNGDVEKDENNHEKTESNDVEIIMTDD 909
            S++   L    T  + A++    I         ++ D++        T+ +D+ +  T  
Sbjct: 871  SSEEHQLT---TSHSIALSSATSI---------SHSDID--------TQDHDISLNSTSY 910

Query: 910  ATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLI 969
            +  L     VA ++ D LE  LE+G QQDVTECI  VL+Q+E+GS P+  D DNEQ DL+
Sbjct: 911  SNRL-----VAMVTRDDLETTLEIGNQQDVTECINTVLYQVETGSMPLYLDADNEQMDLV 965

Query: 970  KQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLTMAEY 1029
            K+LFYG T Q I P+    K   K E + SLLVNI D P D+Y+  D YF DEY++M EY
Sbjct: 966  KELFYGETIQEICPIKKFIKGHEKRELYSSLLVNILDSPTDLYEVLDEYFADEYMSMEEY 1025

Query: 1030 GDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTDNLTLLA 1089
            G+VK+T+++T  PTIL +QIQRVYYD+E+ +P+K    LPFK  I++DRY       +  
Sbjct: 1026 GEVKKTLSITKLPTILNIQIQRVYYDKEKLVPYKCGTALPFKNEIFLDRY-------IKG 1078

Query: 1090 KKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVENTVLNIEDKKN 1149
             K+E + L++   ++K                    L  +K  E     N+V        
Sbjct: 1079 NKKENDVLEKARLELK--------------------LAKVKYRELVSEYNSV-------- 1110

Query: 1150 LIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYW 1209
                  NK   I + +++ Y  I  L   I  +     +  YSLF+VFIHRG+AS+GHYW
Sbjct: 1111 ------NK--SISDRIITTYDRIEELNAVIEEEVTKDAKIRYSLFAVFIHRGQASFGHYW 1162

Query: 1210 IYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATPYFLVYVKQGQEADIEPLKR 1267
            +YI+D  +NG+WRKYND  ++            G+ +TPYFL YV   +++ ++PL R
Sbjct: 1163 VYIRDF-ENGIWRKYNDHQVTGAHEDEIFKCVDGDISTPYFLAYVDSSKKSIVKPLVR 1219

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 66/153 (43%), Gaps = 41/153 (26%)

Query: 695 QFLILKAALTKISIERNSNLI---TNFLLTGTIDPN-------------SLPPE------ 732
           Q  ++K  LT  SI+  S +I   +N +L GT D N              L PE      
Sbjct: 43  QKYMVKGGLTDDSIKNLSEIIKPGSNIMLLGTPDANLVSKPKSQNHFIEDLTPEQQVQQF 102

Query: 733 -NWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGRE 791
            + P G  N+GNTCYLN+ LQ  + I  LR  +LN+  ++NN  +               
Sbjct: 103 NDIPIGFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINNDKN--------------- 147

Query: 792 ISEGEVERSIQFIHQLRNLFYAMVHSRERCVTP 824
              GE E  I+ + +L+  F  + +   + V P
Sbjct: 148 ---GENETHIKLVTELKRCFEGLKNKSFKSVMP 177

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y L  +  H+G  S  GHY  +I+D N   +W K+ND+ +S
Sbjct: 430  YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDKVS 470

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 49/113 (43%), Gaps = 26/113 (23%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISE 794
           P G+ N+GNTCY+NS LQ  + I PLR  ILN+Q    N            R G      
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNFQPPKEN------------RSG------ 146

Query: 795 GEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELA-----YLAFAPSNVEVEF 842
              E+ IQ + +L+  F  +    +   TP   LA     Y  FA  + E  F
Sbjct: 147 ---EQHIQLVAELKRCFQQLRDRPQESTTPILLLATLRKCYPQFAERDQESGF 196

 Score = 35.4 bits (80), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ +S
Sbjct: 426  YNLIGVITHQGANSESGHYQSFIRDEADENKWYRFNDDKVS 466

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 27/40 (67%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNF 774
           P G+ N+GNTCY+N+ LQ  + I PLR  ILN+ K   NF
Sbjct: 103 PIGLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNF 142

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 423  YDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFNDDKVS 463

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 21/97 (21%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISE 794
           P G+ N+GNTCY+NS LQ  + I PLR  +LNY                  +V   + SE
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNY------------------KVPREKPSE 100

Query: 795 GEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYL 831
              E+  Q + +LR  F  +    +  VTP   LA L
Sbjct: 101 ---EQHHQLVSELRRCFQQLKDKPQESVTPMLLLAML 134

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y+L  V  H+G  S  GHY  +I+D      W ++ND+ +S
Sbjct: 380  YNLIGVITHQGANSESGHYQSFIRDEVDENKWYRFNDDKVS 420

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKT 770
           P G+ N+GNTCYLN+ LQ  F I PLR  ILNY+++
Sbjct: 108 PIGLKNLGNTCYLNATLQCLFRIEPLREMILNYKQS 143

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y+L  +  H+G  S  GHY  +I+DR    +W K+ND+ ++
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVT 474

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 44/109 (40%), Gaps = 25/109 (22%)

Query: 716 TNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFN 775
           T FL   T     +  +  P G+ N+GNTCY N+ LQ  + I PLR  +L Y    N  N
Sbjct: 86  TKFLEDLTDKERLMQEDTIPMGLRNMGNTCYFNASLQALYRIKPLREKVLAY----NEPN 141

Query: 776 DHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTP 824
             L                       Q + QLRN F A    +E+  TP
Sbjct: 142 PDLHG---------------------QLVIQLRNCFNAFAQRKEKEFTP 169

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y+L  V  H+G  S  GHY  +++D      W KYND+ +
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYNDDKV 454

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 23/33 (69%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           P G  N+GNTCYLNS LQ  + I PLR  IL+Y
Sbjct: 107 PIGFQNMGNTCYLNSTLQALYRIKPLRELILSY 139

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVS 471

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 19/90 (21%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISE 794
           P GI N+GNTCY+N+ LQ  F I PLR  +L + +                    R I E
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVLEFDEK-------------------RAIKE 141

Query: 795 GEVERSIQFIHQLRNLFYAMVHSRERCVTP 824
           G      Q + +L+  F  +   +   +TP
Sbjct: 142 GVDTYHAQLVRELKVTFQKLKDRKGENITP 171

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 23/33 (69%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           P G  N+GNTCYLN+ LQ  + I PLR  IL+Y
Sbjct: 108 PIGFQNMGNTCYLNATLQALYRIEPLRDMILDY 140

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y L  V  H+G  S  GHY  +I+D      W  +ND+ +S
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDEDKWYNFNDDKVS 465

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 19/90 (21%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISE 794
           P GI N+GNTCY+N+ LQ  + I PLR  IL        F+D             +  +E
Sbjct: 59  PMGIVNMGNTCYMNATLQGLYGIVPLREQIL-------AFDDK------------KATAE 99

Query: 795 GEVERSIQFIHQLRNLFYAMVHSRERCVTP 824
           G     +Q I +++  F  +   +   +TP
Sbjct: 100 GMDLYHVQLIREIQATFRKLRDKKGEAITP 129

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y L  V  H+G  S  GHY  +++D   +  W K+ND+ ++
Sbjct: 377  YDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFNDDKVT 417

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 26/41 (63%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFN 775
           P G  N+GNTCY+NS LQ  F +  L+  ILNY+   NN +
Sbjct: 108 PIGFQNMGNTCYMNSTLQALFRVDVLKDMILNYKTEGNNIS 148

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y L  +  H+G  S  GHY  +I+D N    W K+ND+ +S
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVS 476

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 49/111 (44%), Gaps = 24/111 (21%)

Query: 689 NVYEPDQFLILKAALTKISIERNSNLI---TNFLLTGTIDPN-------------SLPPE 732
           +V +  Q  ++K  LT  S    S++I   +  +L GT D N              L P+
Sbjct: 38  HVPQERQKYMVKGGLTDKSASDLSSVIKAGSTVMLLGTPDANLITKPKTASHFIEDLSPD 97

Query: 733 N-------WPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQ-KTLNNFN 775
                    P G  N+GNTCYLN+ LQ  F +  LR  ILNY  K   N N
Sbjct: 98  QQVSRFNELPIGFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLN 148

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y+L  V  H+G  S  GHY  +I+D N   VW K+ND+ +S
Sbjct: 430  YNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKVS 470

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 23/96 (23%)

Query: 695 QFLILKAALTKISIERNSNLI---TNFLLTGTIDPN-------------SLPPENW---- 734
           Q  ++K  L+  S+   S++I   +N +L GT D +              L P+      
Sbjct: 43  QKYMVKGGLSDDSVSNLSSVIKAGSNVMLLGTPDADLISKPKGTNHFIEDLTPDQQMQKF 102

Query: 735 ---PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
              P G+ N+GNTCY+N+ LQ  F +  +R  ILNY
Sbjct: 103 DSNPIGLQNMGNTCYMNATLQALFRVDSIRDLILNY 138

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y+L  +  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVS 464

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRV 787
           P G  N+GNTCYLN+ LQ  + +  LR  ILNY  +    N+ + + E  +++
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLREMILNYNPSQGVSNNGVQDEETHKQI 160

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVS 470

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRV 787
           P G  N+GNTCYLN+ LQ  + +  LR  ILNY  +    N  + + E  +++
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASNSGVQDEETHKQI 160

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVS 470

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 7/70 (10%)

Query: 708 IERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL-- 765
           +E N + ++N  +      N L P +  TG+ N+GNTCY+NS LQ    +  LR Y L  
Sbjct: 338 VEGNHHWVSNHFVY-----NKLEPASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFLYN 392

Query: 766 NYQKTLNNFN 775
            Y+K +N  N
Sbjct: 393 GYEKEINEEN 402

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 43/96 (44%), Gaps = 23/96 (23%)

Query: 695 QFLILKAALTKISIERNSNLI---TNFLLTGTIDPN-------------SLPPENW---- 734
           Q  ++K  LT     + S+LI   T  +L GT D N              L PE      
Sbjct: 45  QKYMVKGGLTGEESIQISSLIKPGTTVMLLGTPDANLISKPAKKNNFIEDLAPEQQVQQF 104

Query: 735 ---PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
              P G  N+GNTCYLN+ LQ  + +  +R  ILNY
Sbjct: 105 AQSPVGFKNMGNTCYLNATLQALYRVDDVRDMILNY 140

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ ++
Sbjct: 431  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVT 471

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 48/101 (47%), Gaps = 23/101 (22%)

Query: 695 QFLILKAALTKISIERNSNLI---TNFLLTGTIDPN-------------SLPPEN----- 733
           Q  ++K  LT  +I   S++I   +  +L GT D +              L PE+     
Sbjct: 45  QKYMVKGGLTDNTISNLSSVIKPGSTVMLLGTPDADMISKPKESNKFIEDLAPEHQRQKF 104

Query: 734 --WPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLN 772
              P G+ N+GNTCY+NS LQ  + +  LR  +L Y++  N
Sbjct: 105 NQMPIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKEQAN 145

 Score = 36.2 bits (82), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 427  YDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFNDDKVS 467

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILN--YQKTLNNFNDHLSNSEHV 784
           N+L P     G+NN+GNTCY+NS LQ    I  LR Y L   ++K + N ++ L    HV
Sbjct: 333 NALTPSRGNIGLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEI-NLDNPLGYQGHV 391

Query: 785 RR 786
            R
Sbjct: 392 AR 393

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           P G  N+GNTCYLN+ LQ  + +  LR  ILNY
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVNDLRDMILNY 140

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y+L  V  H+G  S  GHY  +I+D      W K+ND+ +S
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVS 470

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 19/116 (16%)

Query: 710 RNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQK 769
           +N + ++N+ +      N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L    
Sbjct: 272 KNYHWLSNYFMY-----NQLTPSSGITGLYNLGNTCYMNSALQCLVHIPELRDYFL---- 322

Query: 770 TLNNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPS 825
             N F D ++ +  +         +G V R+  F   ++NLF     S    +TP+
Sbjct: 323 -YNCFEDEINCNNPLGY-------QGYVARA--FSGLVQNLFGCKTLSSGSTLTPA 368

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL 765
           N+L P    TG+ N+GNTCY+NS LQ    I  LR Y L
Sbjct: 293 NTLQPSQGITGLTNLGNTCYMNSALQCLVHIPELRDYFL 331

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTLNNFN 775
           N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L   Y+  +N  N
Sbjct: 355 NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEEN 405

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 708 IERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL-- 765
           IE N +  +N+        N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L  
Sbjct: 341 IEGNHHWPSNYFAY-----NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYD 395

Query: 766 NYQKTLNNFN 775
            Y+  +N  N
Sbjct: 396 GYEDEINEEN 405

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTLNNFNDHLSNSEHV 784
           N + P N   G+ N+GNTCY+NS LQ    I   + Y L   Y+K + N ++ L +  H+
Sbjct: 340 NQMTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEI-NVDNPLGHKGHI 398

Query: 785 RRVGGREI 792
               G  I
Sbjct: 399 AWAFGTLI 406

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTLNNFN 775
           N L P +  TG+ N+GNTCY+NS LQ    I  LR Y L   Y+  +N  N
Sbjct: 355 NKLEPGSGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEEN 405

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 42/96 (43%), Gaps = 23/96 (23%)

Query: 695 QFLILKAALTKISIERNSNLI---TNFLLTGTIDPNSL--PPE----------------- 732
           Q  ++K  L+  SI     +I   +  +L GT D N L  P E                 
Sbjct: 45  QKFMVKGGLSDDSIANLQTIIKPGSTVMLLGTPDANLLSKPAEKHRFVEDLSPDQQVQQF 104

Query: 733 -NWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
            + P G+ N+GNTCYLN+ LQ  F    L+  IL Y
Sbjct: 105 NSTPLGLQNMGNTCYLNATLQALFRADELKDLILQY 140

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y L  V  H+G  S  GHY  +I+D +    W K+ND+ +S
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVS 466

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 49/108 (45%), Gaps = 8/108 (7%)

Query: 710 RNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL--NY 767
           +N + ++N+ +      N L P    TG+ N+GNTCY+NS LQ    I   R Y L   Y
Sbjct: 300 KNYHWLSNYFIY-----NDLVPSLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGY 354

Query: 768 QKTLNNFNDHLSNSEHVRRVGGREISEGEVERSIQFIHQLRNLFYAMV 815
           +K LN  N  L    HV       I     ++ +QF     N F A +
Sbjct: 355 EKELNTDNP-LGYQGHVAEAFSELIRCLFGDKLVQFSAYAPNHFKATI 401

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 3/52 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN--YQKTLNNFND-HLSNSEHV 784
           +G+ N+GNTCY+NS+LQ  F+    R+  L+  Y++ +    D HLSNS H+
Sbjct: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDPHLSNSFHI 497

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 7/71 (9%)

Query: 707 SIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL- 765
            +E++ + ++N+        N L P +   G++N+GN+CY+NS LQ    I  LR Y L 
Sbjct: 274 GVEKDQHWLSNYYYY-----NKLSPPSGIVGLSNLGNSCYMNSALQCLVHIPELRDYFLY 328

Query: 766 -NYQKTLNNFN 775
             +++ +N  N
Sbjct: 329 GGFEQDINTSN 339

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 10/125 (8%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            + +LF G  K  I  ++  D   ++VE F  + +N+ +  K + ++FD+Y   E +    
Sbjct: 308  LNELFVGKMKSYIRCINV-DYESSRVEDFWDIQLNVKN-LKGVQESFDNYVEVEIMDGEN 365

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1080
                 +YG  D K+ V   +FP++L +Q++R  YD       K  +   F E I +  Y 
Sbjct: 366  QYAAQDYGLQDAKKGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYL 425

Query: 1081 DTDNL 1085
            D D L
Sbjct: 426  DPDVL 430

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYI 764
           G+ N G TCYLNSLLQ YF     R  +
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV 230

 Score = 32.7 bits (73), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y+L  V +H GE S GHY+  IK  +    W +++D+ +
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKP-DVGDQWFRFDDDKV 476

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTLNNFN 775
           N L P    TG++N+GN+CY+NS LQ    I  L+ Y L   Y++ +N  N
Sbjct: 325 NKLLPPRGTTGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQN 375

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 23/31 (74%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G+ N GNTCY NS+LQ  F+++ LR+ IL Y
Sbjct: 134 GLENFGNTCYCNSVLQCLFNLSELRTNILMY 164

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  ++++PLR  IL +
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSPLRENILQF 171

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSY 763
            G+NN+GNTCY+NS LQ    I P+R Y
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDY 425

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 60/125 (48%), Gaps = 10/125 (8%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            + ++F G  K  I  ++  D   ++VE F  L +N+ +  K++ ++FD+Y   E +    
Sbjct: 311  LNEIFVGRMKSYIKCINV-DYESSRVEDFWDLQMNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1080
                 +YG  D ++ V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFV 428

Query: 1081 DTDNL 1085
            D D L
Sbjct: 429  DKDVL 433

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 26/110 (23%)

Query: 1184 DDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXG 1243
            D+   Y Y+L  V +H G+ S GHY+  IK   ++  W +++DE +             G
Sbjct: 441  DNGNPYIYNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFG 499

Query: 1244 NTATP-----------------------YFLVYVKQGQEADIEPLKRILE 1270
                P                       Y LVY++Q QE D+  L+ ++E
Sbjct: 500  CDRLPDEKVRTMTRDDYQNYIIQRHTSAYMLVYIRQDQEQDL--LRPVVE 547

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            YSL SV +H G  +YGHY  + K R   GVW + +DET+
Sbjct: 722  YSLRSVIVHYGTHNYGHYIAFRKYR---GVWWRISDETV 757

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 735 PTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQ 768
           P G  N+GNTCY+N+ LQ  +    +R  IL+Y+
Sbjct: 110 PIGFQNMGNTCYMNATLQALYRTDDIRQMILDYK 143

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 1191 YSLFSVFIHRGEAS-YGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y+L  +  H+G  S  GHY  +++D N    W K+ND+ ++
Sbjct: 433  YNLIGIITHQGANSESGHYQAFMRDENDENKWYKFNDDKVT 473

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 53/128 (41%), Gaps = 26/128 (20%)

Query: 1166 MSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYN 1225
            +S + D + L+  +  +  D   Y Y+L  V +H G+ S GHY+  IK   ++  W +++
Sbjct: 424  LSPFVDKDVLKKTLDSENKDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFD 482

Query: 1226 DETISXXXXXXXXXXXXGNTATP-----------------------YFLVYVKQGQEADI 1262
            DE +             G    P                       Y LVY++Q QE D+
Sbjct: 483  DERVWRVTKKQVFQENFGCDRLPDEKVRTMTRGEYQNYIIQRHTSAYMLVYIRQEQEEDL 542

Query: 1263 EPLKRILE 1270
              L+ +LE
Sbjct: 543  --LRPVLE 548

 Score = 40.4 bits (93), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 10/125 (8%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            + ++F G  K  I  ++  D    +VE F  L +N+ +  K++ ++FD+Y   E +    
Sbjct: 311  LNEIFVGKMKSYIKCINV-DYESARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1080
                 +YG  D ++ V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFV 428

Query: 1081 DTDNL 1085
            D D L
Sbjct: 429  DKDVL 433

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN--YQKTLN 772
           TG+ N+GNTCY+NS+LQ  F  +  R   L   Y + LN
Sbjct: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN 626

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 7/69 (10%)

Query: 709 ERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL--N 766
           +++S+  +NFL+      N+L       G+ N+GNTCY+NS LQ    I   R Y L   
Sbjct: 308 QKSSHWPSNFLIY-----NNLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFLYGT 362

Query: 767 YQKTLNNFN 775
           +QK +N  N
Sbjct: 363 FQKEVNEGN 371

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 40.4 bits (93), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 88/218 (40%), Gaps = 27/218 (12%)

Query: 872  PIL-IDFEVDENTNGDVEKDENNHEKTESNDVEIIMTDDATDLASPTRVAKISSDQLENA 930
            PIL ID  +D N N    +D N +   +     II     T + SPT   ++   + EN 
Sbjct: 450  PILNIDHLLDNNNNK--TRDSNLYNGLKDIFECIIENKFLTGVVSPTEFVQLL--KKENV 505

Query: 931  L-EMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYD-LIKQLFYGTTKQCIVPLSATD 988
            L +    QD  E      F I   S+ I+ D  N Q D  I + F G     I  LS  D
Sbjct: 506  LFDTMMHQDAHEFFN---FLINQLSDYIQTDCANPQDDNFINESFQGILTNRIKCLSC-D 561

Query: 989  KVRTKVERFLSLLVNIGDHPK--DIYDAFDSYFRDEYL---------TMAEYGDVKRTVA 1037
             V ++ E FL   + + +H +  DI     SY + E L               + +RTV 
Sbjct: 562  NVTSRDEPFLDFPIEVQEHKEFTDISTILKSYHQKEMLGGHNKFYCSQCCTLQEAQRTVG 621

Query: 1038 VTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIY 1075
            +   P  L + ++R  Y  E F   K      F +++Y
Sbjct: 622  LKKLPNTLALHLKRFKYSEEHFTNIKL-----FNKIVY 654

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRR 786
           N L P +   G+ N+G+TC++NS+LQ    I  LR Y L      N F   L N+ +   
Sbjct: 342 NRLSPSSGTMGLANLGSTCHINSVLQCLTHITELRDYFL-----YNGFAAEL-NTRNSLG 395

Query: 787 VGGR 790
            GGR
Sbjct: 396 YGGR 399

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122W UBP1 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions irrespective of their size
            capable of cleaving polyubiquitin chains
          Length = 791

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 708  YSLRSVIVHYGTHNYGHYIAFRKHR---GFWWRISDETV 743

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 40.0 bits (92), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (72%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQ 768
           TG+ N+GNTCY+NS+LQ  F+    R+  L+++
Sbjct: 753 TGLRNLGNTCYINSMLQCLFATTEFRNIFLSHK 785

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 39.7 bits (91), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 46/115 (40%), Gaps = 24/115 (20%)

Query: 1171 DINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETIS 1230
            D++S  DK+  +  +     Y L  V +H G+ S GHY+  IK   ++  W +++DE + 
Sbjct: 411  DVSSYIDKMGTEDTEMPPCIYKLHGVLVHAGDISTGHYYAMIKPSTEDQ-WYRFDDEKVW 469

Query: 1231 XXXXXXXXXXXXGNTATP-----------------------YFLVYVKQGQEADI 1262
                        G    P                       Y LVY+++ QEAD+
Sbjct: 470  KVTKTQVFDENFGLDRIPDDEVRLMSREQYQNYLLARHTSAYMLVYIREDQEADL 524

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 10/97 (10%)

Query: 967  DLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL-- 1024
            D + ++F G  K  I  ++  D   ++VE F  L +N+ +  KD+  +F++Y   E +  
Sbjct: 297  DKLNEIFVGRMKSYIKCINV-DYESSRVEEFWDLQMNVKN-LKDLKSSFENYIEIELMNG 354

Query: 1025 ----TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYD 1055
                   +YG  D ++ V   +FP +L +Q++R  YD
Sbjct: 355  ENQYAAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 391

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 16/29 (55%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYI 764
            G  N G TCYLNSLLQ YF     R  +
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLV 221

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 39.7 bits (91), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 7/54 (12%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTLN-----NFNDHLSNSEH 783
           G++N+GNTCY+NS LQ    I  +R Y +   ++K +N      F  H++ S H
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEINVNNPLGFQGHMARSFH 375

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score = 39.7 bits (91), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y+L SV +H G  +YGHY  Y K R   GVW + +DE++
Sbjct: 689  YALRSVIVHYGTHNYGHYIAYRKFR---GVWWRISDESV 724

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL122W
            (UBP1)
          Length = 775

 Score = 39.7 bits (91), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 3/38 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDET 1228
            YSL SV +H G  +YGHY  + K R   GVW + +DET
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAFRKFR---GVWWRISDET 708

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 39.7 bits (91), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTLNNFN 775
           G++N+GNTCY+NS LQ    I  LR Y L   Y+  LN  N
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDN 364

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 39.3 bits (90), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 644  YSLRSVIVHYGTHNYGHYIAFRKFR---GCWWRISDETV 679

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 710 RNSNLITNFL-LTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYI 764
           +N+N+   ++   G ID   L    +  G+ N GNTC++NS+LQ   S   L +++
Sbjct: 64  KNNNMFRRWIPRAGNIDDKILKKGGFVGGLVNDGNTCFMNSVLQSLASSKELNAFL 119

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
            YDL122W
          Length = 764

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETIS 1230
            YSL SV +H G  +YGHY  + K R   G W + +DET+ 
Sbjct: 624  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETVG 660

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 39.7 bits (91), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 11/122 (9%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            I +LF G  K CI  ++  D   ++VE F  + +N+ D  K++ ++F+ Y   E +    
Sbjct: 303  INELFVGKMKSCIKCINV-DYESSRVEDFWDIQLNVKDM-KNLQESFEQYIEVELMNGEN 360

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1080
                 ++G  D ++ V   +FP +L +Q++R  YD       K  +   F E I +  Y 
Sbjct: 361  QYAAQDHGLQDAQK-VVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYL 419

Query: 1081 DT 1082
            D+
Sbjct: 420  DS 421

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y L  V +H G+ S GHY+  I+  + +G W +++D+ +
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQP-DAHGSWYRFDDDRV 468

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 39.3 bits (90), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 682  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETV 717

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 39.3 bits (90), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 43/105 (40%), Gaps = 26/105 (24%)

Query: 1189 YGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATP 1248
            Y Y+L  V +H G+ S GHY+  IK   ++  W +++DE +             G    P
Sbjct: 447  YVYNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLP 505

Query: 1249 -----------------------YFLVYVKQGQEADIEPLKRILE 1270
                                   Y LVY++Q QE D+  L+ +LE
Sbjct: 506  DEKVRTMTREDYQNYIIQRHTSAYMLVYIRQEQEEDL--LRPVLE 548

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 10/125 (8%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            + ++F G  K  I  ++  D    +VE F  L +N+ +  K++ ++FD+Y   E +    
Sbjct: 311  LSEIFVGKMKSYIKCVNV-DYESARVEDFWDLQLNVKNF-KNLQESFDNYIEMELMNGEN 368

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1080
                 +YG  D ++ V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFV 428

Query: 1081 DTDNL 1085
            D + L
Sbjct: 429  DKEVL 433

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
            UBP1Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; cleaves at the C terminus of
            ubiquitin fusions irrespective of their size; capable of
            cleaving polyubiquitin chains
          Length = 809

 Score = 38.9 bits (89), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 681  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETV 716

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 38.9 bits (89), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 685  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETV 720

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
            (REAL)
          Length = 787

 Score = 38.9 bits (89), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 683  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETV 718

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNYQK 769
           G  N GNTCY NS+LQ  ++++ LR  IL + K
Sbjct: 141 GYENFGNTCYCNSVLQCLYNLSSLRENILQFPK 173

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTLN 772
           G++N+GNTCY+NS LQ    I   + Y L   Y+K +N
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVN 384

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y+L SV +H G  +YGHY  + K R   G+W + +DET+
Sbjct: 678  YALRSVIVHYGSHNYGHYIAFRKFR---GLWWRISDETV 713

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            YSL SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 577  YSLRSVIVHYGTHNYGHYIAFRKYR---GYWWRISDETV 612

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 10/96 (10%)

Query: 968  LIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYLT-- 1025
            ++ ++F G  K  I  +   D   ++VE F  L +N+ +  K + ++FD+Y   E L   
Sbjct: 308  MLNEIFVGKMKSYIKCIDV-DYESSRVEDFWDLQLNVKNM-KGLKESFDNYIEIELLNGE 365

Query: 1026 ----MAEYG--DVKRTVAVTTFPTILQVQIQRVYYD 1055
                  +YG  D ++ V   +FP +L +Q++R  YD
Sbjct: 366  NQYQAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 401

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE +
Sbjct: 439  YNLHGVLVHAGDISTGHYYTLIKPGLEDQ-WYRFDDERV 476

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 16/93 (17%)

Query: 694 DQFLILKAALTKISIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQY 753
           DQ L L+   +  +IE++SN   +  +TG               + N+GNTCY+NS+LQ 
Sbjct: 581 DQRLSLQRHYSIPTIEKSSNTYVSLSITG---------------LRNLGNTCYINSMLQC 625

Query: 754 YFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRR 786
            F+    R   ++  K    FN + SN   + +
Sbjct: 626 LFATTKFRDLFVS-GKFEEFFNQNYSNRPQLSK 657

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 51/128 (39%), Gaps = 26/128 (20%)

Query: 1166 MSLYSDINSLEDKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYN 1225
            +S + D + L   +     D   Y Y+L  V +H G+ S GHY+  IK   ++  W +++
Sbjct: 424  LSPFVDKDVLRKTLDSGDKDKNPYIYNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFD 482

Query: 1226 DETISXXXXXXXXXXXXGNTATP-----------------------YFLVYVKQGQEADI 1262
            DE +             G    P                       Y LVY++Q QE D+
Sbjct: 483  DERVWRVTKKQVFQENFGCDRLPDEKVRTMTRDDYQNYIIQRHTSAYMLVYIRQEQEQDL 542

Query: 1263 EPLKRILE 1270
              L+ +LE
Sbjct: 543  --LRPVLE 548

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 10/125 (8%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            + ++F G  K  I  ++  D    +VE F  L +N+ +  +++  +FD+Y   E +    
Sbjct: 311  LNEIFVGKMKSYIKCINV-DYESARVEDFWDLQLNVKNF-ENLQGSFDNYIEMELMNGEN 368

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1080
                 +YG  D ++ V   +FP +L +Q++R  YD       K  +   F E I +  + 
Sbjct: 369  QYAAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFV 428

Query: 1081 DTDNL 1085
            D D L
Sbjct: 429  DKDVL 433

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
            Anc_3.270 YBR058C
          Length = 765

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 14/96 (14%)

Query: 1146 DKKNLIKTLKNKVTDIDNELMSLYS---DINSLEDKISHQ--FDDFKEYG------YSLF 1194
            D K   K L   + D+ + +  ++S   D  SLE + + Q   +  +++G      Y L+
Sbjct: 651  DAKLCRKALLQYLNDVASSVEWVFSHPDDDGSLETETAPQDTANAARKFGHPGGSIYKLY 710

Query: 1195 SVFIHRGEASY-GHYWIYIKDRNQNGVWRKYNDETI 1229
             +  H+G ++  GHY  YI+ R+  G W  YNDE I
Sbjct: 711  GIVCHKGNSTQSGHYVAYIRQRD--GQWTLYNDEKI 744

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 5/56 (8%)

Query: 703 LTKISIERNSNLITNFLLTGTIDPNSL---PPENWPTGINNIGNTCYLNSLLQYYF 755
           LT++ +E+N N   +F +T       +   P +    G+ N+GN+CYLNS+LQ  F
Sbjct: 286 LTELQVEQNMNW--DFQMTDESGHELVKLNPSKEVGCGLINMGNSCYLNSVLQCLF 339

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y+L SV +H G  +YGHY  + K R   G+W + +DET+
Sbjct: 679  YALRSVIVHYGTHNYGHYIAFRKFR---GLWWRISDETV 714

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
            (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETIS 1230
            YSL SV +H G  +YGHY  + K R   G W + +DE+++
Sbjct: 687  YSLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDESVT 723

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  +++  LR ++L Y
Sbjct: 144 GYENFGNTCYCNSVLQVLYNLPELRVHLLEY 174

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 2/68 (2%)

Query: 700 KAALTKISIERNSNLITNFLLTGTIDPNSLPPENWP-TGINNIGNTCYLNSLLQYYFSIA 758
           K  +  +   RN  L   F +  TI+ NS P   +  TG+ N+GNTCY+N +LQ  F+  
Sbjct: 612 KLPIHALHSPRNQTLTRKFSIP-TIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATN 670

Query: 759 PLRSYILN 766
            L++  ++
Sbjct: 671 ELKNLFIS 678

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN 766
           TG+ N+GNTCY+NS+LQ  F+    R   L+
Sbjct: 556 TGLRNMGNTCYINSMLQCLFATRKFRDLFLS 586

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
           (REAL)
          Length = 748

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  ++I+  R  +L Y
Sbjct: 127 GYENFGNTCYCNSVLQCLYNISEFRCNVLRY 157

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%), Gaps = 3/49 (6%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN--YQKTLNNFN-DHLSNS 781
           TG+ N+ NTCY+NS+LQ  FS    R+  L+  Y + L + N D++S S
Sbjct: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRS 794

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 703 LTKISIERNSNLITNFLLTGTIDPNSLPP-ENWPTGINNIGNTCYLNSLLQYYFSIA 758
           L ++ +E+N N     + +   +   LP  + +  G+NN+GN+CY+NS+LQ  F+ A
Sbjct: 279 LVELQVEQNMNWDFQMVDSKGNELKHLPASKEYGCGLNNLGNSCYMNSVLQVLFNGA 335

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 727 NSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTLN 772
           N L P     G+ N+GNTCY+NS LQ    +     Y L   YQK +N
Sbjct: 405 NYLVPSTGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEIN 452

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 5/63 (7%)

Query: 697 LILKAALTKISIERNSNLITNFLLTGTIDPNSL---PPENWPTGINNIGNTCYLNSLLQY 753
           L  +  LT++ +E+N N   +F +T +     +   P  N+  G+ N+GN+CYLNS+LQ 
Sbjct: 279 LATEKTLTELQVEQNLNW--DFKMTDSAGHELIKLEPNGNFGCGLINLGNSCYLNSILQA 336

Query: 754 YFS 756
            F+
Sbjct: 337 LFA 339

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 736  TGINNIGNTCYLNSLLQYYFSIAPLRSYILN 766
            TG+ N+ NTCY+NS+LQ  FS +  R+  L+
Sbjct: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
           (REAL)
          Length = 749

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  ++I   R  IL Y
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNILQY 165

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 733 NWPTGI---NNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTLNNFNDHLSNSEHVRRV 787
           N P+GI   +N+GNTCY+NS LQ    I  L  Y L   Y++ + N N+ L +   V   
Sbjct: 333 NAPSGIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREI-NINNPLGHKGDVAHA 391

Query: 788 GGR 790
            G 
Sbjct: 392 FGH 394

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  F++   R+ IL +
Sbjct: 115 GYENFGNTCYCNSILQCLFNLTEFRNSILQF 145

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            YSL SV +H G  +YGHY  +   R   G W + +DET+
Sbjct: 654  YSLRSVVVHYGTHNYGHYIAF---RRYRGYWWRISDETV 689

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G+ N GNTCY NS+LQ  +++  LR  +L Y
Sbjct: 100 GLENYGNTCYCNSVLQCLYNLKELRVNVLKY 130

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISEG 795
           G  N GNTCY NS+LQ  ++ + LR  ++ Y +      +   NS  ++ V G E ++G
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILYPEEAKFDPEQFDNSISIKNVIGDEENQG 186

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYIL 765
           TG+ N+GNTCY+NS+LQ  F+    R   L
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATRRFRDLFL 637

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 10/123 (8%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            +  LF G  K  I  ++  D    +VE F  + +N+ +  KD+ ++F++Y   E +    
Sbjct: 308  LNDLFVGKMKSYIRCVNV-DYESFRVEDFWDIQLNVKN-LKDVKESFENYVEVEMMDGEN 365

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1080
                 +YG  D K+ V   +FP +L +Q++R  YD       K  +   F E I +  Y 
Sbjct: 366  QYAAQDYGLQDAKKGVVFESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPYL 425

Query: 1081 DTD 1083
            D D
Sbjct: 426  DPD 428

 Score = 35.8 bits (81), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 20/75 (26%)

Query: 710 RNSNLITNFLLTGTI----------DPNSLPPENWPT----------GINNIGNTCYLNS 749
           RNS+  + FL+ G++          DP  +   N+            G  N G TCYLNS
Sbjct: 156 RNSSRNSGFLVNGSLNVSVFIRILKDPTGVLWHNFMNYDSKKLTGYIGFKNQGATCYLNS 215

Query: 750 LLQYYFSIAPLRSYI 764
           LLQ YF     R  +
Sbjct: 216 LLQSYFFTKLFRKMV 230

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y+L  V +H G+ S GHY+  IK  N    W +++D+ +
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKP-NVTDQWFRFDDDKV 476

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 17/67 (25%)

Query: 707 SIERNSNLITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL- 765
           +IERN N+  +  +TG               + N+GNTCY+NS++Q  F+    R+  + 
Sbjct: 584 TIERNPNVYVSLSITG---------------LRNLGNTCYINSMIQCLFAAKTFRTLFIS 628

Query: 766 -NYQKTL 771
            NY+  L
Sbjct: 629 SNYKNYL 635

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
           carboxyl-terminal hydrolase, ubiquitin-specific protease
           that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  ++I   R  +L Y
Sbjct: 135 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 165

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
           (REAL)
          Length = 754

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  ++I   R  +L Y
Sbjct: 137 GYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 167

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
            YDL122W
          Length = 782

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            YSL SV +H G  +YGHY  +   R   G W + +DE++
Sbjct: 674  YSLRSVIVHYGTHNYGHYIAF---RRYRGCWWRISDESV 709

 Score = 32.3 bits (72), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 46/89 (51%), Gaps = 6/89 (6%)

Query: 703 LTKISIERNSNLITNFLLT-GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLR 761
           +  +S  RN++ +  FL +  ++D   L       G+ N GNTC++NS+LQ   S+A  R
Sbjct: 52  MNNLSSIRNNSTLNRFLPSYNSMDDTILKRGGHIAGLVNDGNTCFMNSVLQ---SLASSR 108

Query: 762 SYI--LNYQKTLNNFNDHLSNSEHVRRVG 788
           + +  L+ +   +   D  +  E+ + VG
Sbjct: 109 TLVEFLDEEIVNSQLKDDETEGENEKEVG 137

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 10/125 (8%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            + ++F G  K  I  ++  D    + E F  + +N+ +  K + D+F++Y   E +    
Sbjct: 309  LNEIFVGKMKSFIKCINV-DYESARTEDFWDIQMNVKNL-KGLKDSFENYIEVELMDGEN 366

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1080
                 +YG  D K+ V   +FP +L +Q++R  YD       K  +   F E I +  Y 
Sbjct: 367  QYAAQDYGLQDAKKGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYM 426

Query: 1081 DTDNL 1085
            D D L
Sbjct: 427  DKDVL 431

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 16/29 (55%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYI 764
            G  N G TCYLNSLLQ YF     R  +
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV 231

 Score = 32.3 bits (72), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y L  V +H G+ S GHY+  IK   ++  W +++DE +
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLEDQ-WYRFDDERV 477

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 720 LTGTIDPNSLP---PENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           +  TI   S+P     N   G  N GNTCY NS+LQ  ++++ LR  IL +
Sbjct: 122 ILATIASESMPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLSSLRENILQF 172

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y L SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 672  YELRSVIVHYGTHNYGHYIAFRKYR---GTWWRISDETV 707

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY++S+LQ  F+   LR
Sbjct: 625 TGLRNLGNTCYISSMLQCLFATTTLR 650

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ +F+ +  R+ +L++
Sbjct: 128 GYENFGNTCYCNSILQCFFNHSVFRTSMLSF 158

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 30/76 (39%), Gaps = 3/76 (3%)

Query: 1179 ISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXX 1237
            +S  FD      Y L S  IH G+   YGHY    K   +   W  ++DET+        
Sbjct: 547  VSSTFDSKLSKRYELASAVIHLGDGPQYGHYISLCK--TETFGWLLFDDETVEAVDEQTV 604

Query: 1238 XXXXXGNTATPYFLVY 1253
                  N+ T Y L Y
Sbjct: 605  LSFTGENSDTAYVLFY 620

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  +++   R+ IL Y
Sbjct: 116 GYENFGNTCYCNSVLQCLYNLTEFRTEILKY 146

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (69%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQ 768
           TG+ N+GNTCY+NS++Q  F+    R+  ++ +
Sbjct: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMK 723

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYIL 765
           GI N+GNTCY+NS+LQ  F     R   L
Sbjct: 214 GIRNMGNTCYMNSMLQCLFGSTQFRDLFL 242

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  ++I  LR  ++ Y
Sbjct: 113 GYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 22/31 (70%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN 766
           TG+ N+GNTCY+NS++Q  F+    R+  ++
Sbjct: 609 TGLRNLGNTCYINSMIQCLFAAKTFRTLFIS 639

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y L SV +H G  +YGHY  + K R   G W + +DET+
Sbjct: 658  YVLRSVIVHYGTHNYGHYIAFRKYR---GCWWRISDETV 693

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 722 GTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYI 764
           G +D ++L    +  G+ N GNTC++NS++Q   S A L  ++
Sbjct: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTLN 772
           G++N+GNTCY+NS LQ    I  LR Y     Y++ +N
Sbjct: 290 GLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEIN 327

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTL 771
           TG+ N+GNTCY+NS++Q  F+    R+  +  NY+  L
Sbjct: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYL 638

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 37.4 bits (85), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  +++  LR+ IL +
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNILQF 547

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 22/31 (70%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN 766
           TG+ N+GNTCY+NS++Q  F+    R+  ++
Sbjct: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFIS 632

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN 766
           TG+ NIG TCY+NS+LQ  F+    R   L+
Sbjct: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLS 586

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 37.0 bits (84), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 54/121 (44%), Gaps = 24/121 (19%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISEG 795
           TG+ N+G+TCY+NS+LQ  F+    R   L+       ++D+              IS+G
Sbjct: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS-----PKYHDY--------------ISKG 653

Query: 796 EVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYLAFAPSNVEVEFEVEGNKESNDATI 855
            + R+ Q       LF  M  +    V PS  L     A +++  +F++  +++     +
Sbjct: 654 YIHRA-QISRSFHMLFKKMYMNGGCSVVPSGFLK----ACNSMRPDFKIPNDQQDTQEFL 708

Query: 856 L 856
           L
Sbjct: 709 L 709

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLN 772
           G  N GNTCY NS+LQ  ++++ +R  IL + +  N
Sbjct: 142 GYENFGNTCYCNSVLQCLYNLSSVRENILQFPEKPN 177

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 61/135 (45%), Gaps = 13/135 (9%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            + +LF G  K  I      D   ++VE F  + +N+ D  K++  +F++Y   E +    
Sbjct: 315  LSELFVGKMKSYI-KCKNVDYESSRVEEFWDIQLNVKD-LKNLQQSFENYIEVELMDGEN 372

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYA 1080
                 ++G  D  + V   +FP +L +Q++R  YD       K  +   F + I +  Y 
Sbjct: 373  QYAAPDFGLQDAYKGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYL 432

Query: 1081 DTDNLTLLAKKEETE 1095
            D D   +L  + ETE
Sbjct: 433  DKD---VLKNENETE 444

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 36.6 bits (83), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  +++  LR  +L Y
Sbjct: 138 GYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 36.6 bits (83), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
           TG+ N+GNTCY+NS+LQ  F+    R
Sbjct: 678 TGLRNLGNTCYINSMLQCLFATRLFR 703

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 36.2 bits (82), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y L  +  HRG  + GHY  Y K    +GVW ++ND  +
Sbjct: 423  YELTGIVTHRGTVNEGHYITYTK--TADGVWYQFNDSVV 459

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 58/132 (43%), Gaps = 33/132 (25%)

Query: 624 ALYTIAISKRSLDLFNFLTDECPQFQNYYGPEKLDYQEALKLLQVN--ENASDETILKIF 681
           A+   ++S  + DL+ +  D+  +F     P+ ++   ALK+  +N  E  +DE      
Sbjct: 238 AIKLGSLSSSTCDLYCYACDDETRF-----PDNVNLGSALKIYGINIQEKIADE------ 286

Query: 682 KGKWFDENVYEPDQFLILKAALTKISIERNSNLITNFLLTGTIDPNSLPPEN-WPTGINN 740
                                L ++ IE+N N     + +   +   LP  N +  G+ N
Sbjct: 287 -------------------KTLVQLQIEQNENWQFKMVDSSGKELKKLPASNEYGCGLIN 327

Query: 741 IGNTCYLNSLLQ 752
           +GN+CYLNS++Q
Sbjct: 328 LGNSCYLNSVMQ 339

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 8/66 (12%)

Query: 1191 YSLFSVFIHRGEA-SYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATPY 1249
            Y L SV +H G + S GHY  +   R  +G W  Y+DE I+                  Y
Sbjct: 761  YQLLSVVVHEGRSLSSGHYIAHC--RQPDGTWATYDDELINKISELKLLTEPNA-----Y 813

Query: 1250 FLVYVK 1255
            +LVY +
Sbjct: 814  YLVYTR 819

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
           Anc_7.390
          Length = 717

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  +++   R  IL Y
Sbjct: 127 GYENFGNTCYCNSVLQCLYNLPEFRLNILQY 157

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 48/116 (41%), Gaps = 11/116 (9%)

Query: 958  RYDEDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHP-KDIYDAFD 1016
            R D DN+  + I ++F GT    +  L+  D V ++ E FL L + + ++   DI     
Sbjct: 426  RLDRDNQAKNFINEIFQGTLTNKVRCLTC-DNVTSREEAFLDLPIEVKENGDTDIQRVLK 484

Query: 1017 SYFRDEYLT---------MAEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFK 1063
             Y + E L               + +R V +   P  L + ++R  Y  ++    K
Sbjct: 485  YYSQREMLNGSNKFNCSQCCALQEAERAVELKKLPDTLILHLKRFKYSEQQLSNIK 540

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 33/78 (42%), Gaps = 5/78 (6%)

Query: 1179 ISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXX 1237
            IS  FDD     Y L S+ +H GE+   GHY    K ++    W  Y+DET+        
Sbjct: 575  ISSVFDDSISKKYELNSIVVHIGESPQLGHYVTLCKHKSYG--WLIYDDETVQAVSDELV 632

Query: 1238 XXXXXG--NTATPYFLVY 1253
                     +AT Y L Y
Sbjct: 633  SRILNNEQRSATAYLLFY 650

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYIL 765
           G  N G TCY NS+LQ  F+I   R  I+
Sbjct: 107 GFQNFGYTCYCNSILQALFNIGSFRDGII 135

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 5/63 (7%)

Query: 697 LILKAALTKISIERNSNLITNFLLTGTIDPNSL---PPENWPTGINNIGNTCYLNSLLQY 753
           L  +  L ++ +E+N N   +F +T +   + L   P +    G+ N+GN+CYLNS+LQ 
Sbjct: 283 LASEKTLVELQVEQNMNW--DFQMTDSAGKDLLKLKPDQEHGCGLINLGNSCYLNSVLQC 340

Query: 754 YFS 756
            F+
Sbjct: 341 LFN 343

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  +++   R  +L Y
Sbjct: 147 GYENFGNTCYCNSVLQCLYNLTEFRLNVLQY 177

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLN 772
           G+ N GNTCY NS+LQ  +++   R  IL    +++
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENILGLTPSID 167

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYI--LNYQKTLN 772
           TG+ N+G TCY+NS+LQ  F+    R      NY++  N
Sbjct: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFN 637

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  +++   R+ +L Y
Sbjct: 151 GYENFGNTCYCNSVLQCLYNLPEFRNDMLRY 181

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  +++  LR  +L +
Sbjct: 144 GYENFGNTCYCNSVLQVIYNLPELRVNLLEF 174

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 10/75 (13%)

Query: 733 NWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLS-NSEHVRRVGGRE 791
           N+  G+ N+GN+CY+N +LQ       L    LN     N++  H++ NS    ++G + 
Sbjct: 580 NFTVGLENMGNSCYMNCILQCIMGTNELSQIFLN-----NSYEKHININS----KLGSKG 630

Query: 792 ISEGEVERSIQFIHQ 806
           +      R    +HQ
Sbjct: 631 VLARYFARLAHIMHQ 645

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYIL 765
           TG+ N  NTCY+NS++Q  F   P R   L
Sbjct: 292 TGLQNPCNTCYINSIIQCLFGSTPFRDLFL 321

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 56/122 (45%), Gaps = 10/122 (8%)

Query: 972  LFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL------T 1025
            +F G  K  I  ++  D   ++VE F  + +N+    + + +AF++Y   E +       
Sbjct: 368  VFVGKMKSYIKCVN-IDYESSRVEDFWDIQLNVKG-LEGLANAFENYIEVELMDGENQYA 425

Query: 1026 MAEYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRYADTD 1083
              +YG  D K+ V   +FP +L +Q++R  YD       K  +   F E I +  Y D +
Sbjct: 426  AQDYGLQDAKKGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKE 485

Query: 1084 NL 1085
             L
Sbjct: 486  VL 487

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 21/44 (47%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLS 779
            G  N G TCYLNSLLQ YF     R  +        N ND ++
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLVYQIPTADENPNDSVA 302

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y+L  V +H G+ S GHY+  IK    +  W +++DE +
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKPTTDDK-WYRFDDEKV 533

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  + +   R  +L Y
Sbjct: 162 GYENFGNTCYCNSVLQCLYHLPEFRLRVLEY 192

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 10/95 (10%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            + +LF G  K  I  ++  D   ++VE F  L +N+ +  K + ++F +Y   E +    
Sbjct: 309  LNELFVGKMKSYIKCINV-DYESSRVEDFWDLQLNVKNL-KGLEESFSNYIEIELMNGEN 366

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYD 1055
                 +YG  D ++ V   +FP +L +Q++R  YD
Sbjct: 367  QYAAQDYGLQDAEKGVIFESFPPVLHLQLKRFEYD 401

 Score = 33.9 bits (76), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 16/29 (55%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYI 764
            G  N G TCYLNSLLQ YF     R  +
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLV 231

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y L S+  H+G  + GHY + +K    +G W K+ND  +S
Sbjct: 433  YELTSIISHKGTVNEGHYIVVVKVN--DGQWFKFNDSMVS 470

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 60/128 (46%), Gaps = 14/128 (10%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            + +LF G  K  I  ++  D   ++VE F  L +N+ +  K + ++F +Y   E +    
Sbjct: 313  LNELFVGKMKSYIKCINV-DYESSRVEDFWDLQLNVKNL-KGLEESFKNYIEIELMNGEN 370

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVI----YM 1076
                 ++G  D ++ V   +FP IL +Q++R  YD       K  +   F E I    YM
Sbjct: 371  QYAAQDFGLQDAEKGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYM 430

Query: 1077 DRYADTDN 1084
            D+ A  +N
Sbjct: 431  DKKALREN 438

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 37/95 (38%), Gaps = 24/95 (25%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATP-- 1248
            Y+L  V +H G+ S GHY+  IK   Q+  W +++DE +             G    P  
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKPDLQDQ-WYRFDDEKVWKVTKKQVFEENFGMNKLPEE 502

Query: 1249 ---------------------YFLVYVKQGQEADI 1262
                                 Y LVY+++ +E ++
Sbjct: 503  EIRGMTREQYQNYLITRHTSAYMLVYIREDKEPEV 537

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 16/29 (55%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYI 764
            G  N G TCYLNSLLQ YF     R  +
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 235

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 7/72 (9%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILN--YQKTLNNFNDHLSN----SEHVRRVGGR 790
           G+ N+GN+CY+N ++Q   S   L    LN  Y+K + N N  L +    +++  R+   
Sbjct: 520 GLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHI-NLNSKLGSKGVLAKYFARLVHT 578

Query: 791 EISEGEVERSIQ 802
              EG  +R ++
Sbjct: 579 MYREGSFKRPLE 590

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 723 TIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILN--YQKTLN 772
           T+  N +   ++  G+ N+GN+CY+N ++Q  F+   L    LN  Y K +N
Sbjct: 512 TLSCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHIN 563

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 771

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y L SV +H G  +YGHY  + + R   G W + +DE++
Sbjct: 681  YVLRSVIVHYGTHNYGHYIAFRRFR---GCWWRISDESV 716

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
            Anc_2.307 YDL122W
          Length = 482

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y L +V IH G  +YGHY  Y K  NQ   W + +DE++
Sbjct: 422  YDLKAVIIHYGTHNYGHYISYRKFMNQ---WWRISDESV 457

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 19/41 (46%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFND 776
            G  N G TCYLNSLLQ YF     R  +        N ND
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYGIPTNGENPND 244

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 46/95 (48%), Gaps = 10/95 (10%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            + ++F G  K  I      D   ++VE F  + +N+ +  K + ++F++Y   E +    
Sbjct: 310  LNEIFVGKMKSYI-RCKNVDYESSRVEDFWDIQLNVKNF-KSLQESFENYIEVELMNGEN 367

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYD 1055
                 ++G  D  + V   +FP +L +Q++R  YD
Sbjct: 368  QYAAPDFGLQDAYKGVVFESFPAVLHLQLKRFEYD 402

 Score = 32.7 bits (73), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y L  V +H G+ S GHY+  IK   ++  W +++DE +
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKPTLEDQ-WYRFDDEKV 478

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 13/76 (17%)

Query: 733 NWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREI 792
           N+  G+ N GN+CY++ ++Q       L +  LN     N++ +H++       +  R  
Sbjct: 483 NFSVGLVNCGNSCYMSCIIQCLLGTQELCTMFLN-----NSYQNHIN-------LNSRLG 530

Query: 793 SEGEVERSI-QFIHQL 807
           S+G + R   Q IHQ+
Sbjct: 531 SKGVLARYFSQLIHQM 546

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 10/95 (10%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            I +LF G  K  I  ++  D    + E F  + +N+ +  +D+  +F++Y   E +    
Sbjct: 309  INELFVGKMKSYIRCINV-DYQSVRTEDFWDIQLNVKNM-RDLQTSFENYIEVELMDGEN 366

Query: 1025 TMAEYG----DVKRTVAVTTFPTILQVQIQRVYYD 1055
              A  G    D K+ V   +FP +L +Q++R  YD
Sbjct: 367  QYAAQGHGLQDAKKGVVFESFPPVLHLQLKRFEYD 401

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 21/44 (47%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLS 779
            G  N G TCYLNSLLQ Y+     R  +        N ND ++
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLVYQIPTEGENPNDSVT 246

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  +++   R  +L +
Sbjct: 132 GFENFGNTCYCNSVLQCLYNMTEFRIQMLQH 162

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 703 LTKISIERNSNLITNFL-LTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQ 752
           L ++ +E+N N     +  +G      LP +++  G+ N+GN+CYLNS+LQ
Sbjct: 289 LVQLQVEQNENWQFRMVDSSGKEFKRLLPNKDYGCGLINLGNSCYLNSVLQ 339

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N GNTCY NS+LQ  +++   R  +L +
Sbjct: 125 GYENFGNTCYCNSVLQCLYNLTEFRLLLLQH 155

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 10/95 (10%)

Query: 969  IKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL---- 1024
            + +LF G  K  I  ++  +   ++VE F  L +N+ +  K + D+F++Y   E +    
Sbjct: 307  LSELFVGKMKSYIKCVNV-EYESSRVEDFWDLQLNVKNL-KCLKDSFENYIEIELMNGEN 364

Query: 1025 --TMAEYG--DVKRTVAVTTFPTILQVQIQRVYYD 1055
                 ++G  D ++ V   +FP IL +Q++R  YD
Sbjct: 365  QYAAQDFGLQDAEKGVIFESFPPILHLQLKRFEYD 399

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            Y+L  V +H G+ S GHY+  IK   ++  W +++DE +
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKPDLEDQ-WYRFDDEKV 475

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 10/75 (13%)

Query: 733 NWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLS-NSEHVRRVGGRE 791
           ++  G+ N+GN+CY+N ++Q       L +  LN     N++  H++ NS    ++G + 
Sbjct: 512 DFTVGLENMGNSCYINCIIQCLLGTHELTNIFLN-----NSYERHINLNS----KLGSKG 562

Query: 792 ISEGEVERSIQFIHQ 806
           +      R I  +HQ
Sbjct: 563 VLAKHFARLIHQMHQ 577

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
           Anc_7.390 YBL067C
          Length = 846

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTL 771
           G  N GNTCY NS+LQ  +++   R  +L Y   L
Sbjct: 173 GYENFGNTCYCNSVLQCLYNLYEFRLNMLEYSDHL 207

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 42/101 (41%), Gaps = 6/101 (5%)

Query: 1157 KVTDIDNELMSLYSDIN-SLEDKISHQFDDFKEYGYSLFSVFIHRGEA-SYGHYWIYIKD 1214
            K +++ N  + L++ +   L   ++  FD   E  Y L  V IH G +  +GHY    K 
Sbjct: 657  KYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSSPQHGHYVSLCK- 715

Query: 1215 RNQNGVWRKYNDETISXXXXXXXXXXXX--GNTATPYFLVY 1253
             N    W  ++DET+                N AT Y L Y
Sbjct: 716  -NDKFGWLLFDDETVESVSESTVLEFTGDPNNQATAYVLFY 755

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 10/75 (13%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLS-NSEHVRRVGGREISE 794
            G+ NIGN+CYLN ++Q       L    LN     N +  H++ NS    ++G + +  
Sbjct: 559 VGLQNIGNSCYLNCIIQCLLGTHELTKIFLN-----NFYERHINLNS----KLGSKGVLA 609

Query: 795 GEVERSIQFIHQLRN 809
               R I  +H   N
Sbjct: 610 KYFARLIHLMHNHAN 624

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNYQK 769
           G  N GNTCY NS+LQ  F +   R  IL + +
Sbjct: 123 GYENFGNTCYCNSILQCLFFLDDFRIDILKHPR 155

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761
            G+ N GNTCY+NS++Q  F    LR
Sbjct: 238 VGLRNQGNTCYINSMVQCLFGTKVLR 263

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 36/89 (40%), Gaps = 19/89 (21%)

Query: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISEG 795
           TG+ N  NTCY+NS++Q  FS    R   L  +  L      L N ++            
Sbjct: 296 TGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKL-----FLENEKY------------ 338

Query: 796 EVERSIQFIHQLRNLFYAMVHSRERCVTP 824
              + +Q  H +  LF  M  +  R + P
Sbjct: 339 --PKGLQLSHSIYVLFKKMYLNGGRAIIP 365

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 33.1 bits (74), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETI 1229
            YSL S+ +H G   YGHY  Y +  +Q   W + +DE++
Sbjct: 428  YSLKSIVVHYGSHDYGHYISYRRFEDQ---WWRISDESV 463

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 33.5 bits (75), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G+ N+GN+CYLN ++Q       L    LNY
Sbjct: 748 GLQNMGNSCYLNCIIQCLLGTHELTKIFLNY 778

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 725 DPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL 765
           D N L  E   TG+ N  NTCY+NS++Q  F     R   L
Sbjct: 287 DSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 327

>TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2.16
            YNL225C
          Length = 1081

 Score = 33.1 bits (74), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 7/78 (8%)

Query: 1130 KLLESSIVENTVLN--IEDKKNLIKTLKNKVTDIDNELMSLYSDINSLEDKISHQFDD-- 1185
            KLLE  ++EN  LN  I + +N    L+NK+ D  +E+ +L  ++N L+DK+S+   D  
Sbjct: 205  KLLEEKVIENNRLNSDILNSRNSNLVLQNKLVDGSDEITNLQDEVNILKDKLSYFEADNK 264

Query: 1186 -FKEYGYSLFSVF--IHR 1200
              K   YSL S +  +HR
Sbjct: 265  ILKNDIYSLESNYDELHR 282

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 1184 DDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETIS 1230
            DD  +  + L  +  HRG  + GHY  + K     G W K+ND  +S
Sbjct: 398  DDVPDIIFELIGIIAHRGTVNEGHYIAFTKVT--TGHWFKFNDSMVS 442

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
           cerevisiae YBL067c UBP13
          Length = 724

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNY 767
           G  N G+TCY NS+LQ  +++   R  IL +
Sbjct: 122 GYENFGHTCYCNSVLQCIYNLPEFRKSILQF 152

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 10/88 (11%)

Query: 685 WFDENVYEPDQFL--ILKAALTKISIERNSNLITNFLLT------GTIDPNSLPPENWPT 736
           W +  +    Q L  I   AL  +S+   S  + N+LL+      G+  P  L  + + T
Sbjct: 19  WLELFLQRKGQLLRKITYTALLGLSLYVISPTVVNYLLSVLGLEKGSKGPKRL--DKFTT 76

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYI 764
           G+ N GN C++NS +Q    +  L +Y+
Sbjct: 77  GLVNPGNDCFINSSIQALVPLDKLTTYL 104

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 715 ITNFLLTGTIDPN-SLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYI 764
           + N L +  I+ + +  P+ + TG+ N GN CY NS++Q   SI     YI
Sbjct: 50  VKNILFSKNINGSLASRPDKYTTGLVNKGNYCYANSVIQALSSIDYFSDYI 100

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 702 ALTKISIERNSNLITNFLLTGTIDPNSLPP-ENWPTGINNIGNTCYLNSLLQYYFS 756
           +L ++ +E+N N     + +   +   LPP +    G  N+GN+CYLNS+LQ  F+
Sbjct: 298 SLIELQVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFN 353

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 2/40 (5%)

Query: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETIS 1230
            Y L  +  HRG  + GHY  + K     G W K+ND  ++
Sbjct: 411  YELIGIVSHRGTVNEGHYIAFCKI--SGGQWFKFNDSVVT 448

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 32.7 bits (73), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 737 GINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNNFNDHLSNSEHVRRVGGREISEGE 796
           G+ N+ N+CY+N ++Q   S+  L    LN     N+F  H+ N E   ++G + +    
Sbjct: 430 GLENMSNSCYMNCIIQCLLSVPELIQICLN-----NSFLKHI-NME--SKLGSKGVIMKH 481

Query: 797 VERSIQFIH 805
             + IQ +H
Sbjct: 482 FAKLIQDMH 490

>KAFR0J01720 Chr10 (330744..332129) [1386 bp, 461 aa] {ON} Anc_2.230
           YNL068C
          Length = 461

 Score = 32.3 bits (72), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 7/102 (6%)

Query: 230 YGIYVSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPD 289
           YG+  S + NKL+   I N E+   +++  + T  +Q+  +   +KNE  N NE P +  
Sbjct: 199 YGL--SGNNNKLLCAIINNSEYVKKQKQLGYITFHLQENGSTGPMKNEDGNNNEGPDE-S 255

Query: 290 CFYTLFKIFKGPLARKSTADPIKTI----DSGNIVLNTHLNP 327
            F    +   GPL +  +  P  T     ++ N+  N   NP
Sbjct: 256 IFNNAIQSPSGPLTQTLSVFPPPTATMSHNNSNMASNIMSNP 297

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 32.3 bits (72), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 44/98 (44%), Gaps = 10/98 (10%)

Query: 936  QQDVTECIGNVLFQIESGSEPIR-YDEDNEQYDLIKQL--------FYGTTKQCIVPLSA 986
            QQD  E +  +L Q+    +  R  DED E      QL        F GT +  IV    
Sbjct: 226  QQDAHEFLQFLLNQLHCDYKRERQVDEDKEVRSSSSQLCHCIVHSSFQGTLRSSIVCPEC 285

Query: 987  TDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFRDEYL 1024
             D  +T ++ FL L ++I    + +YD  DS+ R E L
Sbjct: 286  QDDSKTMLDPFLDLSLDIKGQ-RTLYDCLDSFHRREQL 322

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 32.3 bits (72), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 18/20 (90%)

Query: 737 GINNIGNTCYLNSLLQYYFS 756
           G+ N+GN+CYLNS+LQ +++
Sbjct: 327 GLINLGNSCYLNSILQCFYN 346

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 32.3 bits (72), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 1/60 (1%)

Query: 1189 YGYSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISXXXXXXXXXXXXGNTATP 1248
            Y Y L  V +H G+ S GHY+  IK   ++  W +++D+ +             G+   P
Sbjct: 441  YIYDLHGVLVHTGDISTGHYYTMIKPSIEDQ-WYRFDDDKVWRVTKNQVFEENFGHVRLP 499

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 143,414,697
Number of extensions: 6952163
Number of successful extensions: 32501
Number of sequences better than 10.0: 453
Number of HSP's gapped: 33774
Number of HSP's successfully gapped: 533
Length of query: 1270
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1149
Effective length of database: 39,606,813
Effective search space: 45508228137
Effective search space used: 45508228137
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)