Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_8.1695.426ON1460146077350.0
Skud_15.2795.426ON1460146074950.0
YOR116C (RPO31)5.426ON1460146074630.0
Smik_15.2945.426ON1460146074510.0
NDAI0C016205.426ON1460146068640.0
NCAS0H020405.426ON1460146068550.0
TDEL0E019905.426ON1460146068090.0
KAFR0D050305.426ON1462145767920.0
Kpol_1016.95.426ON1460146067090.0
SAKL0G02354g5.426ON1458146067060.0
CAGL0L11660g5.426ON1459145966250.0
ZYRO0F09856g5.426ON1458146066180.0
TBLA0A037205.426ON1458146065320.0
KLTH0F16236g5.426ON1460146165310.0
KNAG0B042405.426ON1455146164870.0
KLLA0E21253g5.426ON1457146064860.0
AER252C5.426ON1459146064320.0
Ecym_55255.426ON1459146064290.0
TPHA0H017605.426ON1459145264090.0
Kwal_55.214595.426ON1148114551320.0
TPHA0A030707.314ON1719150718640.0
Ecym_80657.314ON1743151518650.0
KNAG0C039707.314ON1721150318630.0
KAFR0B010607.314ON1685150418530.0
Suva_4.1047.314ON1733150518490.0
Smik_4.957.314ON1719150618460.0
YDL140C (RPO21)7.314ON1733150518460.0
KLLA0F05071g7.314ON1720150718430.0
NDAI0A021307.314ON1729150818380.0
KLTH0H02046g7.314ON1740152718380.0
Skud_4.1147.314ON1726150518340.0
Kwal_56.244897.314ON1728153018330.0
ADR086C7.314ON1745151518310.0
CAGL0I03828g7.314ON1715149718190.0
NCAS0A139007.314ON1716150518110.0
TDEL0C023207.314ON1727149017990.0
SAKL0F10472g7.314ON1730129916890.0
Kwal_55.21464singletonOFF32031713950.0
ZYRO0F05918g7.314ON174497514701e-175
TBLA0F021707.314ON172697014351e-170
Kpol_162.1singletonON131162612531e-148
CAGL0E05500g7.51ON164397411561e-132
TPHA0H028007.51ON164897111471e-131
TDEL0H040007.51ON166597011421e-130
KLLA0F23243g7.51ON165398611351e-129
ZYRO0D04532g7.51ON166797611361e-129
KLTH0D01628g7.51ON165498011281e-128
NCAS0F007307.51ON167491611181e-127
TBLA0E019307.51ON165998111141e-126
Skud_15.5067.51ON166597611051e-125
KNAG0D049707.51ON167196810891e-123
SAKL0B10736g7.51ON165097410711e-120
Smik_15.5197.51ON166599310521e-118
YOR341W (RPA190)7.51ON166499910521e-118
Kwal_26.69797.51ON1654100610491e-118
Suva_8.3917.51ON166599310401e-116
KAFR0K005407.51ON166298510311e-115
NDAI0H012007.51ON166993010161e-113
ADR374C7.51ON164099610021e-111
Kpol_1040.37.51ON16567279641e-106
Kpol_1019.277.314ON3642901904e-14
Suva_13.4108.752ON267128820.42
TPHA0H014405.359ON875128772.8
Smik_13.4348.752ON267128744.0
Skud_13.3958.752ON267128719.2
YMR226C8.752ON267128719.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_8.169
         (1460 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  2984   0.0  
Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2891   0.0  
YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  2879   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  2874   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2648   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2645   0.0  
TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2627   0.0  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2620   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2588   0.0  
SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2587   0.0  
CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  2556   0.0  
ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2553   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2520   0.0  
KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2520   0.0  
KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  2503   0.0  
KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2503   0.0  
AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2482   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2481   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  2473   0.0  
Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  1981   0.0  
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   722   0.0  
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   723   0.0  
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   722   0.0  
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   718   0.0  
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   716   0.0  
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   715   0.0  
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   715   0.0  
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   714   0.0  
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   712   0.0  
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   712   0.0  
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   711   0.0  
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   710   0.0  
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   709   0.0  
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   705   0.0  
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   702   0.0  
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   697   0.0  
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   655   0.0  
Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116...   541   0.0  
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   570   e-175
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   557   e-170
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   487   e-148
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   449   e-132
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   446   e-131
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   444   e-130
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   441   e-129
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   442   e-129
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   439   e-128
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   435   e-127
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   433   e-126
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   430   e-125
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   424   e-123
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   417   e-120
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   409   e-118
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   409   e-118
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   408   e-118
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   405   e-116
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   401   e-115
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   395   e-113
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   390   e-111
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   375   e-106
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    78   4e-14
Suva_13.410 Chr13 complement(702373..703176) [804 bp, 267 aa] {O...    36   0.42 
TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {O...    34   2.8  
Smik_13.434 Chr13 complement(705526..706329) [804 bp, 267 aa] {O...    33   4.0  
Skud_13.395 Chr13 complement(695660..696463) [804 bp, 267 aa] {O...    32   9.2  
YMR226C Chr13 complement(721593..722396) [804 bp, 267 aa] {ON} N...    32   9.8  

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2984 bits (7735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1440/1460 (98%), Positives = 1440/1460 (98%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA
Sbjct: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
            NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK
Sbjct: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL
Sbjct: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            LIPKPCLFESLSNEAALKAN
Sbjct: 1441 LIPKPCLFESLSNEAALKAN 1460

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2891 bits (7495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1388/1460 (95%), Positives = 1418/1460 (97%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAP+ANGALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS+LEC TCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSA+LLSETDK
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDAT+PSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQEL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            VNGPNVHPGANYLLK+NEDARRNLRYGDRMKLAK+LQIGDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL MMSDG+EQFDVPPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            YYLWTGKQVFSLLIKP+H SPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFV+IRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKEELVEIAYRKCDELIT FNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITF+N+DEGLLPYAIM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            +TAN+IL PLE+RLVRYDNRG LVK+EDKD+AE+VDQYDAERDFYRSLREYINLKAT LA
Sbjct: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
            NLRKSRGM E +  P KEL+G+D DEAVP NVRTSVSQLYRISE+SV+KFLEIALFKYRK
Sbjct: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+AITRASKLKIQA DV IIGKD+IAINVFPEGYKAKSISTSAKEPSENDVFYRM
Sbjct: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRRALPDVVVKGL DISRAVINIRDD KRELLVEGYGLRDVMCTDGVIGSKTTTNHVL
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAARYSI+REINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV+KGTN+SEKD
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L+PKPCLFESLSNEAALKAN
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 2879 bits (7463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1385/1460 (94%), Positives = 1414/1460 (96%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAP+ANGALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSLEC TCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R+FLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKDIWVGEWKEVL HNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQEL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            VNGPNVHPGANYLLK+NEDARRNLRYGDRMKLAK+LQIGDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL MMSDG+E FD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            YYLWTGKQVFSLLIKP+H SPVVINLDAKNKVFVPPKSKSLP+EMSQNDGFV+IRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELIT FNKGELETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITF+NQD+GLLPYAIM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            ETAN+IL PLE+RLVRYDN G LVK ED +KAE+VDQYDAERDFY SLREYIN KAT LA
Sbjct: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
            NLRKSRGML L+  P KELQG+DPDE VP NV+TSVSQLYRISE+SV+KFLEIALFKYRK
Sbjct: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDVA+YVQDVYKDNLSFIQVRIDLGTIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVAITRASKLKIQA DV IIGKD+IAINVFPEGYKAKSISTSAKEPSENDVFYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRRALPDVVVKGL DISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGS+TTTNHVL
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAARYSI+REINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV+KGTN+SEKD
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L+PK CLFESLSNEAALKAN
Sbjct: 1441 LVPKRCLFESLSNEAALKAN 1460

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2874 bits (7451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1378/1460 (94%), Positives = 1416/1460 (96%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAP+ANGALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSLEC TCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPGVDNLRRMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RHFLQELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQEL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            VNGPNVHPGANYLLK+NEDARRNLRYGDR+KLAK+LQIGDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL MMSDG+EQFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            YYLWTGKQVFSLLIKP+H SPVVINLDAKNKVFVPPKSKSLP+EMSQNDGFV+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELIT FNKGELETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITF+NQDEGLLPYAIM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAIM 960

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            +T N+IL PLE+RLVRYDN G LVK+E+ +KAE+VDQYDAERDFYRSL+EYINLKAT LA
Sbjct: 961  QTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATALA 1020

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
            NLRKSRGMLEL+  P KE + +DPD+ VP NV+TSVSQLYRISE+SV+KFLEIAL+KYRK
Sbjct: 1021 NLRKSRGMLELLEPPTKESEKVDPDKLVPDNVKTSVSQLYRISEKSVRKFLEIALYKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVAITRA+KLKIQA DV IIGKD+IAINVFPEGYKA+SISTSAKEPSENDVFYRM
Sbjct: 1201 TIEDIAVAITRAAKLKIQASDVNIIGKDRIAINVFPEGYKARSISTSAKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRRALPDVVVKGL DISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGS+TTTNHVL
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAARYSI+REINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV+KGTN+SE+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISERD 1440

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L+PKPCLFESLSNEAALKAN
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2648 bits (6864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1262/1460 (86%), Positives = 1354/1460 (92%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVVSE PKRI GLEFSALSAADIVAQSEVE+S+RDLFDLEK R P+  GALD +MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSLEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICK CSAILLS+ D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R+FL+ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                    IIH
Sbjct: 121  RQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            D FRWVGKKSAPEKD WVG+WKEVL+H+PELER+VKRC DDLNPLKTLNLFKQIK  DCE
Sbjct: 181  DNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLG+++TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYNR KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQLI 420

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK NEDARRNLRYGDR+KLAK+LQ GDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLL MM D   QFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            +YLWTGKQ+FSLLIKP+  SPVVINLDAKNKV++PPK+K+ P+EMS+NDG+V+IRGSQIL
Sbjct: 601  HYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA AMNRMAKLCARFLGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNA+PVNFNRSWDHA NITF     GLLPY IM
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIM 960

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            ET N IL PLEDRL+RYDN G +V +ED  KAE+VDQ+DAERDFY+SLR+Y++ KA  L 
Sbjct: 961  ETTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLG 1020

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
            ++RKSRGML +V+ P +EL+ M+PDE VP  +R SV QLY+I+E  VKKFLEIAL+KYRK
Sbjct: 1021 SVRKSRGMLPMVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGR+EKTLLSDVAYY+QDVYKDNLSFIQVRIDL TI+KLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVA+TRA KLKI   DV IIGKDKIAINVFPEGYKAKSIST+AKEP+EN VFYRM
Sbjct: 1201 TIEDIAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP +VVKGL +I+RAVINIRDDGKRELLVEGYGLRDVMCTDGVIG KTTTNH+L
Sbjct: 1261 QHLRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV +VLGIEAAR SIV EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV+KGT ++++ 
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEIAKES 1440

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L PKP LFE+L++  ++K N
Sbjct: 1441 LKPKPTLFENLTSSRSIKMN 1460

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2645 bits (6855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1261/1460 (86%), Positives = 1355/1460 (92%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVVSE PKRI GLEFSALSAADIVAQSE+EVS+RDLFDLEK R P+  GALD KMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSLEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQG+CK CSAILL++ DK
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R+FL ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                    IIH
Sbjct: 121  RQFLTELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKD WVG+WKEVL+H+PELER++KRC DDLNPLKTLNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQLI 420

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLKKNEDARRNLRYGDR+KLAK+LQ GDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLL MMS+G  +FD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            YY+WTGKQVFSLLI+P+ +SPVVINLDAKNKVF+PPK K  P+EMS+NDG+VVIRGS IL
Sbjct: 601  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKEELVEIAY KCDELI  F+KG+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNA+PVNFNRSWDHA NITF N ++GLLPY IM
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEIM 960

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            E  N+IL PLE+RL+RYDN G LV  +D +KAE+VDQ+DAERDFYRSLR+YI  KA  LA
Sbjct: 961  EKTNEILKPLEERLIRYDNVGELVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADILA 1020

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
             +RKSRGMLE+ + P +EL+ +DPDE +  +++ SV QLY+I+E+SV+ FLEIAL+KYRK
Sbjct: 1021 RVRKSRGMLEMSSEPGEELRKLDPDERITESIKHSVDQLYKITEKSVQTFLEIALYKYRK 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGR+EKTLLSD+AYY+QDVYKDNLSFIQVR+DLGTI+KLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDIAYYIQDVYKDNLSFIQVRVDLGTIEKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVAIT+A KLKIQ  DV I+GKDKIAINV+P+GYKAKSIST AKEPS N VFYRM
Sbjct: 1201 TIEDIAVAITKAPKLKIQTSDVNILGKDKIAINVYPDGYKAKSISTMAKEPSNNAVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRR LP +VVKG  DISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG KTTTNH+L
Sbjct: 1261 QHLRRVLPSIVVKGFGDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV +VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVNNVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV+KGTN+SE D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEAD 1440

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L PKP LFE LSN    K N
Sbjct: 1441 LKPKPTLFEKLSNCGTHKLN 1460

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2627 bits (6809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1253/1460 (85%), Positives = 1348/1460 (92%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVVS TPKRI GLEFSALSAADIVAQSEVE+STRDLFDLE  RAPRA GALDPKMGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSLECTTCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICKNCSA+LL + D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPGVDNLRRMGIL K+LDQCKKQRRCL C                    IIH
Sbjct: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRW GKKS PEKD WVG+W EVL+HNPELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID++  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            +GL+KGISINNMMEHWDYLQL+VAMYINSDSVNPAM+PG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLKK+EDARRNLRYGDR+KLAK+L++GDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DR +LTQLL MMSDG  QFD+P PAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
             YLWTGKQVFSLLIKP+ KSPVVINLDAKNKVF+PPKSKSLPSEMSQNDG+V+IRGS+IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLK+KKE++VE AY KCDELI S+NKG+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDP+EMEGNAQPVNF RSW+HA+N+TF+N + GL PY I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            E  +KIL PL +RL+RYDN G LV  E     E++DQ DAER+FY SL+ ++  KA  LA
Sbjct: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
            ++RK RGM EL++ P  E + +D DE VP N+R SV QL RI+  SV++FL+IA+ KYR+
Sbjct: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGR+EKTLLSDVA+Y+QDVY+DNLSF+QVRIDL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVAITRA KLKIQA DVTI+ KDKIAINVFPEGYKAKSISTSAKEP ENDVF+RM
Sbjct: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRR+LP +VVKGL DISRAVIN+RDD KRELLVEGYGLRDVM TDGV+G KT TNH+L
Sbjct: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTMSIGTG+FKVIKGT++ E+D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L PKP LFESLS E A+KAN
Sbjct: 1441 LRPKPTLFESLSKETAIKAN 1460

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2620 bits (6792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1239/1457 (85%), Positives = 1352/1457 (92%), Gaps = 1/1457 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVV+SE PK+I G+EFSALSA+DIVAQSEVE+S+RDLFDLE++R  + NGALDP+MGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSSL C TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNCS++LLS+ DK
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  RKFLHELRRPG-VDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXII 179
            +K+LHELR  G +DNL++MGILKK++DQCKKQRRCLHC                    II
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 180  HDTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADC 239
            HDTFRWVGKKS PEKD W+G+W EVL+H+PELER+VKRC DDLNPLKTLNLFKQ++  DC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 240  ELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
            ELLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 300  KAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKG 359
            KAGL+KGISINNMMEHWDYLQLTVAMYIN+DSVNPAMLPG+S+GGGKVKPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQEL 419
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQEL
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 420  VVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPS 479
            V+NGPN+HPGANYLLKKNE+ARRNLRYGDR+KLAK+LQ GD++ERHLEDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMK 599
            NLLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT TQLL MMSDG  QFD+PPPAIMK
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 600  PYYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQI 659
            PYYLWTGKQ+FSLLIKP+HKSPVVINLDAKNKV++PPKSKSLP+EMS+NDGFV+IRGS I
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTP 719
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM+KLCARFLGNRGFSIGI+DVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 720  ADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGD 779
            ADDLK KKEELVEIAY KCD+LI S+NKG+LETQPGCNEE+TLEAKIGG LSKVREEVGD
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 780  VCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            VCINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 900  YDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAI 959
            YDNTVRTS+NGIVQFTYGGDGLDP+EMEG+AQPVNFNRSWDHA NITF+N + GLLPY +
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 960  METANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTL 1019
            M+  N++L PLE+RLVRYDN G  V  ED DK E+ DQ+DAERDFY++LR YI  K+  L
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020

Query: 1020 ANLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYR 1079
            A++RKSRG+LEL++ P +ELQ + PDE      R+SV QL +I+E++V KFLEIAL KYR
Sbjct: 1021 AHVRKSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080

Query: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            KAR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140

Query: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199
            IINAVLVN+NDERAARVVKGRVEKT+LSDVAYY+QDVYKDNLSF+Q+RIDL TI+KLQLE
Sbjct: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200

Query: 1200 LTIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            LTIEDIAVA+T+A KLKIQA DV+I G DK+ +NVFPEG K+KSISTSAK+PSENDVFYR
Sbjct: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260

Query: 1260 MQQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319
            MQQLRRALP +VVKGL +I+RAVINIRDDGKRELLVEGYGLR+VMCTDGVIGSKT TNHV
Sbjct: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320

Query: 1320 LEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379
            LEV SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEK 1439
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTMSIGTGSFKV+KGT++  +
Sbjct: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440

Query: 1440 DLIPKPCLFESLSNEAA 1456
            DL PKP LFESLS+ ++
Sbjct: 1441 DLKPKPTLFESLSSASS 1457

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2588 bits (6709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1232/1460 (84%), Positives = 1332/1460 (91%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVVSETPK+I GLEFSALSA+DIVAQSEVEVSTRDLFDLE  RAP+  GALDPKMGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSS+ECTTCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICKNCS+ILL++TD+
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FLHELRRPG+DNL+RM I+KKILDQCKKQRRCL C                    IIH
Sbjct: 121  RDFLHELRRPGIDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKS+PEKD WVG+W++VL +NPELER+ KR MDDLNPLKTLNLFKQI+  DCE
Sbjct: 181  DTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQL+VAMYINSDSVNP+M+PG+S+GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNR KLQ LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQALV 420

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANY+LK NE+ARRNLRYGDR+K+AK L++GD++ERHLEDGD+VLFNRQPSL
Sbjct: 421  INGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA+NLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKD+F DRAT TQLL MMSD   QFD+PPP I+KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIKP 600

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            Y LWTGKQ+FSLLIKP+  SPVVINLDAKNKVF+PPKSKSLP+EMSQNDGFVVIRGSQIL
Sbjct: 601  YCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPD 720

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            + LKQKKEELVEIAY KCDELI  F KG+LETQPGCNEEQTLEAKIGG LSKVREEVGD+
Sbjct: 721  NALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDI 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNF RSWDHA NITFDN  +GLLPYAI+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAII 960

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
               N IL P E+RL+RYDN G LVK  D+ K E VDQ D+ER+FY SLR+Y+  KA+ LA
Sbjct: 961  NKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASILA 1020

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
            ++RK +G+ EL + P  E + MD DE   +  R +V +L +I+E++V+KFLEIA+ KYR+
Sbjct: 1021 SIRKDKGLKELSSEPGNEFKEMDLDEGESSEARFAVEKLCKITEKTVEKFLEIAMSKYRR 1080

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDND+RAARVVKGR+EKTLLSDVAYYVQDVYKDNLSF++V+IDL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDKRAARVVKGRIEKTLLSDVAYYVQDVYKDNLSFLEVKIDLSTIDKLQLEL 1200

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVA+TRA KLKIQ  DV I+ KDKI I+V+PEG KAKSISTS KEPSENDVFYRM
Sbjct: 1201 TIEDIAVALTRAPKLKIQTTDVQIVSKDKITISVYPEGSKAKSISTSMKEPSENDVFYRM 1260

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP +VV GL DI+RAVINIRDDGKRELLVEGYGLR+VMCTDGVIGSKTTTNHVL
Sbjct: 1261 QTLRRALPQIVVNGLPDIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTTTNHVL 1320

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FK++K T +   D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKILKSTEIKPDD 1440

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L PK  LFE+L  E ALK N
Sbjct: 1441 LKPKRTLFENLVAEPALKVN 1460

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2587 bits (6706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1234/1460 (84%), Positives = 1338/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVV   PK+IKGLEFSALSA+DIVAQSEVE+STRDLFDLE  R P+  GALD KMGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS  EC+TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQG+CKNC++ILLS+ DK
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R+FL ELRRPGVDNLRRMG LKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEK+ WVG+WK+VL HNPELERY+KRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+ V SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG+S  GGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGAS--GGKTKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYN+HKLQ+LV
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLV 418

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            +NGPN+HPGANYLLKKN+DARRNLRYGDRMKLAK+LQ GDV+ERH+EDGDVVLFNRQPSL
Sbjct: 419  INGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLL MMSDG  QFD+PPPA+MKP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKP 598

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            +YLWTGKQVFSLLI+P+ KSPV+IN+DAKNKVF+PPK K LP+EMS NDGFVVIRGS+IL
Sbjct: 599  HYLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPG 718

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             DLKQKKE+ VE AY KCDELI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 719  ADLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSWDHA NITF ++D GLLPY I+
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQII 958

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            E  N IL PLE +LVR+DN G  +  ED++K E++DQ+DAER+FY+SLR+Y+  KAT LA
Sbjct: 959  ENTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLA 1018

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
             +RK++G+  L++ P  EL+ ++ DE  P  + T+V+QL +IS+  V+ FL IA+ KY +
Sbjct: 1019 KIRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHR 1078

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVND DERAARVVKGR+EKT+LSDV YY+QDVYKDNLSFIQ ++DLGTI+KLQLEL
Sbjct: 1139 INAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLEL 1198

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVAITRASKLKI   DV+I+G++KI INVFPEGYKAKSISTSAKEPSEN VFYRM
Sbjct: 1199 TIEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRM 1258

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP +VVKGL DISRAVINIRDDGKRELLVEGYGLRDVM TDGVIGSKT TNH+L
Sbjct: 1259 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            E+F+VLGIEAAR SIV EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1319 EIFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV+KGT++SE+D
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEED 1438

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L PK  LFESL N+ ALK +
Sbjct: 1439 LKPKHTLFESLCNDVALKTH 1458

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 2556 bits (6625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1225/1459 (83%), Positives = 1332/1459 (91%), Gaps = 3/1459 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVV+ ETPKRI GLEFSALS ADIVAQSE+E+S+RDLFDLE +R+P+  GALDP+MGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            S+SS+ECTTCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQGICK CSAILLSE DK
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPGVDNLRRM +LKK+LDQCKKQRRCLHC                    IIH
Sbjct: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKS PEKD W+G+WKEVL+HNPELERYVKR  DDLNPLKTLNLFKQI S DCE
Sbjct: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDAT  +GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AG++KGISINNMMEHWDYLQ+TVAMYINSDS+NPAMLPGSS GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN  KL++LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
             NGPNVHPGANYLLKKNE+ARRNLRYGDR KLA +LQ GDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+A+LTQLL MMSDG  QFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
             YLWTGKQVFSLLIKP+  SPV INLDAKNKV++PPK K  P+EMSQNDGFV++RGSQIL
Sbjct: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA+AMNRMAKLCAR+LGNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            DDLKQKKE+LVEIAY KCDELI  +NKG+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITF+N D GLLPY I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            +T + IL PLE RL+RYD  G  V  ED    ++VDQ+D+ER FY SLRE++  KA  LA
Sbjct: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLA 1020

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPD-EAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYR 1079
             LRKSRG+ +L+     EL+G DP+ E +   V+ S++QLYRI+E +V+KFLEIA+ KY 
Sbjct: 1021 KLRKSRGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078

Query: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199
            IINAVLVN+NDERAARVVKGR+EKTLLSDV YY+QDVYK+N++++QV++DL TIDKLQLE
Sbjct: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198

Query: 1200 LTIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            LTIEDIA+AITRA KLKIQ  DVT++GKDKIAINV PEG+ +K+ STS KEP+ENDVFYR
Sbjct: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258

Query: 1260 MQQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319
            MQ LRRALP ++VKGL DI+RAVINIRDDGKRELLVEGYGLRDVMCTDGVIG+KT TNHV
Sbjct: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318

Query: 1320 LEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379
            LE+F+VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEK 1439
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV+K T+++E 
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438

Query: 1440 DLIPKPCLFESLSNEAALK 1458
            +L PK  LFESL++  A K
Sbjct: 1439 ELKPKRTLFESLTSNVANK 1457

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2553 bits (6618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1219/1460 (83%), Positives = 1337/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVV SE PK+I GLEFSALSAADIVAQSEVE+STRDLFDLE  RAP+  GALDPKMGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSS+EC TCHGNLASCHGHFGH+KLALPVFHIGYFKATIQILQGICK CS+ILL +TDK
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            + FL ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                    IIH
Sbjct: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRW GKKS PEK+ W+G+W  VL H+PELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQL VAMYINSDSVNPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYN+ KLQ+LV
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            VNGPN +PGANYLLKK+EDARRNLR+GDR+KLAK+L+IGD++ERHLEDGDVVLFNRQPSL
Sbjct: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+  +TQLL MMSDG  QFD+PPP I KP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
             YLWTGKQ+FSLLI+P+ KSPVV+NLDAKNKV++PPKSKSLP+EMSQNDGFV+IRGSQIL
Sbjct: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCAR++GNRGFSIGI+DVTPA
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            ++LK+KKEE+VE AY KCDELI  F+KG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 719  EELKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSK
Sbjct: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNR+WDHA N+TF+N D GLLPY IM
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            +   +IL PLE+RLVRYDN G  +  E++D+ E++DQ DAER FY SLR++I  KA  LA
Sbjct: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
              R S+ M EL++ P  ELQ +D DE VP ++R SV Q+YRI+++ V++FL +A+ KYR+
Sbjct: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVN++DERAARVVKGR+EKTLLSDVA+Y+QDVY+DNLS++QVR+DL TIDKLQLEL
Sbjct: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIAVA+TRA KLKIQA DV I+GKDKIAINVFP+G KAKSIST AKEPSEN+VFYRM
Sbjct: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRRALP +VVKGL+DISRAVINIRDDGKRELLVEGYGLRDVM TDGV+G KT TNH+L
Sbjct: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV+SVLGIEAAR SIV EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKV+KGTNVSE+ 
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L PKP LFESL NE ++K N
Sbjct: 1439 LKPKPTLFESLVNETSVKVN 1458

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2520 bits (6532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1212/1460 (83%), Positives = 1310/1460 (89%), Gaps = 2/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVV SE PK+I GLEFSALSAADIVAQSEV ++TRDL+DLE  RAP+ +GALD +MGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS+LEC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ ICK+C+A+LLS+ DK
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPG+DNL+RMGILKKILDQCKKQRRCLHC                    IIH
Sbjct: 121  RNFLSELRRPGIDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKK  PEKD WVG+W+EVL+HNPELER+VKR MDDLNPLKTLNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQL+VAMYINSDSVNP ++PG+S G  KVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGN-KVKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PE+VTRYN+ KLQ LV
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQALV 419

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLKK+E+ARRNLRYGD++KLAK+LQIGDV+ERHLEDGDVVLFNRQPSL
Sbjct: 420  LNGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT TQLL MM DG  QFD+PPPAIMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMKP 599

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
             YLWTGKQ+FSLLIKP+  SPVVIN+DAKNKVF PPK KSLPSEMS NDGFVVIRGSQIL
Sbjct: 600  CYLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAA AMNRMAKLCARFLGNRGFSIGINDVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTPD 719

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
            D LK  KE LVEIAY KCDELI  +N+G+LETQPGCNEEQTLEAKI G LSKVREEVGD+
Sbjct: 720  DKLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGDI 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDNWNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CINELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSF+SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDP +MEGNAQPVNFNRSWDHAYNI FDN D+ + PY I+
Sbjct: 900  DNTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQIL 959

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            E  N IL PLE++L+RYDN G +V  E+  K E VDQ DAER+FY SLR+Y+  KA  LA
Sbjct: 960  EITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANELA 1019

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
            ++RKSRGM EL++AP  E + MD DE  P ++R SV Q+ RI+E +V++FL+IA+ KYR+
Sbjct: 1020 DVRKSRGMKELLSAPGDEFKLMDLDEQTPDSIRHSVEQICRITENTVREFLKIAITKYRR 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGR+EKTLLSDVAYY+QD YKDN S+++V+IDLGTI+KLQLEL
Sbjct: 1140 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDCYKDNNSYLEVKIDLGTIEKLQLEL 1199

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            T+ DIA AI RA KLKIQ  DV      KI I+V PE   +K IS SAKEP EN+VFYRM
Sbjct: 1200 TMSDIADAIARAPKLKIQFGDVVPESNSKIRISVRPEASVSK-ISASAKEPLENNVFYRM 1258

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP +VVKGL DI+RAVINIRD+GKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL
Sbjct: 1259 QHLRRALPSIVVKGLPDIARAVINIRDNGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1318

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1319 EVNSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV+K T++    
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKDTHIRNGT 1438

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L PK  LFESL  E  +K N
Sbjct: 1439 LKPKRTLFESLCKETNIKIN 1458

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2520 bits (6531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1198/1461 (81%), Positives = 1316/1461 (90%), Gaps = 2/1461 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIVAQS+VE+STRDLFDLE  R P++ GALD +MGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK C+A+LLSE DK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
             +FL ELRRPG+DNLRRMGILKK++DQCKKQRRCL C                    I+H
Sbjct: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKD WVG+WK VL HNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+LV
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLV 419

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            +NGPN HPGANYLLKK+E+ARRNLRYGDRMKLA++LQ GDV+ERHLEDGDVVLFNRQPSL
Sbjct: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+ RA   QLL MMSDG  QFD+PPP+IMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKP 599

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            YY+WTGKQVFSLLI+P+ +SPVVINLDAKNKV++PPK KSLP+EMS NDG+VVIRGS+IL
Sbjct: 600  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEAA AMNRMAKLCARFLGNRGFSIGINDVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPG 719

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             +LK KKE +VE AY KCD LI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 720  FELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN N+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF+RSW+HA N+TF++ D+ LLPY IM
Sbjct: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIM 959

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            +  N +L PLE++LVRYDN G  +    +D+ E++DQ DAER+FY+SLR+Y+  KA+ LA
Sbjct: 960  QQTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLA 1019

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
            N+R  +G+ E ++ P  ELQ MD DE  P +   SV QL +IS + V KFLEIA+FKY K
Sbjct: 1020 NIRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHK 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVN+NDERAARVVKGR+EKTLLSDVA+Y+QDVYKDN+SF+QV++DLGTI+KLQLEL
Sbjct: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLEL 1199

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            T+EDIAVAITRA+KLKI A DV+I+GKDK+ INV+PE  K KSISTSAKEP EN++FYRM
Sbjct: 1200 TVEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRM 1259

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP +VVKGL DI+RAVINI+DDG RELLVEGYGLR+VM TDGVIG KT TNH+L
Sbjct: 1260 QHLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHIL 1319

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVFSVLGIEAAR SIV EI+YTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1320 EVFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMR 1379

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKV+KGT++SE D
Sbjct: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESD 1439

Query: 1441 LIPKPCLFESLSNE-AALKAN 1460
            L PKP LFESL +   ALK N
Sbjct: 1440 LAPKPTLFESLCDSVTALKVN 1460

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 2503 bits (6487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1192/1461 (81%), Positives = 1313/1461 (89%), Gaps = 7/1461 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVV ET K+I G+EFSAL+AADIVAQSEVE++TRDLFDLEK R  +  GALD +MGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSSS EC TCHGNLASCHGHFGH+KLALPVFH+GYFK+TIQILQ ICK+CSA+LLS+ D+
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FL ELRRPG+DNLR+M ILKK++DQCKKQRRCL C                    IIH
Sbjct: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKK  PEKD W+GEW E+LTH+PELER+VKRC DDLNPLKTL LFKQ+KS DCE
Sbjct: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI++TV SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL KGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPG+S+GGGKVKPIRGFCQRLKGK
Sbjct: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLT+PEKVTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            +NGP VHPGANYLLKKNE+ARRNLRYGD++KLAK+LQ GDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D  +LTQLL MMSD   QFD+PPPAIMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            YYLWTGKQVFSLLI+P+ KSPVVINLDAKNKV++PPK KS P+EMS NDGFV+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN MNRMAKLCAR+LGNRGFSIGI+DVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             DL+ KKEE+V  AY KCDELI  F  G+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            D+TVRTSANGIVQFTYGGDGLDPL+MEGNA+PVNF RSWDHA NITF+  + GLLPY I+
Sbjct: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
               + +L PLE++L+RYDN G +V  E  D   + D++DAER FY+SLR Y+  KA  LA
Sbjct: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPD-EAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYR 1079
             +R +RG+LE+         G D   E V + ++ SV Q+Y+I++++V  FL IAL KY 
Sbjct: 1021 QIRNTRGLLEMTQ------NGGDTSMEVVSSELQASVDQVYKITKKNVNAFLTIALHKYH 1074

Query: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1075 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1134

Query: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199
            IINAVLVN+ DERAARVVKGR+EKTLLSD+A+Y+QDVY+ N+S++++R+DL TI+KLQLE
Sbjct: 1135 IINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLE 1194

Query: 1200 LTIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            LT+EDIAVA++RA KLKIQ  D+ I+GKDKI +NV+PEG KAKSISTSAKEPSEN+VFY+
Sbjct: 1195 LTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYK 1254

Query: 1260 MQQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319
            MQ LRR+LPDVVVKGL DISRAVINIRDDGKRELLVEGYGLR+VMCTDGVIGSKT TNHV
Sbjct: 1255 MQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHV 1314

Query: 1320 LEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379
            LEV SVLGIEAAR SIV EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1315 LEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1374

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEK 1439
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMS+GTGSFKV+K  +VSE+
Sbjct: 1375 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSER 1434

Query: 1440 DLIPKPCLFESLSNEAALKAN 1460
            DL  +P LFESL++E A+KAN
Sbjct: 1435 DLKVRPTLFESLASETAIKAN 1455

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2503 bits (6486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1199/1460 (82%), Positives = 1304/1460 (89%), Gaps = 3/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKE V+   PK+IKG+ FSALSAADIV+QSEVE+STRDLFDL+  R+ +  GALDP+MGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS  ECTTCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ +CK C A+LLSE DK
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            RKFL ELRRPG+DNLRRM ILKKILDQCKKQRRC  C                    IIH
Sbjct: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEK+ W+G+WK+VL +NPELERYVKRCMDDLNPLK LNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQL VAMYINSDSVNP+MLPGSS  G K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYN+HKLQ+LV
Sbjct: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            +NGP VHPGANYLLKKNEDARRNLRYGDR+KLAK LQ GDV+ERH+EDGDVVLFNRQPSL
Sbjct: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRA LTQLL MMSD   QFD+PPP+IMKP
Sbjct: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            +YLWTGKQVFSLLIKPS KSPVVINLDAKNKV++PP  K  P+EMSQNDGFV+IRGS IL
Sbjct: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             DLKQKKE++VE AY KCDELI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSW HA N+T ++   GLLPY I+
Sbjct: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
               N IL PLE++L RYDN G  ++ ED+ K E++DQ+DAER FY+SLRE++  KA TLA
Sbjct: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
            +LR  RG+ ELV+ P +EL+  + DE VP ++  +++QL +IS+  V+KFL IA+ KY +
Sbjct: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INAVLVNDNDERAARVVKGRVEKTLLSDV++YVQD+Y+DN++F+Q++ID  TI+KLQLEL
Sbjct: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            T+EDI VAI +A KLKI   D++IIGKDKI I V  +G   KSIST+ KEP  N+VFYRM
Sbjct: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            QQLRRALP +VVKG +DISRAVINIRDDGKRELLVEGYGLRDVM TDGVIGSKT TNH+L
Sbjct: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV+ VLGIEAAR  I+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMR
Sbjct: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKV+K T V E D
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L PKP LFE+L  +  +KAN
Sbjct: 1439 LTPKPTLFETLC-DTVVKAN 1457

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2482 bits (6432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1187/1460 (81%), Positives = 1305/1460 (89%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVV   PKRI GLEFSALSA+DIVAQSEVE+ TRDLFDLE  RAP+  GALD +MGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS  EC+TCHG LASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNC+ +LL+E DK
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R+FL ELRRPG+DNLRRM  LKK+LDQCKKQRRCLHC                    IIH
Sbjct: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKD W+G+W +VL H+PELERY+KR M++LNPLKTLNLFKQI   DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG  NGGGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGG-NGGGKTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+HKLQ+L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            VNG NVHPGANYLLKKNE+ARRNLRYGDR+KLAK+LQIGDV+ERHLEDGDVVLFNRQPSL
Sbjct: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT  Q+L MMSDG  QFD+PPPAIM+P
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            +YLWTGKQ+FSLLIKP+ KSPV+INLDAKNKV++ PK+K+ P+EMS NDG+VVIRGS IL
Sbjct: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             +LK  KEE+VEIAY KCDELI  + +G+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTS+NGIVQFTYGGDGLDPL MEGNA+PVNFNRSWDHA NIT+++ D+G+LPY I+
Sbjct: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            E  N IL PLE +L RYDN G  +    +++  ++DQ+DAER+FY+SLR Y++ KA  LA
Sbjct: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
            ++ KSRG+ EL +AP  ELQ MD D + P     SV+QL +IS + V+ FL+IA+ KYRK
Sbjct: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRK 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A++EPGTA+GAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INA LVND+DERAARVVKGRVEKTLLSDV +Y+QDVY+DN+SF+QV++DL TI+KLQLEL
Sbjct: 1140 INATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLEL 1199

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            T+EDIA+AIT A KLKI   DV+I+G++KI INV  +  KAKSIST A EP ENDVF++M
Sbjct: 1200 TVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKM 1259

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP +VVKGL DISRAVINIRDDGKRELLVEGYGLRDVM TDGV+G KT TNH L
Sbjct: 1260 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFL 1319

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EV+ VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1320 EVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKV+KGTN+S  D
Sbjct: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDD 1439

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L PKP LFE+L +   LK N
Sbjct: 1440 LKPKPTLFENLCSLNTLKVN 1459

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2481 bits (6429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1185/1460 (81%), Positives = 1302/1460 (89%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVV   PK+IKGL FSALSA+DIVAQSEVE+ TRDLFDLE  RAP+  GALD KMGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS  EC+TCHGNLASCHGHFGH+KLALPVFHIGYFKATIQILQ ICKNC+AILLSE +K
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R+FL ELRRPG+DNLRRM  L+K+LDQCKKQRRCLHC                    IIH
Sbjct: 121  RQFLAELRRPGIDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEK+ W+G+W +VL HNPELERY+KR MD+LNPLKTLNLFKQ+++ DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG + GG     IRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKP-IRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPE+VTRYN+HKLQ+L+
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQLI 419

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANY+LKKNEDARRNLRYGDR+KLAK++QIGDV+ERH+EDGDVVLFNRQPSL
Sbjct: 420  INGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPII+ATQDFITGSYLISHKDSF+DRAT TQLL MM+D   QFD+PPPAI+KP
Sbjct: 540  LLTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIKP 599

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
             YLWTGKQVFSLLI+P+ KSPV+INLDAKNKV++PPK+KS P+EMS NDG+V+IRGS+IL
Sbjct: 600  CYLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
             GVMDKSVLGDGKKHSVFYTILRD+GP EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 660  CGVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTPG 719

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             +LK KKEE+VEIAY KCDELI  F +GELETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 720  KELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVR+SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNTVRTS+NG+VQFTYGGDGLDPL MEGNAQPVNFNRSWDHA NITF+N++ GLLPY IM
Sbjct: 900  DNTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQIM 959

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            ET+N ILVPLE +L+R DN G  +  +     E++DQ DAERDFY+SLR Y+  KA  LA
Sbjct: 960  ETSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRLA 1019

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
             +RKS+G+  L+  P +EL+ MD D +  T    S++QL +IS   V  FL IA+ KY K
Sbjct: 1020 QIRKSKGLKSLLEEPAQELKYMDLDASASTADLNSINQLCKISYNLVTTFLNIAISKYHK 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A++EPGTA+GAIGA SIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASKVISTPI
Sbjct: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200
            INA+LVNDNDERAARVVKGR+EKTLLSDV +Y+QDVY+DN+SFIQV++DL TI+KLQLEL
Sbjct: 1140 INALLVNDNDERAARVVKGRIEKTLLSDVVFYIQDVYRDNMSFIQVKVDLSTIEKLQLEL 1199

Query: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260
            TIEDIA+AI+RA KLKI   DV+IIGK+KI I+V  +  K KSIST   EP+ENDVFYRM
Sbjct: 1200 TIEDIAIAISRAPKLKISTGDVSIIGKNKINISVGNDLEKGKSISTLVSEPNENDVFYRM 1259

Query: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320
            Q LRRALP++VVKGL DISRAVINI +DGKRELLVEGYGLRDVM TDGVIG KT TNH L
Sbjct: 1260 QHLRRALPNIVVKGLPDISRAVINILEDGKRELLVEGYGLRDVMTTDGVIGYKTKTNHFL 1319

Query: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380
            EVF VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1320 EVFEVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379

Query: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKV++GTN+S  +
Sbjct: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVRGTNISMDE 1439

Query: 1441 LIPKPCLFESLSNEAALKAN 1460
            L P P LFE+L N  ALK +
Sbjct: 1440 LKPNPTLFENLCNNTALKVS 1459

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 2473 bits (6409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1182/1452 (81%), Positives = 1311/1452 (90%), Gaps = 4/1452 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVV+SETPKRI GLEFSALS +DI+AQSEVE+STRDLFDLE  RAP   GALDPKMGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS+LEC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQILQG+CK+CSAILL++TDK
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R FLHELR+P +DNL+RM ILKKILDQCKKQRRCL C                    IIH
Sbjct: 121  RHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKK+ PEKD W+G+W +VLT+NPELE+++KRC DDLNPLKTLNLFKQIK+ DCE
Sbjct: 181  DTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDS ASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMMEHWDYLQL+VAMYINSDSVN  ++PGS NGG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPGS-NGGTKAKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP+ VAKVLTYPEKVTRYN+ KLQ+LV
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKLV 419

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            +NGPNVHPGANYLLK NE+ARRNLRYG+R KLAK L+IGD++ERHLEDGD+VLFNRQPSL
Sbjct: 420  MNGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQTEEARAEAINLMGVKN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNL    QTEEARAEAINLMGVKN
Sbjct: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVKN 539

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMK 599
            NLLTPKSGEPIIAATQDFITGSYLISHKDSF+DRATLTQLL MMSD   +FD+PPPAI K
Sbjct: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIFK 599

Query: 600  PYYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQI 659
            P  LWTGKQ+FSLLIKP+ +SPVVINLDAKNKV++PP++KS PSEMS NDG+V+IRGS+I
Sbjct: 600  PQCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEI 659

Query: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTP 719
            LSGVMDKSVLGDGKKHSVFYTILRDYGPQE+ANAMNRMAKLCAR+LGNRGFSIGI+DVTP
Sbjct: 660  LSGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTP 719

Query: 720  ADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGD 779
             ++LK KKE+LVEIAY+KCDELI  +NKGELETQPGCNEEQTLEAKIGG LSKVREEVGD
Sbjct: 720  GEELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGD 779

Query: 780  VCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 839
            VCINELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNS
Sbjct: 780  VCINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNS 839

Query: 840  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899
            KTPQSKGFVRNSFF+GL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 840  KTPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 899

Query: 900  YDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAI 959
            YDNT+RTS+NGIVQFTYGGDGLDPL+MEGNA+PVNF R+WDHA NITFD   +GLLPY I
Sbjct: 900  YDNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQI 959

Query: 960  METANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTL 1019
            ++  N IL PLE+ LVRY+N G  +  +D  K E+VDQ DA+RDFY S+REY+  KA  L
Sbjct: 960  IKQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQL 1019

Query: 1020 ANLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYR 1079
            A +RK+R + EL++ P +ELQ +D DE +P+NVR  V +L +ISE +VKKFLEIA+ KY 
Sbjct: 1020 AKIRKARSLKELISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKYH 1079

Query: 1080 KARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139
            +A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1080 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1139

Query: 1140 IINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLE 1199
            II AVLVND+D RAARVVKGR+EKTLLSDVAYY++DVY+DN +FI+++IDL TI+KLQLE
Sbjct: 1140 IIKAVLVNDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQLE 1199

Query: 1200 LTIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            LTIEDIA+AI++A KLKI + ++ I+G DKIAI+VF E   +KSISTS KE SEN VFY+
Sbjct: 1200 LTIEDIAIAISKAPKLKIDSSNIHIVGNDKIAIDVFEEA--SKSISTSLKESSENTVFYK 1257

Query: 1260 MQQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHV 1319
            MQ LRRALPDVVVKGLADISRAVINI+DD K ELLVEGYGLRDVMCTDGVIG+KT+TNH+
Sbjct: 1258 MQTLRRALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNHI 1317

Query: 1320 LEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1379
            LE+F+VLGIEAAR SIV EI+YTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKM
Sbjct: 1318 LEIFNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1377

Query: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEK 1439
            RDSVLQLASFEKTTDHLFDAAFYMKKD V+GVSECIILGQTMSIGTGSF V+K T VS +
Sbjct: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSPE 1437

Query: 1440 DLIPKPCLFESL 1451
             + PK  LFESL
Sbjct: 1438 QVKPKRTLFESL 1449

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 1981 bits (5132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/1145 (81%), Positives = 1024/1145 (89%), Gaps = 1/1145 (0%)

Query: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60
            MKEVVV   PKRIKGLEFSALSA+DIV QS+VE+STRDLFDLE  R P++ GALD +MGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120
            SSS  EC+TCHGNLASCHGHFGH+KL+LPVFH+GYFKATIQ+LQ ICK+C+A+LLSE DK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIH 180
            R+FL ELRRPG+DNLRRMGILKK++DQCKKQRRCL C                    I+H
Sbjct: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            DTFRWVGKKSAPEKD WVG+WK VL+HNPELERYVK+CMDDLNPLKTLNLFKQ+   DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GID+TV SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
            AGL+KGISINNMME WDYLQL VAMYINSDSVNPAM+PG S GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGG-KTKPIRGFCQRLKGK 359

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            QGRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLTYPE VTRYN+ KLQ+LV
Sbjct: 360  QGRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLV 419

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
            +NGPN HPGANYLLKK+E+ARRNLRYGDR+KLAK+LQ GD++ERHLEDGDVVLFNRQPSL
Sbjct: 420  INGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSL 479

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 480  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600
            LLTPKSGEPIIAATQDFITGSYLISHKDSFY RA   QLL MMSDG  QFD+PPPAIMKP
Sbjct: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKP 599

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660
            YY+WTGKQVFSLLI+P+ KS VVINLDAKNKV++PPK K LP+EMS NDGFVVIRGSQIL
Sbjct: 600  YYMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQIL 659

Query: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720
            SGVMDKSVLGDGKKHSVFYTILRD+GP+EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPG 719

Query: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780
             +LK KKE +VE AY KCD+LI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 720  FELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 779

Query: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840
            CI ELDN N+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 780  CIKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSK 839

Query: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899

Query: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960
            DNT+RTS+NGIVQFTYGGDGLDP++MEGNAQPVNF RSWDHA NITF++ D+ LLPY IM
Sbjct: 900  DNTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIM 959

Query: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020
            +  N IL PLE++LVRYDN G  +    +D+AE +DQ DAER+FY+SLREY++ KA+ LA
Sbjct: 960  QQTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLA 1019

Query: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080
             +R  +G+ + ++ P  ELQ MD DE  P+ +  SV QL +IS + V KFLEIA+FKY K
Sbjct: 1020 KIRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHK 1079

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            A++EPGTA+GA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 AKVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1141 INAVL 1145
            INAVL
Sbjct: 1140 INAVL 1144

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1719

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/1507 (34%), Positives = 781/1507 (51%), Gaps = 151/1507 (10%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ + S  ++   +  D  + RA +  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRSISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKR-KFL 124
            +C TC   +  C GHFGH+ LA PVFHIG+     ++ + IC +C  +LL E +++ + +
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENNEQMRQV 125

Query: 125  HELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTFR 184
              ++    D+ +R      I   CK +  C                           T R
Sbjct: 126  MSIK----DSKKR---FNAIWTLCKTKTVC---ETDVPSEDDPTQLISRGGCGNAQPTIR 175

Query: 185  WVGKKSAPEKDIWVGEWKEVLTHNP--ELERYVKRCMDDLNPLKTLNLFKQIKSADCELL 242
              G K        VG WK+    N   E E+ V      LN  + LN+FK I   D   L
Sbjct: 176  KDGLK-------LVGSWKKDKATNDGDEPEQRV------LNTEEILNIFKHISVHDSNTL 222

Query: 243  GIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
            G +      RP+  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEQF--ARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQ 361
               G   + + E    LQ  +A Y+++D +  P  L  S       +P++    RLKGK+
Sbjct: 280  EHNGAPHHAIEEAESLLQFHIATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 362  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELVV 421
            GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L +LV 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 422  NGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSLH 481
            NGPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 482  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 541
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCSVPLQI 511

Query: 542  LTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMS-----DGVEQFDVPPPA 596
            ++P+S +P +   QD + G   ++ +D F +   L QLL M+      DG+    +P PA
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRKLTLRDCFIE---LDQLLNMLYWVPDWDGI----IPTPA 564

Query: 597  IMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVVI 654
            I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G ++I
Sbjct: 565  IIKPVPLWSGKQILSIAI------PKGIHLQRFDEGTTMLSPK----------DNGMLII 608

Query: 655  RGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGI 714
             G QI+ GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS GI
Sbjct: 609  DG-QIIFGVVDKKTVGSSNG-GLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGFSTGI 666

Query: 715  NDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVR 774
             D        ++  E +  A RK +E+        L  + G    ++ E  +  FL++ R
Sbjct: 667  GDTIADGGTMKEITETIADAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 775  EEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 834
            ++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727  DKAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPH 786

Query: 835  FPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 894
            F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787  FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 895  DLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFDNQDE 952
            D+   YD+T R S   ++QF YG DG+D   +E  +       + +++  Y I   + + 
Sbjct: 847  DIMVHYDSTTRNSLGNVIQFVYGEDGIDAGHIEKQSIDTIGGSDAAFEKRYRIDLMSPNH 906

Query: 953  GLLPYAIMETANKIL--VPLEDRL-VRY----DNRGFL----VKDEDK-----------D 990
             L P +++E+  +I   V L+  L   Y    D+R FL    +  E              
Sbjct: 907  ALDP-SLLESGLEITGDVKLQSILDTEYKQLVDDRRFLRNVFIDGEPNWHLPVNIRRIIQ 965

Query: 991  KAEHVDQYDAERDFYRSLREYINLKATTLANLRKSRGMLELVNAPPKELQGMDPDEAVPT 1050
             A+   + D  +    ++ E I   A    NL   RG  +++    +E Q  D       
Sbjct: 966  NAQQTFRIDHTKPSDLTINEVIRDVARLQENLLVLRGKGKII----EEAQN-DAITLFCC 1020

Query: 1051 NVRTSVS-----QLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMT 1105
             VR+ ++     Q YR+++Q+ +  L     ++ ++ + PG  +G + AQSIGEP TQMT
Sbjct: 1021 LVRSRLAVRRVLQEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMT 1080

Query: 1106 LKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEK 1163
            L TFHFAGVAS  VT GVPR+KEI+N +K + TP     L  +   D+  A++++  +E 
Sbjct: 1081 LNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLDPEYATDQEKAKIIRSAIEH 1140

Query: 1164 TLLSDVA-----YYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL--- 1200
            T L  V      YY  D    V  ++   IQ+   L        ID      L+LEL   
Sbjct: 1141 TTLKSVTVASEIYYDPDPTTTVIAEDEEIIQLHYSLMDSETEKNIDNQSPWLLRLELDRA 1200

Query: 1201 TIEDIAVAITRASKLKIQAP---DVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVF 1257
             + D  + + +  + KI+     D+++I  +  A  +       +  S  A+  +E D  
Sbjct: 1201 AMNDKDLTMVQVGE-KIKETFRNDLSVIWSEDNADKLIIRCRVVRPKSLDAETEAEED-- 1257

Query: 1258 YRMQQLRRA-LPDVVVKGLADISRAVINIRD------DGKRE------LLVEGYGLRDVM 1304
            + ++++    L  + ++G+ DI R V+   D       G+ +      L  +G  L +VM
Sbjct: 1258 HMLKKIENTMLESITLRGVEDIERVVMMKYDRKMPSETGEYQKVPEWVLETDGVNLMEVM 1317

Query: 1305 CTDGVIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTY 1364
               GV GS+  TN  +++  VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVMT 
Sbjct: 1318 TVPGVDGSRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTT 1377

Query: 1365 KGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIG 1424
            +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IG
Sbjct: 1378 QGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIG 1437

Query: 1425 TGSFKVI 1431
            TG+F V+
Sbjct: 1438 TGAFDVM 1444

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
            Ashbya gossypii ADR086C
          Length = 1743

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1515 (33%), Positives = 779/1515 (51%), Gaps = 154/1515 (10%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMG 59
            M +   S  P R IK ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G
Sbjct: 1    MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETD 119
                + +C TC   +  C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE-- 117

Query: 120  KRKFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                 +EL R  +   D  RR      +   CK +   + C                   
Sbjct: 118  ----YNELMRQAIKIKDPKRR---FNAVWSLCKSK---MVCDTEVPSEDDPSKYISRGGC 167

Query: 177  XIIHDTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKS 236
                 + R  G          VG WK+   ++ + ++  KR    L+  + LN+FK I  
Sbjct: 168  GNAQPSIRKDGLS-------LVGTWKKD-KNSEDSDQPEKRI---LSAEEILNVFKHITP 216

Query: 237  ADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTS 296
             D   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217  EDSLRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 297  SLIKAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              ++     G   + + E    LQ  VA Y+++D    A  P +    G+  PI+    R
Sbjct: 274  INVQRLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRAR 328

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            LKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L
Sbjct: 329  LKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRL 388

Query: 417  QELVVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNR 476
             +LV NGPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH+ D D VLFNR
Sbjct: 389  TQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNR 446

Query: 477  QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 536
            QPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447  QPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 537  VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMS-----DGVEQFD 591
            V   +++P+S +P +   QD + G   ++ +D+F +   L Q+L M+      DGV    
Sbjct: 507  VPQQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGV---- 559

Query: 592  VPPPAIMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQND 649
            +P P I+KP  LW+GKQ+ S+ I      P  I+L    +   ++ PK          ++
Sbjct: 560  IPKPTILKPKPLWSGKQLLSMAI------PNGIHLQRFDEGTTYLSPK----------DN 603

Query: 650  GFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRG 709
            G ++I G QI+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L + G
Sbjct: 604  GMLIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNG 661

Query: 710  FSIGINDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGF 769
            FSIGI D    +   ++  E + +A ++  E+        L  + G    ++ E  +  F
Sbjct: 662  FSIGIGDTIADEKTMREITEAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRF 721

Query: 770  LSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQD 829
            L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ + G R+  GF D
Sbjct: 722  LNEARDKAGRSAELNLRDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFAD 781

Query: 830  RSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRL 889
            R+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL
Sbjct: 782  RTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRL 841

Query: 890  MKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITF 947
            +K+LED+   YD T R S   I+QF YG DG+D   +E  +       + +++  Y I  
Sbjct: 842  VKALEDIMVHYDGTTRNSLGNIIQFVYGEDGMDASHIEKQSIDTIPGSDLAFEKRYRIDL 901

Query: 948  DNQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQ---------- 997
             N + GL P +++E+A +I+  L+ + +  +    LV+D    ++  +D           
Sbjct: 902  LNPEYGLDP-SLLESATEIMGDLKLQNMLDEEYKQLVQDRQLLRSVFLDGEHNWPLPVNI 960

Query: 998  ----YDAERDFYRSLREYINLKATTLA-NLRKSRGMLELVNAPPKELQGMDPDEAVPTNV 1052
                 +A++ F     +  +L    +   +RK +  L ++      L+    + AV    
Sbjct: 961  RRIIQNAQQTFRIDTTKPTDLTIKDVVLGVRKLQDNLLVLRGSSNILKEAQ-ENAVTLFC 1019

Query: 1053 RTSVSQL--------YRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQM 1104
                S+L        YR+++Q+ +  L     ++ ++ + PG  +G + AQSIGEP TQM
Sbjct: 1020 SLVRSRLATRRVLTEYRLTKQTFQWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQM 1079

Query: 1105 TLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVE 1162
            TL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  D   D+  A++++  +E
Sbjct: 1080 TLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLNEDYAADQEKAKLIRSAIE 1139

Query: 1163 KTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKLKIQAPDV 1222
             T L  V    +  Y  + S   +  D   I   QL  ++ D        + LK Q+P +
Sbjct: 1140 HTTLKSVTVSSEIYYDPDPSSTVIEEDEEII---QLHFSLMDEET----ENSLKHQSPWL 1192

Query: 1223 TIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVF------------------------- 1257
              +  D+ A+N   +      +    KE  +ND+F                         
Sbjct: 1193 LRLELDRAAMN--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAENLIIRCRVVRDPKTLD 1250

Query: 1258 --------YRMQQLRRA-LPDVVVKGLADISRAVINIRD------DGKRE------LLVE 1296
                    + ++++    L  + ++G+ DI+R V+   D       G+        L  +
Sbjct: 1251 AEAEAEEDHMLKKIENTMLESITLRGVQDITRVVMMKYDRKVPNETGEYHKVPEWVLETD 1310

Query: 1297 GYGLRDVMCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQ 1356
            G  L +VM   GV  ++  TN  +++ +VLGIEA R ++ RE+   +++ G  V+ RH+ 
Sbjct: 1311 GVNLSEVMTVPGVDPTRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMA 1370

Query: 1357 LLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECII 1416
            LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +I
Sbjct: 1371 LLVDVMTSQGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGASAELDDCNGVSENVI 1430

Query: 1417 LGQTMSIGTGSFKVI 1431
            LGQ   IGTG+F V+
Sbjct: 1431 LGQMAPIGTGAFDVM 1445

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1721

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1503 (33%), Positives = 784/1503 (52%), Gaps = 144/1503 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKR-KFL 124
            +C TC   ++ C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +++ + +
Sbjct: 66   KCQTCQEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENNEQMRQV 125

Query: 125  HELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTFR 184
              ++ P     +R      +   CK +   + C                        T R
Sbjct: 126  MAIKDPK----KRFNATWAL---CKTK---MVCETDVPSENDPTKLVSRGGCGNTQPTVR 175

Query: 185  WVGKKSAPEKDIWVGEWKEVLT-HNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELLG 243
              G K        VG WK   T    E E+ V      L+  + LN+FK I + D   LG
Sbjct: 176  KDGLK-------LVGSWKRKKTIEGEEPEQRV------LSTEEILNIFKHISTEDFIRLG 222

Query: 244  IDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGL 303
             +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 223  FNEEF--SRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 279

Query: 304  DKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQG 362
              G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+G
Sbjct: 280  HNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEG 333

Query: 363  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELVVN 422
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +LV N
Sbjct: 334  RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRN 393

Query: 423  GPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSLHR 482
            GPN HPGA Y++++N D R +LRY  R    + LQ G  +ERH+ D D VLFNRQPSLH+
Sbjct: 394  GPNEHPGAKYVIRENGD-RIDLRYSKRAGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHK 451

Query: 483  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 542
            +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 452  MSMMAHKVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 511

Query: 543  TPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSD--GVEQFDVPPPAIMKP 600
            +P+S +P +   QD + G  +++ +D+F +   +  +L  + D  GV    +P PAI+KP
Sbjct: 512  SPQSNKPCMGIVQDTLCGIRILTLRDTFLELDHVLNMLYWVPDWDGV----IPTPAILKP 567

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVVIRGSQ 658
              LWTGKQ+ S+ I      P  I+L    +    + PK          ++G ++I G Q
Sbjct: 568  KPLWTGKQILSVAI------PNGIHLQRFDEGTTLLSPK----------DNGMLIIDG-Q 610

Query: 659  ILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIND-V 717
            I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +L + GFS GI D +
Sbjct: 611  IIFGVVDKKTVGSSSG-GLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTGIGDTI 669

Query: 718  TPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEV 777
                 +K+  E + E A +K +E+        L  + G    ++ E  +  FL++ R++ 
Sbjct: 670  ADGATIKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKA 728

Query: 778  GDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPK 837
            G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K
Sbjct: 729  GRLAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSK 788

Query: 838  NSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLS 897
            +  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+ 
Sbjct: 789  DDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIM 848

Query: 898  CQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFDNQDEGLL 955
              YDNT R S   ++QF YG DG+D   +E  +       + +++  Y I   N    L 
Sbjct: 849  VHYDNTTRNSLGNVIQFIYGEDGIDASYIEKQSLDTIGGSDAAFEKKYRIDLMNVQNSLD 908

Query: 956  PYAIMETANKILVPLEDRLVRYDNRGFLVKDE--------DKD--------------KAE 993
            P  ++E+ ++I   L+ + +  +    LVKD         D +               A+
Sbjct: 909  P-TLLESGSEITGDLKLQTLLDEEYKQLVKDRAFLRNVFVDGESNWPLPVNIRRIIQNAQ 967

Query: 994  HVDQYDAERDFYRSLREYINLKATTLANLRKSRGMLELVNAPPKELQGMDPDEAVPTNVR 1053
               + D  +    ++R+ I+      + L   RG  E++     E    D        VR
Sbjct: 968  QTFRIDHSKPSDLTIRDIIDSVNELQSKLLVLRGKSEII-----ERAQTDAVTLFCCLVR 1022

Query: 1054 TSVS-----QLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKT 1108
            + ++     + YR+++++    L     ++ ++ + PG  +G + AQSIGEP TQMTL T
Sbjct: 1023 SRLATRRVLKEYRLTKEAFNWVLNNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNT 1082

Query: 1109 FHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLL 1166
            FHFAGVAS  VT GVPR+KEI+N +K + TP +   L +D  +D+  A++++  +E T L
Sbjct: 1083 FHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKLIRSAIEHTTL 1142

Query: 1167 SDVA-----YYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL-----T 1201
              V      YY  D    V +++   IQ+   L       ++D+     L+LEL      
Sbjct: 1143 KSVTVASEIYYDPDPRSTVIEEDEEIIQLHFSLLDDEMESSLDQQSPWLLRLELDRAAMN 1202

Query: 1202 IEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRMQ 1261
             +D+ +        +    D+ +I  +  A  +       +  S  A+  +E D  + ++
Sbjct: 1203 DKDLTMGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETEAEED--HMLK 1260

Query: 1262 QLRRA-LPDVVVKGLADISRAVINIRD------DGKRE------LLVEGYGLRDVMCTDG 1308
            ++    L ++ ++G+ +I R V+   D       G+ +      L  +G  L +VM   G
Sbjct: 1261 KIENTMLENITLRGVENIERVVMMKYDRKVPNESGEYQKVPEWVLESDGVNLAEVMQVPG 1320

Query: 1309 VIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEV 1368
            V  ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G +
Sbjct: 1321 VDATRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGL 1380

Query: 1369 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSF 1428
              +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F
Sbjct: 1381 TSVTRHGFNRSNTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQMAPIGTGAF 1440

Query: 1429 KVI 1431
             V+
Sbjct: 1441 DVM 1443

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1685

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1504 (33%), Positives = 775/1504 (51%), Gaps = 145/1504 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  +V   +  D  + RA +  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKVRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKR-KFL 124
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +++ + +
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNEQMRQV 125

Query: 125  HELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTFR 184
             +++ P     +R      +   CK +   + C                        T R
Sbjct: 126  LKIKDPK----KR---FNAVWSLCKTK---MICETDVPSENDPTQLISRGGCGNAQPTVR 175

Query: 185  WVGKKSAPEKDIWVGEWKE--VLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELL 242
              G K        VG WK+    +   E E+ V      L   + LN+FK I   D   L
Sbjct: 176  KDGLK-------LVGSWKKDKATSDGEEPEQRV------LGVEEILNIFKHISPEDSTKL 222

Query: 243  GIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
            G D      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFDEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQ 361
               G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 362  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELVV 421
            GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +LV 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVR 393

Query: 422  NGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSLH 481
            NGPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLH 451

Query: 482  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 541
            ++S++SH  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMSHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 542  LTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSD--GVEQFDVPPPAIMK 599
            ++P+S +P +   QD + G  +++ KD+F +   +  +L  + D  G+    +P PAI+K
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRILTLKDTFLEFDHVLNMLYWVPDWDGI----IPTPAILK 567

Query: 600  PYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVVIRGS 657
            P  LWTGKQ+ S  I      P  I+L    +    + PK          ++G ++I G 
Sbjct: 568  PKPLWTGKQILSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLIIDG- 610

Query: 658  QILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDV 717
            QI+ GV+DK  +G      + + + R+ GPQ  +     + K+   +L + GFS GI D 
Sbjct: 611  QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFSTGIGDT 669

Query: 718  TPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEV 777
                +  ++  E +  A +K +E+        L  + G    ++ E  +  FL++ R++ 
Sbjct: 670  IANGETIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKA 729

Query: 778  GDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPK 837
            G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K
Sbjct: 730  GRLAEVNLNDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSK 789

Query: 838  NSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLS 897
            +  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+ 
Sbjct: 790  DDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIM 849

Query: 898  CQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFDNQDEGLL 955
              YD T R S   I+QF YG DG+D   +E  +       + +++  Y I     +  L 
Sbjct: 850  VHYDGTTRNSLGNIIQFIYGEDGIDASHIEKQSLDTIGGSDAAFEKRYRIDLLKVENSLD 909

Query: 956  PYAIMETANKI-----LVPLEDRLVR--YDNRGFLVK---DEDKD------------KAE 993
            P +++E+ ++I     L  L D   R   ++R FL K   D + +             A+
Sbjct: 910  P-SLLESGSEITGDLKLQVLLDEEYRQLVEDRAFLRKVFTDGESNWPLPVNIRRIIQNAQ 968

Query: 994  HVDQYDAERDFYRSLREYINLKATTLANLRKSRGMLELVNAPPKELQGMDPDEAVPTNVR 1053
               + D  +    ++R+ I         L   RG  E+V    ++   +           
Sbjct: 969  QTFRIDHSKPSDLTIRDIIKGVRELQEKLLVLRGKNEIVQQAQQDAITLFCCLVRSRLAT 1028

Query: 1054 TSVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAG 1113
              V Q YR++++S    +     ++ ++ + PG  +G + AQSIGEP TQMTL TFHFAG
Sbjct: 1029 RRVIQEYRLTKESFDWVINNIESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG 1088

Query: 1114 VASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVA- 1170
            VAS  VT GVPR+KEI+N +K + TP +   L      D+  A+ ++  +E T L  V  
Sbjct: 1089 VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEEKYAADQERAKYIRSAIEHTTLKSVTV 1148

Query: 1171 ----YYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL-----TIEDIA 1206
                YY  D    V +D+   IQ+   L       ++D+     L+LEL       +D+ 
Sbjct: 1149 ASEIYYDPDPRSTVIEDDEEIIQLHFSLLDEEMEASLDQQSPWLLRLELDRAAMNDKDLT 1208

Query: 1207 VAITRASKLKIQAPDVTII----GKDKIAIN---VFPEGYKAKSISTSAKEPSENDVFYR 1259
            +        +    D+ +I      +K+ I    V P+G  A++      E  E+ +  +
Sbjct: 1209 MGQVGERIKETFKKDLFVIWSEDNAEKLIIRCRVVRPKGLDAET------EAEEDHMLKK 1262

Query: 1260 MQQLRRALPDVVVKGLADISRAVINIRD------DGKRE------LLVEGYGLRDVMCTD 1307
            ++     L ++ ++G+ +I R V+   D       G+ +      L  +G  L +VM   
Sbjct: 1263 IENT--MLENITLRGVENIERVVMMKYDRKVPSKTGEFQKVPEWVLETDGVNLAEVMTIP 1320

Query: 1308 GVIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGE 1367
            GV  ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G 
Sbjct: 1321 GVDTTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTCQGG 1380

Query: 1368 VLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGS 1427
            +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+
Sbjct: 1381 LTSVTRHGFNRANTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGA 1440

Query: 1428 FKVI 1431
            F V+
Sbjct: 1441 FGVM 1444

>Suva_4.104 Chr4
            complement(193257..193711,193754..193782,194161..198878)
            [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1505 (33%), Positives = 773/1505 (51%), Gaps = 147/1505 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            EL R  +   D  +R G +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDTKKRFGAIWTL---CKTK---MVCETDVPSENDPTQLVSRGGCGNTQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLT----HNPELERYVKRCMDDLNPLKTLNLFKQIKSAD 238
             R  G K        VG WK+         PEL          L+  + LN+FK I + D
Sbjct: 174  VRKDGLK-------LVGSWKKDRATGDADEPELRV--------LSTEEILNIFKHISAKD 218

Query: 239  CELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  SSSLGFNEVF--SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRL 357
            ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELVVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQ 477
            +LV NGPN HPGA Y+++ + D R +LRY  R    + LQ G  +ERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMS-----DGVEQFDV 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L M+      DGV    +
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDG 650
            P PAI+KP  LW+GKQV S+ I      P  I+L    +    + PK          ++G
Sbjct: 561  PTPAIIKPKPLWSGKQVLSVAI------PNGIHLQRFDEGTTLLSPK----------DNG 604

Query: 651  FVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGF 710
             ++I G QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GF
Sbjct: 605  MLIIDG-QIVFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGF 662

Query: 711  SIGINDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFL 770
            S GI D        ++  E +  A +K  ++        L  + G    ++ E  +  FL
Sbjct: 663  STGIGDTIADGPTMREITETIADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFL 722

Query: 771  SKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDR 830
            ++ R++ G +    L + N    M   GSKGS +N++QM A VGQQ + G R+  GF DR
Sbjct: 723  NEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDR 782

Query: 831  SLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLM 890
            +LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+
Sbjct: 783  TLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLV 842

Query: 891  KSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFD 948
            K+LED+   YDNT R S   ++QF YG DG+D   +E  +       + +++  Y I   
Sbjct: 843  KALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDASHIEKQSLDTIGGSDAAFEKRYRIDLL 902

Query: 949  NQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQ----------- 997
            N D  L P +++E+ ++IL  L+ +++  +    LVKD    +   VD            
Sbjct: 903  NPDHILDP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRSFLRHIFVDGEANWPLPVNIR 961

Query: 998  ---YDAERDFYRSLREYINLKATTLA--------NLRKSRGMLELVNAPPKELQGMDPDE 1046
                +A++ F+    +  +L    +         NL   RG  E++    ++   +    
Sbjct: 962  RIIQNAQQTFHIDHTKPSDLTIKDIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCL 1021

Query: 1047 AVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTL 1106
                     V Q Y++++Q+ +  L     ++ ++ + PG  +G + AQSIGEP TQMTL
Sbjct: 1022 LRSRLASRRVIQEYKLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1107 KTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRVEKT 1164
             TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A+ ++  +E T
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEKAKFIRSAIEHT 1141

Query: 1165 LLSDVA-----YYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL---T 1201
             L  V      YY  D    V  ++   IQ+   L       + D+     L+LEL    
Sbjct: 1142 TLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAA 1201

Query: 1202 IEDIAVAITRASKLKIQA--PDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            + D  + + +  +   Q    D+ +I  +     +       +  S  A+  +E D  + 
Sbjct: 1202 MNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEED--HM 1259

Query: 1260 MQQLRRA-LPDVVVKGLADISRAVINIRD------------DGKRELLVEGYGLRDVMCT 1306
            ++++    L ++ ++G+ +I R V+   D            + +  L  +G  L +VM  
Sbjct: 1260 LKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYIKEPEWVLETDGVNLSEVMTV 1319

Query: 1307 DGVIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKG 1366
             G+  ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQG 1379

Query: 1367 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1426
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTG 1439

Query: 1427 SFKVI 1431
            +F V+
Sbjct: 1440 AFDVM 1444

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
            YDL140C (REAL)
          Length = 1719

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1506 (33%), Positives = 777/1506 (51%), Gaps = 149/1506 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            EL R  +   D+ +R   +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLT----HNPELERYVKRCMDDLNPLKTLNLFKQIKSAD 238
             R  G K        VG WK+         PEL          L+  + LN+FK I   D
Sbjct: 174  VRKDGLK-------LVGSWKKDRASGDAEEPELRV--------LSTEEILNIFKHISVKD 218

Query: 239  CELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  FTSLGFNEVF--SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRL 357
            ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELVVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQ 477
            +LV NGPN HPGA Y+++ + D R +LRY  R    + LQ G  +ERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMS-----DGVEQFDV 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L M+      DGV    +
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDG 650
            P PAI+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G
Sbjct: 561  PTPAIIKPKPLWSGKQILSVAI------PNGIHLQRFDEGTTLLSPK----------DNG 604

Query: 651  FVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGF 710
             ++I G QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GF
Sbjct: 605  MLIIDG-QIIFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGF 662

Query: 711  SIGINDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFL 770
            S GI D        ++  E +  A +K  ++        L  + G    ++ E  +  FL
Sbjct: 663  STGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFL 722

Query: 771  SKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDR 830
            ++ R++ G +    L + N    M   GSKGS +N++QM A VGQQ + G R+  GF DR
Sbjct: 723  NEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDR 782

Query: 831  SLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLM 890
            +LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+
Sbjct: 783  TLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLV 842

Query: 891  KSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFD 948
            K+LED+   YDNT R S   ++QF YG DG+D   +E  +       + +++  Y I   
Sbjct: 843  KALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRIDLL 902

Query: 949  NQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSL 1008
            N +  L P +++E+ ++IL  L+ +++  +    LVKD    +   VD  +A      ++
Sbjct: 903  NTEHILDP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDG-EANWPLPVNI 960

Query: 1009 REYINLKATT--LANLRKSRGMLELVNAPPKELQG-----MDPDEAVPTNVRTSVS---- 1057
            R  I     T  + + + S   ++ +    K+LQG        +E +    R +V+    
Sbjct: 961  RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQGSLLVLRGKNEIIQNAQRDAVTLFCC 1020

Query: 1058 ------------QLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMT 1105
                        Q YR+++Q+    L     ++ ++ + PG  +G + AQSIGEP TQMT
Sbjct: 1021 LLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMT 1080

Query: 1106 LKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRVEK 1163
            L TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E 
Sbjct: 1081 LNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEH 1140

Query: 1164 TLLSDVA-----YYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL--- 1200
            T L  V      YY  D    V  ++   IQ+   L       + D+     L+LEL   
Sbjct: 1141 TTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRA 1200

Query: 1201 TIEDIAVAITRASKLKIQA--PDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFY 1258
             + D  + + +  +   Q    D+ +I  +     +       +  S  A+  +E D  +
Sbjct: 1201 AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEED--H 1258

Query: 1259 RMQQLRRA-LPDVVVKGLADISRAVINIRD------------DGKRELLVEGYGLRDVMC 1305
             ++++    L ++ ++G+ +I R V+   D            + +  L  +G  L +VM 
Sbjct: 1259 MLKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMT 1318

Query: 1306 TDGVIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYK 1365
              G+  ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +
Sbjct: 1319 VPGIDATRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQ 1378

Query: 1366 GEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGT 1425
            G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGT
Sbjct: 1379 GGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGT 1438

Query: 1426 GSFKVI 1431
            G+F V+
Sbjct: 1439 GAFDVM 1444

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
            RPO21RNA polymerase II largest subunit B220, part of
            central core; phosphorylation of C-terminal heptapeptide
            repeat domain regulates association with transcription
            and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1505 (33%), Positives = 773/1505 (51%), Gaps = 147/1505 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            EL R  +   D+ +R   +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLT----HNPELERYVKRCMDDLNPLKTLNLFKQIKSAD 238
             R  G K        VG WK+         PEL          L+  + LN+FK I   D
Sbjct: 174  IRKDGLK-------LVGSWKKDRATGDADEPELRV--------LSTEEILNIFKHISVKD 218

Query: 239  CELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  FTSLGFNEVF--SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRL 357
            ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELVVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQ 477
            +LV NGPN HPGA Y+++ + D R +LRY  R    + LQ G  +ERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMS-----DGVEQFDV 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L M+      DGV    +
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDG 650
            P PAI+KP  LW+GKQ+ S+ I      P  I+L    +    + PK          ++G
Sbjct: 561  PTPAIIKPKPLWSGKQILSVAI------PNGIHLQRFDEGTTLLSPK----------DNG 604

Query: 651  FVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGF 710
             ++I G QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GF
Sbjct: 605  MLIIDG-QIIFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGF 662

Query: 711  SIGINDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFL 770
            S GI D        ++  E +  A +K  ++        L  + G    ++ E  +  FL
Sbjct: 663  STGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFL 722

Query: 771  SKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDR 830
            ++ R++ G +    L + N    M   GSKGS +N++QM A VGQQ + G R+  GF DR
Sbjct: 723  NEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDR 782

Query: 831  SLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLM 890
            +LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+
Sbjct: 783  TLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLV 842

Query: 891  KSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFD 948
            K+LED+   YDNT R S   ++QF YG DG+D   +E  +       + +++  Y +   
Sbjct: 843  KALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLL 902

Query: 949  NQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQ----------- 997
            N D  L P +++E+ ++IL  L+ +++  +    LVKD    +   VD            
Sbjct: 903  NTDHTLDP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNIR 961

Query: 998  ---YDAERDFY--RSLREYINLKATTLA------NLRKSRGMLELVNAPPKELQGMDPDE 1046
                +A++ F+   +    + +K   L       NL   RG  E++    ++   +    
Sbjct: 962  RIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCL 1021

Query: 1047 AVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTL 1106
                     V Q YR+++Q+    L     ++ ++ + PG  +G + AQSIGEP TQMTL
Sbjct: 1022 LRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1107 KTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRVEKT 1164
             TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHT 1141

Query: 1165 LLSDVA-----YYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL---T 1201
             L  V      YY  D    V  ++   IQ+   L       + D+     L+LEL    
Sbjct: 1142 TLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAA 1201

Query: 1202 IEDIAVAITRASKLKIQA--PDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            + D  + + +  +   Q    D+ +I  +     +       +  S  A+  +E D  + 
Sbjct: 1202 MNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEED--HM 1259

Query: 1260 MQQLRRA-LPDVVVKGLADISRAVINIRD------------DGKRELLVEGYGLRDVMCT 1306
            ++++    L ++ ++G+ +I R V+   D            + +  L  +G  L +VM  
Sbjct: 1260 LKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTV 1319

Query: 1307 DGVIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKG 1366
             G+  ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQG 1379

Query: 1367 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1426
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTG 1439

Query: 1427 SFKVI 1431
            +F V+
Sbjct: 1440 AFDVM 1444

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1720

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1507 (33%), Positives = 783/1507 (51%), Gaps = 138/1507 (9%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMG 59
            M +   S  P R IK ++F   S  ++   S  ++   +  D  + +A +  G  DP++G
Sbjct: 1    MVDFPYSSAPLRTIKEVQFGLFSPEEVRGISVAKIEFPETMDESQMKA-KIGGLNDPRLG 59

Query: 60   VSSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETD 119
                + +C TC   +A C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNYKCQTCGEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLLDE-- 117

Query: 120  KRKFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                 +E  R  +   D  RR   +  +   CK +   + C                   
Sbjct: 118  ----YNEQMRQAIKIKDPKRRFNAVWTL---CKAK---MVCETEVPSPDDPTVFLSRGGC 167

Query: 177  XIIHDTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKS 236
              I  + R  G          VG WK+    + + ++  KR    ++  + LN+FK I  
Sbjct: 168  GHIQPSIRKDGLS-------LVGTWKKDKNAD-DSDQPEKRI---ISAEEILNVFKHISP 216

Query: 237  ADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTS 296
             D   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217  EDGWRLGFNEDF--SRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 297  SLIKAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              ++     G   + + E    LQ  VA Y+++D    A  P +    G+  PI+    R
Sbjct: 274  INVQKLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRAR 328

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            LKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L
Sbjct: 329  LKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRL 388

Query: 417  QELVVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNR 476
             +LV NGPN HPGA Y+++++ D R +LRY  R    + LQ G  +ERH+ D D VLFNR
Sbjct: 389  TQLVRNGPNEHPGAKYVIRESGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNR 446

Query: 477  QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 536
            QPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447  QPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 537  VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMS-----DGVEQFD 591
            V   +++P+S +P +   QD + G   ++ +D+F +   L Q+L M+      DG+    
Sbjct: 507  VPLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGI---- 559

Query: 592  VPPPAIMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQND 649
            +P PAI+KP  LW+GKQV S+ I      P  I+L        F+ PK          ++
Sbjct: 560  IPTPAILKPVPLWSGKQVLSMAI------PNGIHLQRFDDGTTFLSPK----------DN 603

Query: 650  GFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRG 709
            G ++I G +I+ GV+DK  +G      + + + R+ GP+  A   + + K+   +L + G
Sbjct: 604  GMLIIDG-KIIFGVVDKKTVGSSSG-GLIHVVTREKGPEICARLFSNIQKVVNYWLLHNG 661

Query: 710  FSIGINDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGF 769
            FSIGI D    +   ++  E + +A +K +++        L  + G    ++ E  +  +
Sbjct: 662  FSIGIGDTIADEKTMREITEAIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRY 721

Query: 770  LSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQD 829
            L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ + G R+  GF D
Sbjct: 722  LNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFAD 781

Query: 830  RSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRL 889
            R+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL
Sbjct: 782  RTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRL 841

Query: 890  MKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITF 947
            +K+LED+   YD T R S   ++QF YG DG+D   +E  +       + +++  Y I  
Sbjct: 842  VKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIEKQSIDTIPGSDSAFERRYRIDL 901

Query: 948  DNQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQ---------- 997
             N++  L P +++E+ ++I+   + +L+  D    LV D    +   VD           
Sbjct: 902  LNEEYALDP-SLLESGSEIIGDSKLQLLLNDEYKQLVDDRQILRRVFVDGEHNWPLPVNI 960

Query: 998  ----YDAERDFYRSLREYINLK-ATTLANLRKSRGMLELVNAPPKELQGMDPDEA----- 1047
                 ++++ F     +  +L     ++ +RK +  L +V      L+    +       
Sbjct: 961  KRIIQNSQQTFRIDQTKPTDLTIEDVISGVRKLQEKLLVVRGKSDILKEAQQNAITLFCC 1020

Query: 1048 -VPTNVRT-SVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMT 1105
             + + + T  V + YR++ Q+    L     ++ ++ + PG  +G + AQSIGEP TQMT
Sbjct: 1021 LLRSRLATRRVIEEYRLNRQTFDWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMT 1080

Query: 1106 LKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEK 1163
            L TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  +   D+  A+ ++  +E 
Sbjct: 1081 LNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDPEYAADQEKAKEIRSAIEH 1140

Query: 1164 TLLSDVA-----YYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL--- 1200
            T L  V      YY  D    V +D+   IQ+   L       ++D      L+LEL   
Sbjct: 1141 TTLKSVTVASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEKSLDYQSPWLLRLELDRA 1200

Query: 1201 --TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSIST--SAKEPSENDV 1256
              T +D+ +        +    D+ +I  +  A  +       +   T  +  E  E+ +
Sbjct: 1201 AMTDKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVIRDPKTLDADVEAEEDHM 1260

Query: 1257 FYRMQQLRRALPDVVVKGLADISRAVINIRD------DGKRE------LLVEGYGLRDVM 1304
              +++     L  + ++G+ DI+R V+   D       G+        L  +G  L +VM
Sbjct: 1261 LKKIEN--SMLEKITLRGVEDITRVVMMKYDRKVPSETGEYHKVPEWVLETDGVNLSEVM 1318

Query: 1305 CTDGVIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTY 1364
               GV GS+  TN  +++ +VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVMT 
Sbjct: 1319 TVSGVDGSRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTS 1378

Query: 1365 KGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIG 1424
            +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IG
Sbjct: 1379 QGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVILGQMAPIG 1438

Query: 1425 TGSFKVI 1431
            TG+F V+
Sbjct: 1439 TGAFDVM 1445

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
            Anc_7.314
          Length = 1729

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1508 (33%), Positives = 775/1508 (51%), Gaps = 153/1508 (10%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLH 125
            +C TC   +  C GHFGH+ LA PV H+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            E  R  +   D+ +R      + + CK +   + C                        T
Sbjct: 120  EQMRQAIAIKDSKKR---FNAVWNLCKTK---MICDTDVPSDDDPTQLISRGGCGNAQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLTHNP--ELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
             R  G K        VG WK+    N   E E+ V      L+  + LN+FK I   D  
Sbjct: 174  VRKDGLK-------LVGSWKKEKNTNDGDEPEQRV------LSTEEILNIFKHISPEDST 220

Query: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
             LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 221  RLGFNEEF--ARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKG 359
                 G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKG
Sbjct: 278  TLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKG 331

Query: 360  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQEL 419
            K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +L
Sbjct: 332  KEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQL 391

Query: 420  VVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPS 479
            V NGPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH+ D D VLFNRQPS
Sbjct: 392  VRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPS 449

Query: 480  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
            LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 450  LHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPL 509

Query: 540  NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSD--GVEQFDVPPPAI 597
             +++ +S +P +   QD + G   ++ +D+F +   +  +L  + D  GV    +P PAI
Sbjct: 510  QIVSAQSNKPCMGIVQDTLCGIRKLTLRDTFLEFDEVLNMLYWVPDWDGV----IPTPAI 565

Query: 598  MKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVVIR 655
            +KP  LW+GKQV S+ I      P  I+L    +    + PK          ++G +V+ 
Sbjct: 566  IKPKPLWSGKQVLSIAI------PRGIHLQRFDEGTTLLSPK----------DNGMLVVD 609

Query: 656  GSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIN 715
            G QI+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI 
Sbjct: 610  G-QIIFGVVDKKTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIG 667

Query: 716  DVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVRE 775
            D        ++  E +  A RK +++        L  + G    ++ E  +  FL++ R+
Sbjct: 668  DTIADGSTIKEITETIADAKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEARD 727

Query: 776  EVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF 835
            + G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF
Sbjct: 728  KAGRLAEMNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHF 787

Query: 836  PKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLED 895
             K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED
Sbjct: 788  SKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALED 847

Query: 896  LSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFDNQDEG 953
            +   YD T R S   ++QF YG DG+D   +E  +       + +++  Y I   N    
Sbjct: 848  IMVHYDGTARNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRIDLMNPKNA 907

Query: 954  LLPYAIMETANKI-----LVPLEDRLVR--YDNRGFLVK---DEDKD------------K 991
            L P +++E+ ++I     L  L D   +    +R FL K   D + +             
Sbjct: 908  LDP-SLLESGSEITGDVKLQSLLDEEYKQLIKDRKFLRKIFVDGESNWPLPVNIRRIIQN 966

Query: 992  AEHVDQYDAERDFYRSLREYINLKATTLANLRKSRGMLELVNAPPKELQGMDPDEAVPTN 1051
            A+   + D  +    ++R+ I         L   RG  E++            D+A+   
Sbjct: 967  AQQTFRIDHSKPSDLTIRDIIFGLKDLEERLLVLRGKSEIIQKA--------QDDAITLF 1018

Query: 1052 ---VRTSVS-----QLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQ 1103
               VR+ +S     Q YR+++Q+ +  L     ++ ++ + PG  +G + AQSIGEP TQ
Sbjct: 1019 CCLVRSRLSTRRILQEYRLTKQAFEWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQ 1078

Query: 1104 MTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRV 1161
            MTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L +D  +D+  A+ ++  +
Sbjct: 1079 MTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKFIRSAI 1138

Query: 1162 EKTLLSDVA-----YYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL- 1200
            E T L  +      YY  D    V  ++   IQ+   L       ++D+     L+LEL 
Sbjct: 1139 EHTTLKSITVASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEQSLDRQSPWLLRLELD 1198

Query: 1201 ----TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDV 1256
                  +D+ +        +    D+ +I  +  A  +       +  S  A+  +E D 
Sbjct: 1199 RAAMNDKDLTMGQVGERIKETFRNDLFVIWSEDNAEKLIIRCRVVRPKSMDAETEAEED- 1257

Query: 1257 FYRMQQLRRA-LPDVVVKGLADISRAVINIRD------DGKRE------LLVEGYGLRDV 1303
             + ++++    L ++ ++G+ +I R V+   D       G+ +      L  +G  L +V
Sbjct: 1258 -HMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSQSGEYQKVPEWVLETDGVNLSEV 1316

Query: 1304 MCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMT 1363
            M   GV  ++  TN  +++  VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVMT
Sbjct: 1317 MTVPGVDATRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMT 1376

Query: 1364 YKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSI 1423
             +G +  ITR G ++     L  +SFE+T + LF+A    + D   GVSE ++LGQ   I
Sbjct: 1377 TQGALTSITRHGFNRASTGALMRSSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPI 1436

Query: 1424 GTGSFKVI 1431
            GTG+F V+
Sbjct: 1437 GTGAFDVM 1444

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1740

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1527 (33%), Positives = 781/1527 (51%), Gaps = 178/1527 (11%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMG 59
            M E   S  P R +K ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETD 119
                + +C TC   +  C GHFGH++LA PVFHIGY     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEHS 119

Query: 120  KRKFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                  EL R  +   D  RR      +   CK +  C                      
Sbjct: 120  ------ELMRQAIKIKDPKRR---FNAVWSLCKAKMVC------------------ETEV 152

Query: 177  XIIHDTFRWVGK------KSAPEKD--IWVGEWKEVLTHNP--ELERYVKRCMDDLNPLK 226
               +D  ++V +      + +  KD    VG WK+    +   + ER V      ++  +
Sbjct: 153  PSDNDPAQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRV------ISADE 206

Query: 227  TLNLFKQIKSADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT 286
             LN+FK I   D   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT
Sbjct: 207  VLNVFKHISPEDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287  VKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGG 345
             KL +I+  +  ++     G   + + E    LQ  VA Y+++D +  P  L  S     
Sbjct: 264  YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---- 319

Query: 346  KVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYP 405
              +PI+    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYP
Sbjct: 320  --RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYP 377

Query: 406  EKVTRYNRHKLQELVVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERH 465
            E VT YN  +L +LV NGPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH
Sbjct: 378  EVVTPYNIDRLTQLVRNGPNEHPGAKYIIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERH 435

Query: 466  LEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTE 525
            + D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+E
Sbjct: 436  IIDEDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSE 495

Query: 526  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMS- 584
            E RAE   L  V   +++ +S +P +   QD + G   ++ +D+F +   L Q+L M+  
Sbjct: 496  ETRAELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LDQVLNMLYW 552

Query: 585  ----DGVEQFDVPPPAIMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKS 638
                DGV    +P P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK 
Sbjct: 553  IPDWDGV----IPTPIILKPKPLWSGKQILSIAI------PSGIHLQRFDEGTTLLSPK- 601

Query: 639  KSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMA 698
                     ++G ++I G QI+ GV+DK  +G      + + + R+ GP+  A   + + 
Sbjct: 602  ---------DNGMLIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQ 650

Query: 699  KLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNE 758
            K+   +L + GFSIGI D    +   ++  E + +A RK +E+        L  + G   
Sbjct: 651  KVVNFWLLHNGFSIGIGDTIADEKSMREITEAIIVAKRKVEEVTKEAQANLLTAKHGMTL 710

Query: 759  EQTLEAKIGGFLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQII 818
             ++ E  +  +L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ +
Sbjct: 711  RESFEDSVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSV 770

Query: 819  SGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVK 878
             G R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVK
Sbjct: 771  EGKRIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVK 830

Query: 879  TAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRS 938
            TAETGY+ RRL+K+LED+   YD T R S   ++QF YG DG+D   +E   Q ++   S
Sbjct: 831  TAETGYIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQTIDTIAS 888

Query: 939  WDHAYNITFD----NQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEH 994
             D A+   F     N    L P +++E+ ++I+  L+ + +  +    LV+D +  +   
Sbjct: 889  SDAAFERRFRIDLLNPRHALDP-SLLESGSEIIGDLKLQALLDEEFKQLVEDREFLRKIF 947

Query: 995  VDQYDAE------RDFYRSLREYINLKATTLANL---------RKSRGMLELVNAPPKEL 1039
            VD           R   ++ ++   +  T   +L         ++ +  L ++    K L
Sbjct: 948  VDGEQNWPLPVNIRRIIQNAQQTFRIDQTKPTDLTIRDVVYGVKELQEKLLVLRGKSKIL 1007

Query: 1040 QGMDPDEA------VPTNVRT-SVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAI 1092
            Q    +        + + + T  V Q YR+++Q+ +  L     ++ ++ + PG  +G +
Sbjct: 1008 QEAQQNAVTLFCCLLRSRLATRRVIQEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVL 1067

Query: 1093 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNDN--D 1150
             AQSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  D+  D
Sbjct: 1068 AAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAAD 1127

Query: 1151 ERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAIT 1210
            +  A++++  +E T L  +     ++Y D      V  +   I +L   L  E+      
Sbjct: 1128 QEKAKLIRSAIEHTTLKSIT-VASEIYYDPDPRSTVIEEDEEIIQLHFSLMDEET----- 1181

Query: 1211 RASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQ-------- 1262
                L  Q+P +  +  D+ A+N   +      +    KE  +ND+F    +        
Sbjct: 1182 -EQSLDYQSPWLLRLELDRAAMN--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLII 1238

Query: 1263 ----------------------LRR----ALPDVVVKGLADISRAVINIRD------DGK 1290
                                  L+R     L  + ++G+ DI+R V+   D       G+
Sbjct: 1239 RCRVVRDPKTLDAEAEAEEDHMLKRIENTMLESITLRGVEDITRVVMMKYDRKVPSPTGE 1298

Query: 1291 RE------LLVEGYGLRDVMCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMS 1344
                    L  +G  L +VMC  GV  ++  TN  +++ +VLGIEA R ++ +E+   ++
Sbjct: 1299 YHKVPEWVLETDGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIA 1358

Query: 1345 NHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMK 1404
            + G  V+ RH+ LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    +
Sbjct: 1359 SDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAE 1418

Query: 1405 KDAVEGVSECIILGQTMSIGTGSFKVI 1431
             D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1419 LDDCRGVSENVLLGQVAPIGTGAFDVM 1445

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
            YDL140C (REAL)
          Length = 1726

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/1505 (33%), Positives = 773/1505 (51%), Gaps = 147/1505 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
            EL R  +   D+ +R   +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSENDPTQLVSRGGCGNTQPT 173

Query: 183  FRWVGKKSAPEKDIWVGEWKEVLTHN----PELERYVKRCMDDLNPLKTLNLFKQIKSAD 238
             R  G K        VG WK+         PEL          L+  + LN+FK I   D
Sbjct: 174  VRKDGLK-------LVGSWKKDRASGDADEPELRV--------LSTEEILNIFKHISVED 218

Query: 239  CELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
               LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219  FTSLGFNEVF--SRPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299  IKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRL 357
            ++     G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RL
Sbjct: 276  LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQ 417
            KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L 
Sbjct: 330  KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 418  ELVVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQ 477
            +LV NGPN HPGA Y+++ + D R +LRY  R    + LQ G  +ERH+ D D VLFNRQ
Sbjct: 390  QLVRNGPNEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 478  PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 537
            PSLH++S+++H   + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448  PSLHKMSMMAHRVIVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 538  KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMS-----DGVEQFDV 592
               +++P+S +P +   QD + G   ++ +D+F +   L Q+L M+      DGV    +
Sbjct: 508  PLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----I 560

Query: 593  PPPAIMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDG 650
            P PAI+KP  LW+GKQV S  I      P  I+L    +    + PK          ++G
Sbjct: 561  PTPAIIKPKPLWSGKQVLSAAI------PSGIHLQRFDEGTTLLSPK----------DNG 604

Query: 651  FVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGF 710
             ++I G QI+ GV++K  +G      + + + R+ GPQ  A     + K+   +L + GF
Sbjct: 605  MLIIDG-QIVFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGF 662

Query: 711  SIGINDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFL 770
            S GI D        ++  E +  A +K  ++        L  + G    ++ E  +  FL
Sbjct: 663  STGIGDTIADGPTMREITETIAEAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFL 722

Query: 771  SKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDR 830
            ++ R++ G +    L + N    M   GSKGS +N++QM A VGQQ + G R+  GF DR
Sbjct: 723  NEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDR 782

Query: 831  SLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLM 890
            +LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+
Sbjct: 783  TLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLV 842

Query: 891  KSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFD 948
            K+LED+   YDNT R S   ++QF YG DG+D   +E  +       +++++  Y I   
Sbjct: 843  KALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDKAFEKRYRIDLL 902

Query: 949  NQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQ----------- 997
            N +  L P +++E+ ++IL  L+ +++  +    LVKD    +   VD            
Sbjct: 903  NPEHILDP-SLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPMPVNIR 961

Query: 998  ---YDAERDFY--------RSLREYINLKATTLANLRKSRGMLELVNAPPKELQGMDPDE 1046
                +A++ F+         +++E +        NL   RG  E++    ++   +    
Sbjct: 962  RIIQNAQQTFHIDHTRPSDLTIKEIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCL 1021

Query: 1047 AVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTL 1106
                     + Q YR+++Q+ +  L     ++ ++ + PG  +G + AQSIGEP TQMTL
Sbjct: 1022 FRSRLATRRILQEYRLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1107 KTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRVEKT 1164
             TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHT 1141

Query: 1165 LLSDVA-----YYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL---T 1201
             L  V      YY  D    V  ++   IQ+   L       + D+     L+LEL    
Sbjct: 1142 TLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAA 1201

Query: 1202 IEDIAVAITRASKLKIQA--PDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
            + D  + + +  +   Q    D+ +I  +     +       +  S  A+  +E D  + 
Sbjct: 1202 MNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEED--HM 1259

Query: 1260 MQQLRRA-LPDVVVKGLADISRAVINIRD------------DGKRELLVEGYGLRDVMCT 1306
            ++++    L ++ ++G+ +I R V+   D            + +  L  +G  L +VM  
Sbjct: 1260 LKKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTV 1319

Query: 1307 DGVIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKG 1366
             G+  ++  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQG 1379

Query: 1367 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1426
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTG 1439

Query: 1427 SFKVI 1431
            +F V+
Sbjct: 1440 AFDVM 1444

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL140C
            (RPO21) - RNA polymerase II large subunit [contig 161]
            FULL
          Length = 1728

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1530 (33%), Positives = 779/1530 (50%), Gaps = 184/1530 (12%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMG 59
            M E   S  P R +K ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGMFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETD 119
                + +C TC   +  C GHFGH++LA PVFHIGY     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEHS 119

Query: 120  KRKFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                  EL +  +   D  RR      +   CK +  C                      
Sbjct: 120  ------ELMKQAIKIKDPKRR---FNAVWSLCKVKMVC------------------ETEV 152

Query: 177  XIIHDTFRWVGK------KSAPEKD--IWVGEWKEVLTHNP--ELERYVKRCMDDLNPLK 226
               +D  ++V +      + +  KD    VG WK+    +   + ER +      ++  +
Sbjct: 153  PSDNDPSQYVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRI------ISADE 206

Query: 227  TLNLFKQIKSADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT 286
             LN+FK I   D   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT
Sbjct: 207  VLNVFKHISPEDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLT 263

Query: 287  VKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGG 345
             KL +I+  +  ++     G   + + E    LQ  VA Y+++D +  P  L  S     
Sbjct: 264  YKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---- 319

Query: 346  KVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYP 405
              +PI+    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYP
Sbjct: 320  --RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYP 377

Query: 406  EKVTRYNRHKLQELVVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERH 465
            E VT YN  +L +LV NGPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH
Sbjct: 378  EVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERH 435

Query: 466  LEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTE 525
            + D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+E
Sbjct: 436  IIDEDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSE 495

Query: 526  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMS- 584
            E RAE   L  V   +++ +S +P +   QD + G   ++ +D+F +   L Q+L M+  
Sbjct: 496  ETRAELSQLCAVPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LEQVLNMLYW 552

Query: 585  ----DGVEQFDVPPPAIMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKS 638
                DGV    +P P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK 
Sbjct: 553  IPDWDGV----IPTPIILKPKPLWSGKQILSIAI------PTGIHLQRFDEGTTLLSPK- 601

Query: 639  KSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMA 698
                     ++G ++I G QI+ GV+DK  +G      + + + R+ GP+  A   + + 
Sbjct: 602  ---------DNGMLIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQ 650

Query: 699  KLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNE 758
            K+   +L + GFSIGI D    +   ++  + + +A RK +E+        L  + G   
Sbjct: 651  KVVNYWLLHNGFSIGIGDTIADEKSMREITDAIVVAKRKVEEVTKEAQANLLTAKHGMTL 710

Query: 759  EQTLEAKIGGFLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQII 818
             ++ E  +  +L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ +
Sbjct: 711  RESFEDNVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSV 770

Query: 819  SGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVK 878
             G R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVK
Sbjct: 771  EGKRIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVK 830

Query: 879  TAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNA--QPVNFN 936
            TAETGY+ RRL+K+LED+   YD T R S   ++QF YG DG+D   +E  A       +
Sbjct: 831  TAETGYIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIEKQAIDTIACSD 890

Query: 937  RSWDHAYNITFDNQDEGLLPYAIMETANKILVPL-------EDRLVRYDNRGFLVK---D 986
             +++  + I   N    L P +++E+ ++I+  L       E+     ++R FL K   D
Sbjct: 891  AAFERRFKIDLLNPKHALDP-SLLESGSEIIGDLKLQALLDEEFKQLSEDRQFLRKIFVD 949

Query: 987  EDKD------------KAEHVDQYDAERDFYRSLREYI----NLKATTLANLRKSRGMLE 1030
             +++             A+   + D  +    S+R+ I     L+   L    KS+ + E
Sbjct: 950  GEQNWPLPVNIRRIIQNAQQTFRIDHTKPTDLSIRDVIYGVKELQEKLLVLRGKSKILQE 1009

Query: 1031 L-VNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAI 1089
              VNA       +    A        V Q YR+++Q+ +  L     ++ ++ + PG  +
Sbjct: 1010 AQVNAVTLFCCLLRSRLA-----SRRVIQEYRLNKQTFEWVLSNVEAQFLRSLVHPGEMV 1064

Query: 1090 GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNDN 1149
            G + AQSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  ++
Sbjct: 1065 GVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDEEH 1124

Query: 1150 --DERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAV 1207
              D+  A++++  +E T L  +     ++Y D      V  D   I +L   L  E+   
Sbjct: 1125 AADQEKAKLIRSAIEHTTLKSIT-VASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEET-- 1181

Query: 1208 AITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQ----- 1262
                   L  Q+P +  +  D+ A+N   +      +    KE  +ND+F    +     
Sbjct: 1182 ----EQSLDYQSPWLLRLELDRAAMN--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEK 1235

Query: 1263 -------------------------LRR----ALPDVVVKGLADISRAVINIRDDG---- 1289
                                     L+R     L  + ++G+ DI+R V+   D      
Sbjct: 1236 LVIRCRVVRDPKTLDAEAEAEEDHMLKRIENTMLESITLRGVEDITRVVMMKYDRKVPSP 1295

Query: 1290 --------KRELLVEGYGLRDVMCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIVREINY 1341
                    +  L  +G  L +VMC  GV  ++  TN  +++ +VLGIEA R ++ +E+  
Sbjct: 1296 AGDYHKIPEWVLETDGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYN 1355

Query: 1342 TMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAF 1401
             +++ G  V+ RH+ LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A  
Sbjct: 1356 VIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGA 1415

Query: 1402 YMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
              + D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1416 AAELDDCRGVSENVLLGQVAPIGTGAFDVM 1445

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL140C
            (RPO21)
          Length = 1745

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1515 (33%), Positives = 776/1515 (51%), Gaps = 154/1515 (10%)

Query: 1    MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMG 59
            M +   S  P R IK ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G
Sbjct: 1    MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETD 119
                + +C TC   +  C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E  
Sbjct: 60   SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE-- 117

Query: 120  KRKFLHELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXX 176
                 +EL R  +   D  RR      +   CK +   + C                   
Sbjct: 118  ----YNELMRQAIKIKDPKRR---FNAVWSLCKAK---MVCDTEVPSEDDPSKYISRGGC 167

Query: 177  XIIHDTFRWVGKKSAPEKDIWVGEWKEVLTHNPE-LERYVKRCMDDLNPLKTLNLFKQIK 235
                 + R  G          VG WK+    N E  ++  KR    ++  + LN+FK I 
Sbjct: 168  GNAQPSIRKDGLS-------LVGTWKK--DKNAEDADQPEKRI---ISAEEILNVFKHIS 215

Query: 236  SADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWT 295
              D   LG +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+  
Sbjct: 216  PEDSWRLGFNEDF--SRPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKA 272

Query: 296  SSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQ 355
            +  ++     G   + + E    LQ  VA Y+++D    A  P +    G+  PI+    
Sbjct: 273  NINVQRLEINGSPQHVIQESESLLQFHVATYMDNDI---AGQPQAVQKSGR--PIKSIRA 327

Query: 356  RLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHK 415
            RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +
Sbjct: 328  RLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDR 387

Query: 416  LQELVVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFN 475
            L +LV NGPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH+ D D VLFN
Sbjct: 388  LTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFN 445

Query: 476  RQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLM 535
            RQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L 
Sbjct: 446  RQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLC 505

Query: 536  GVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMS-----DGVEQF 590
             V   +++P+S +P +   QD + G   ++ +D+F +   L Q+L M+      DGV   
Sbjct: 506  AVPLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGV--- 559

Query: 591  DVPPPAIMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQN 648
             +P P I+KP  LW+GKQ+ S+ I      P  I+L    +   ++ PK          +
Sbjct: 560  -IPTPTILKPKPLWSGKQLLSMAI------PSGIHLQRFDEGTTYLSPK----------D 602

Query: 649  DGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNR 708
            +G ++I G QI+ GV+DK  +G      + + + R+ GP+  A     + K+   +L + 
Sbjct: 603  NGMLIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHN 660

Query: 709  GFSIGINDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGG 768
            GFSIGI D    +   ++  + + +A +K +E+        L  + G    ++ E  +  
Sbjct: 661  GFSIGIGDTIADEKTMREITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVR 720

Query: 769  FLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQ 828
            +L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ + G R+  GF 
Sbjct: 721  YLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFA 780

Query: 829  DRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRR 888
            DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RR
Sbjct: 781  DRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRR 840

Query: 889  LMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNIT 946
            L+K+LED+   YD T R S   I+QF YG DG+D   +E  +       + +++  Y I 
Sbjct: 841  LVKALEDIMVHYDGTTRNSLGNIIQFVYGEDGMDAAHIEKQSIDTIPGSDLAFEKRYRID 900

Query: 947  FDNQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAE----- 1001
              N +  L P  ++E+  +I+  L+ + +  +    LV+D    +   +D          
Sbjct: 901  LLNPNYALDP-NLLESGTEIVGDLKLQNLLDEEYKQLVQDRHFLRKIFMDGEHNWPLPVN 959

Query: 1002 -RDFYRSLREYINLKATTLANL------RKSRGMLE--LVNAPPKELQGMDPDEAVPTNV 1052
             R   ++ ++   + +T   +L      +  RG+ E  LV     ++     + A+    
Sbjct: 960  IRRIIQNAQQTFRIDSTKPTDLSIQDVVQGVRGLQERLLVLRGKSQILQEAQENAITLFC 1019

Query: 1053 RTSVSQL--------YRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQM 1104
                S+L        YR+++Q+ +  L     ++ ++ + PG  +G + AQSIGEP TQM
Sbjct: 1020 CLLRSRLATRRVITEYRLTKQTFEWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQM 1079

Query: 1105 TLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVE 1162
            TL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L      D+  A++++  +E
Sbjct: 1080 TLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEESYATDQEKAKLIRSAIE 1139

Query: 1163 KTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKLKIQAPDV 1222
             T L  V    +  Y  + S   +  D   I +L   L  E+     T AS LK Q+P +
Sbjct: 1140 HTTLKSVPVASEIYYDPDPSSTVIEEDEEII-QLHFSLMDEE-----TEAS-LKHQSPWL 1192

Query: 1223 TIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFY------------RMQQLR------ 1264
              +  D++A+    +      +    KE  +ND+F             R + +R      
Sbjct: 1193 LRLELDRVAMT--DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLD 1250

Query: 1265 ----------------RALPDVVVKGLADISRAVINIRD------DGKRE------LLVE 1296
                              L  + ++G+ DI+R V+   D       G+        L  +
Sbjct: 1251 AEAEAEEDHMLKKIENTMLESITLRGVQDITRVVMMKYDRKVPSETGEYHKIPEWVLETD 1310

Query: 1297 GYGLRDVMCTDGVIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQ 1356
            G  L +VM   GV  ++  TN  +++ +VLGIEA R ++ +E+   +++ G  V+ RH+ 
Sbjct: 1311 GVNLSEVMSVPGVDPTRIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMA 1370

Query: 1357 LLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECII 1416
            LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +I
Sbjct: 1371 LLVDVMTSQGFLMSVTRHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCSGVSENVI 1430

Query: 1417 LGQTMSIGTGSFKVI 1431
            LGQ   IGTGSF V+
Sbjct: 1431 LGQMAPIGTGSFDVM 1445

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/1497 (33%), Positives = 763/1497 (50%), Gaps = 131/1497 (8%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  +I A S  ++   +  D  + RA +  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEIRAISVAKIRLPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLH 125
            +C TC   +  C GHFGH+ LA PVFHIG+     ++ + +C +C  +LL E +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTFRW 185
            E  R  +           +   CK +   + C                        T R 
Sbjct: 120  EQMRQAIQIKDPKKRFNAVWSLCKTK---MVCETDVPSEDDPTKLISRGGCGNTQPTIRK 176

Query: 186  VGKKSAPEKDIWVGEWKEVLTHNP--ELERYVKRCMDDLNPLKTLNLFKQIKSADCELLG 243
             G K        VG WK+  +     E E+ V      L+  + LN+FK I   D   LG
Sbjct: 177  DGLK-------LVGSWKKDKSTGDADEPEQRV------LSTEEILNIFKHISPEDSYRLG 223

Query: 244  IDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGL 303
             +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 224  FNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 280

Query: 304  DKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQG 362
              G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+G
Sbjct: 281  HNGAPHHAVEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEG 334

Query: 363  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELVVN 422
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +LV N
Sbjct: 335  RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLVRN 394

Query: 423  GPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSLHR 482
            GPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH+ D D VLFNRQPSLH+
Sbjct: 395  GPNEHPGAKYVIRDNGD-RIDLRYSKRSGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHK 452

Query: 483  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 542
            +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453  MSMMAHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 543  TPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSD--GVEQFDVPPPAIMKP 600
            +P+S +P +   QD + G   ++ +D+F +   +  +L  + D  GV    +P PAI+KP
Sbjct: 513  SPQSNKPCMGIVQDTLCGIRKLTLRDTFLEFDQVLNMLYWVPDWDGV----IPTPAIIKP 568

Query: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVVIRGSQ 658
              LW+GKQ+ S+ I      P  I+L    +    + PK          ++G +VI G +
Sbjct: 569  KPLWSGKQILSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG-E 611

Query: 659  ILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVT 718
            I+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D  
Sbjct: 612  IIFGVVDKKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIGDTV 670

Query: 719  PADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVG 778
                  ++  E +  A +K + +        L  + G    ++ E  +  FL++ R+  G
Sbjct: 671  ADGQTMREISETIAEAKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDRAG 730

Query: 779  DVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKN 838
             +    L + N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 731  RLAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKD 790

Query: 839  SKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 898
              +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 791  DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 850

Query: 899  QYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFDNQDEGLLP 956
             YD T R S   ++QF YG DG+D   +E  +       +++++  Y I   N    L P
Sbjct: 851  HYDGTTRNSLGNVIQFIYGEDGMDAGHIEKQSLDTMGGSDQAFERRYRIDLLNTSNSLEP 910

Query: 957  YAIMETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQ--------------YDAER 1002
             +++E+ ++I+  L+ ++   +    LVKD    +    D                +A++
Sbjct: 911  -SLLESGSEIIGDLKVQMALDEEYKQLVKDRRFLRTIFSDGESSWPLPVNIRRIIQNAQQ 969

Query: 1003 DFYRSLREYINLKATTLANLRKSRGMLELVNAPPKELQGMDPDEAVP-------TNVRT- 1054
             F     +  +L    + N  +      LV     E+     D+AV        + + T 
Sbjct: 970  TFRIDHTKPSDLTIPEIINSVRDLQDRLLVLRSKSEIIKKAQDDAVTLFCCLLRSRLATR 1029

Query: 1055 SVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGV 1114
             V Q YR+++++ +  L     ++ ++ + PG  +G + AQSIGEP TQMTL TFHFAGV
Sbjct: 1030 RVLQEYRLTKEAFEWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGV 1089

Query: 1115 ASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVA-- 1170
            AS  VT GVPR+KEI+N +K + TP +   L  +   D+  A++V+  +E T L  V   
Sbjct: 1090 ASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEKAKLVRSAIEHTTLKSVTVA 1149

Query: 1171 ---YYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL-----TIEDIAV 1207
               YY  D    V  ++   IQ+   L        +D+     L+LEL       +D+ +
Sbjct: 1150 SEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEKLLDQQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1208 AITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRRA- 1266
                         D+ +I  +  A  +       +  +  A+  +E D  + ++++    
Sbjct: 1210 GQVGERIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEED--HMLKKIENTM 1267

Query: 1267 LPDVVVKGLADISRAVINIRD------DGKRE------LLVEGYGLRDVMCTDGVIGSKT 1314
            L ++ ++G+  I R V+   D       G+ +      L  +G  L +VM   GV  ++ 
Sbjct: 1268 LENITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWVLETDGVNLSEVMTVPGVDPTRI 1327

Query: 1315 TTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRF 1374
             TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G +  +TR 
Sbjct: 1328 YTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRH 1387

Query: 1375 GLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1388 GFNRSSTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_7.314
          Length = 1716

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1505 (33%), Positives = 772/1505 (51%), Gaps = 147/1505 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++   S  ++   +  D  + RA +  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRGISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLH 125
            +C TC   +  C GHFGH+ LA PVFH+G+     ++ + +C +C  +LL E ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHNE----- 120

Query: 126  ELRRPGV--DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            ++R+     D+ +R   +  +   CK +   + C                        + 
Sbjct: 121  QMRQAMAIKDSKKRFNAVWTL---CKTK---MICETDVPSDDDPTTLISRGGCGNAQPSI 174

Query: 184  RWVGKKSAPEKDIWVGEWKEV--LTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCEL 241
            R  G K        VG WK+    +   E E+ V      L+  + LN+FK I   D   
Sbjct: 175  RKDGLK-------LVGSWKKEKNTSDGDEPEQRV------LSTEEILNIFKHISPEDSTR 221

Query: 242  LGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
            +G        RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 222  MGFSEEF--ARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360
                G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGK 332

Query: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L +LV
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLV 392

Query: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480
             NGPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH+ D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSL 450

Query: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540
            H++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 510

Query: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSD--GVEQFDVPPPAIM 598
            +++ +S +P +   QD + G   ++ +D+F +   +  +L  + D  GV    +P PA++
Sbjct: 511  IVSAQSNKPCMGIVQDTLCGIRKLTLRDTFIEFDQVLNMLYWVPDWDGV----IPTPAVL 566

Query: 599  KPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVVIRG 656
            KP  LWTGKQV S  I      P  I+L    +    + PK          ++G +VI G
Sbjct: 567  KPKPLWTGKQVLSAAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVIDG 610

Query: 657  SQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIND 716
             QI+ GV+DK  +G      + + + R+ GP   A     + K+   +L + GFS GI D
Sbjct: 611  -QIIFGVVDKKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFSTGIGD 668

Query: 717  -VTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVRE 775
             +     +K+  E + E A +K +++        L  + G    ++ E  +  FL++ R+
Sbjct: 669  TIADGQTIKEITETIAE-AKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARD 727

Query: 776  EVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF 835
            + G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF
Sbjct: 728  KAGRLAEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHF 787

Query: 836  PKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLED 895
             K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED
Sbjct: 788  SKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALED 847

Query: 896  LSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFDNQDEG 953
            +   YD T R S   ++QF YG DG+D   +E          + +++  Y I   N +  
Sbjct: 848  IMVHYDGTTRNSLGNVIQFIYGEDGIDAAHIEKQTLDTIGGSDVAFERRYRIDLLNPEHS 907

Query: 954  LLPYAIMETANKILVPL-------EDRLVRYDNRGFL----VKDEDK-----------DK 991
            L P  ++E+ ++I   L       E+     ++R FL    V  E               
Sbjct: 908  LDP-TLLESGSEIAGDLKLQALLDEEYKQLVEDRRFLREIFVDGESNWPLPVNIRRIIQN 966

Query: 992  AEHVDQYDAERDFYRSLREYINLKATTLANLRKSRGMLELVNAPPKELQGMDPDEAVPTN 1051
            A+   + D  +    ++R+ +        +L   RG  E++     E    D        
Sbjct: 967  AQQTFRIDHSKPSDLTIRDIVFGIKELQEHLLVLRGKSEII-----EKAQSDAITLFCCL 1021

Query: 1052 VRTSVS-----QLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTL 1106
            VR+ ++     Q Y++++Q+ +  L     ++ ++ + PG  +G + AQSIGEP TQMTL
Sbjct: 1022 VRSRLATRRILQEYKLTKQAFQWVLNNVESQFLRSVVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1107 KTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVN--DNDERAARVVKGRVEKT 1164
             TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L +   +D+  A+ ++  +E T
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDGYSSDQEKAKFIRSAIEHT 1141

Query: 1165 LLSDVA-----YYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL---- 1200
             L  +      YY  D    V  ++   IQ+   L       ++D+     L+LEL    
Sbjct: 1142 TLKSITVASEIYYDPDPRSTVIPEDDEIIQLHFSLMDDETEQSLDRQSPWLLRLELDRAA 1201

Query: 1201 -TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYR 1259
               +D+ +        +    D+ +I  +  A  +       +  S  A+  +E D  + 
Sbjct: 1202 MNDKDLTMGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETEAEED--HM 1259

Query: 1260 MQQLRRA-LPDVVVKGLADISRAVINIRD------DGKRE------LLVEGYGLRDVMCT 1306
            ++++    L ++ ++G+ +I R V+   D       G+ E      L  +G  L +VM  
Sbjct: 1260 LKKIENTMLENITLRGVENIERVVMMKYDRKVPSATGEYEKVPEWVLETDGVNLSEVMTV 1319

Query: 1307 DGVIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKG 1366
             G+  ++  TN  +++  VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGIDATRIYTNSFIDIMEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQG 1379

Query: 1367 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG 1426
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRASTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTG 1439

Query: 1427 SFKVI 1431
            +F V+
Sbjct: 1440 AFDVM 1444

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1727

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1490 (33%), Positives = 761/1490 (51%), Gaps = 140/1490 (9%)

Query: 7    SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
            S  P R +K ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G    +L
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLH 125
            +C TC   +  C GHFGH+ LA PVFHIG+     ++ + +C +C  +LL + ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHNE----- 120

Query: 126  ELRRPGV--DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTF 183
            ++R+     D+ +R      I   CK +   + C                        T 
Sbjct: 121  QMRQACKIKDSKKR---FNAIWTLCKTK---MICESDVPSEEDPTKLISRGGCGNAQPTV 174

Query: 184  RWVGKKSAPEKDIWVGEWK-EVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELL 242
            R  G K        VG WK E  T +PE        M+++     LN+FK I   D   L
Sbjct: 175  RKDGLK-------LVGSWKKEKNTGDPEEPEQRILTMEEI-----LNIFKHISKEDSNRL 222

Query: 243  GIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223  GFNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQ 361
               G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKE 333

Query: 362  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELVV 421
            GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV 
Sbjct: 334  GRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLVR 393

Query: 422  NGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSLH 481
            NGPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH+ D D VLFNRQPSLH
Sbjct: 394  NGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLH 451

Query: 482  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 541
            ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452  KMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 542  LTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMS-----DGVEQFDVPPPA 596
            ++P+S +P +   QD + G   ++ +D+F +   L Q+L M+      DGV    +P PA
Sbjct: 512  VSPQSNKPCMGIVQDTLCGIRKLTLRDNFIE---LDQVLNMLYWVPDWDGV----IPTPA 564

Query: 597  IMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVVI 654
            I+KP  LWTGKQ+ S+ I      P  I+L    +    + PK          ++G ++I
Sbjct: 565  IIKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTLLSPK----------DNGMLII 608

Query: 655  RGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGI 714
             G +I+ GV+DK  +G      + + + R+ GPQ  A     + K+   +  + GFS GI
Sbjct: 609  DG-KIIFGVVDKKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGI 666

Query: 715  NDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVR 774
             D        ++  E +  A +K +++        L  + G    ++ E  +  FL++ R
Sbjct: 667  GDTIADGQTMREITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 775  EEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 834
            ++ G +    L + N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727  DKAGRLAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPH 786

Query: 835  FPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 894
            F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787  FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 895  DLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFDNQDE 952
            D+   YD+T R S   ++QF YG DG+D   +E  A       + +++  Y I   N D 
Sbjct: 847  DIMVHYDSTTRNSLGNVIQFVYGEDGMDASHIEKQAIDTIGGSDSAFEKRYRIDLLNPDH 906

Query: 953  GLLPYAIMETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAE------RDFYR 1006
             L P +++E+ ++I+  L+ +++  +    LV+D    ++  VD           R   +
Sbjct: 907  LLDP-SLLESGSEIVGDLKLQVLLDEEYKQLVEDRFFLRSVFVDGEPNWPLPVNIRRIVQ 965

Query: 1007 SLREYINLKATTLANLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVS--------- 1057
            + ++   +  T  ++L        + N   K L      E +    + +VS         
Sbjct: 966  NAQQTFRIDHTKPSDLSIRDVYFAVKNLQDKLLVLRGNSEIIKNAQQDAVSLFCCLMRSR 1025

Query: 1058 -------QLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFH 1110
                   + YR+++Q+ +  L     ++ ++ + PG  +G + AQSIGEP TQMTL TFH
Sbjct: 1026 LATRRVIEEYRLTKQAFEWVLNNIEIQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFH 1085

Query: 1111 FAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVN---------DNDERAARVVKG-- 1159
            FAGVAS  VT GVPR+      +K I + I +  L +         D D R+  + +   
Sbjct: 1086 FAGVASKKVTSGVPRLXXXXEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIAEDEE 1145

Query: 1160 --RVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKLKI 1217
              ++  +LL D      +   D  S   +R++L        +LT+  +   I    K   
Sbjct: 1146 IIQLHFSLLDDET----EKSLDQQSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFK--- 1198

Query: 1218 QAPDVTII----GKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRRALPDVVVK 1273
               D+ +I      +K+ I       K+  I T A+   E+ +  +++     L ++ ++
Sbjct: 1199 --NDLFVIWSEDNAEKLIIRCRVVRPKSMDIETEAE---EDHMLKKIENT--MLENITLR 1251

Query: 1274 GLADISRAVINIRD------DGKRE------LLVEGYGLRDVMCTDGVIGSKTTTNHVLE 1321
            G+ +I R V+   D       G+        L  +G  L +VM   GV   +  TN  ++
Sbjct: 1252 GVENIERVVMMKYDRKVPSATGEYHKVPEWVLETDGVNLSEVMTVPGVDSKRIYTNSFID 1311

Query: 1322 VFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1381
            +  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++   
Sbjct: 1312 IMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSAT 1371

Query: 1382 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
              L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGSF V+
Sbjct: 1372 GALMRCSFEETVEILFEAGACAEMDDCRGVSENVILGQMAPIGTGSFDVM 1421

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1730

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/1299 (34%), Positives = 678/1299 (52%), Gaps = 152/1299 (11%)

Query: 226  KTLNLFKQIKSADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDL 285
            + LN+FK I   D   LG +      RPE  +   LP PP  +RPS+   ++    EDDL
Sbjct: 206  EVLNVFKHICPEDSWRLGFNEDF--ARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDL 262

Query: 286  TVKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGG 344
            T KL +I+  +  ++     G   + + E    LQ  VA Y+++D +  P  L  S    
Sbjct: 263  TYKLGDILKANINVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG--- 319

Query: 345  GKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTY 404
               +PI+    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTY
Sbjct: 320  ---RPIKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTY 376

Query: 405  PEKVTRYNRHKLQELVVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIER 464
            PE VT YN  +L +LV NGPN HPGA Y+++ N D R +LRY  R    + LQ G  +ER
Sbjct: 377  PEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVER 434

Query: 465  HLEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQT 524
            H+ D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+
Sbjct: 435  HIIDNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQS 494

Query: 525  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMS 584
            EE RAE   L  V   +++P+S +P +   QD + G   ++ +D+F +   L Q+L M+ 
Sbjct: 495  EETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LDQVLNMLY 551

Query: 585  -----DGVEQFDVPPPAIMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPK 637
                 DGV    +P P I+KP  LW+GKQ+ S+ I      P  I+L    +    + PK
Sbjct: 552  WVPDWDGV----IPTPTILKPKPLWSGKQILSMAI------PKGIHLQRFDEGTTLLSPK 601

Query: 638  SKSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRM 697
                      ++G +++ G QI+ GV+DK  +G      + + + R+ GPQ  A   + +
Sbjct: 602  ----------DNGMLIVDG-QIIFGVVDKKTVG-SSNGGLIHIVTREKGPQICARLFSNI 649

Query: 698  AKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCN 757
             K+   +L + GFSIGI D        ++  E + +A +K + +        L  + G  
Sbjct: 650  QKVVNYWLLHNGFSIGIGDTIADQKTMREITEAIAVAKKKVENVTKEAQANLLTAKHGMT 709

Query: 758  EEQTLEAKIGGFLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQI 817
              ++ E  +  +L++ R++ G      L + N    M + GSKGS +N++QM A VGQQ 
Sbjct: 710  LRESFEDNVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQS 769

Query: 818  ISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAV 877
            + G R+  GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAV
Sbjct: 770  VEGKRIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAV 829

Query: 878  KTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNA--QPVNF 935
            KTAETGY+ RRL+K+LED+   YD T R S   I+QF YG DG+D   +E  +       
Sbjct: 830  KTAETGYIQRRLVKALEDIMVHYDGTTRNSLGNIIQFIYGEDGMDAAHIEKQSIDTIAGS 889

Query: 936  NRSWDHAYNITFDNQDEGLLPYAIMETANKILVPL-------EDRLVRYDNRGFLVK--- 985
            +R+++  Y I   N D  L P +++E+ ++++  L       E+     ++R FL K   
Sbjct: 890  DRAFERRYRIDLLNPDNALDP-SLLESGSEMMGDLKLQASLDEEYRQLVEDRRFLRKIFV 948

Query: 986  DEDKD------------KAEHVDQYDAERDFYRSLREYINLKATTLANLRKSRGMLELVN 1033
            D +++             A+   + D  +    ++ + I         L   RG  E++ 
Sbjct: 949  DGEQNWPLPVNIRRIIQNAQQTFRIDHTKPTDLTIHDVIYGVKDLQEKLLVLRGKSEML- 1007

Query: 1034 APPKELQGMDPDEAVPTNVRTSVSQLYR-------------ISEQSVKKFLEIALFKYRK 1080
                        +   TN  T    L R             +++Q+ +  L     ++ +
Sbjct: 1008 ------------QEAQTNAVTLFCCLLRSRLASRRVIEEYKLTKQTFQWVLNNVEAQFLR 1055

Query: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140
            + + PG  +G + AQSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP 
Sbjct: 1056 SIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPS 1115

Query: 1141 INAVLVNDN--DERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQL 1198
            +   L ++   D+  A++++  +E T L  V     ++Y D      V  D   I +L  
Sbjct: 1116 LTVYLESEESADQEKAKLIRSAIEHTTLKSVT-VASEIYYDPDPRSTVIEDDEEIIQLHF 1174

Query: 1199 ELTIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFY 1258
             L  E+          L  Q+P +  +  D+ A+N   +      +    KE  +ND+F 
Sbjct: 1175 SLMDEET------EQSLDHQSPWLLRLELDRAAMN--DKDLTMGQVGEKIKETFKNDLFV 1226

Query: 1259 ------------RMQQLR----------------------RALPDVVVKGLADISRAVIN 1284
                        R + +R                        L  + ++G+ DI+R V+ 
Sbjct: 1227 IWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKKIENTMLESITLRGVEDITRVVMM 1286

Query: 1285 IRD------DGKRE------LLVEGYGLRDVMCTDGVIGSKTTTNHVLEVFSVLGIEAAR 1332
              D       G+ +      L  +G  L +VM   GV  ++  TN  +++ +VLGIEA R
Sbjct: 1287 KYDRKTPSATGEYQKVPEWVLETDGVNLAEVMSVPGVDSTRIYTNSFIDIMNVLGIEAGR 1346

Query: 1333 YSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKT 1392
             ++ +E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G ++     L   SFE+T
Sbjct: 1347 AALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEET 1406

Query: 1393 TDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
             + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1407 VEILFEAGAAAELDNCRGVSENVILGQMAPIGTGAFDVM 1445

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 66/122 (54%), Gaps = 2/122 (1%)

Query: 1   MKEVVVSETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMG 59
           M +   S  P R IK ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G
Sbjct: 1   MVDFPYSSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60  VSSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETD 119
               + +C TC   +  C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E +
Sbjct: 60  SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGKLLLDEHN 119

Query: 120 KR 121
           ++
Sbjct: 120 EQ 121

>Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 320

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/317 (83%), Positives = 291/317 (91%), Gaps = 1/317 (0%)

Query: 1145 LVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLELTIED 1204
            LVN NDERAARVVKGR+EKTLLSDVA+Y+QDVYKDNLSF+QV+IDLGTI+KLQLELTIED
Sbjct: 4    LVNMNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNLSFLQVKIDLGTIEKLQLELTIED 63

Query: 1205 IAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLR 1264
            IAVAITRASKLKI A DV+IIGKDK+ INV+PEG K KSISTSAKEP EN++FYR+Q LR
Sbjct: 64   IAVAITRASKLKIAAQDVSIIGKDKVNINVYPEGSKLKSISTSAKEPIENELFYRVQHLR 123

Query: 1265 RALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVLEVFS 1324
            R+LP +VVKGL DI+RAVINI+ DG RELLVEGYGLRDVM TDGV+G KT TNH+LEV S
Sbjct: 124  RSLPGIVVKGLPDIARAVINIKSDGSRELLVEGYGLRDVMTTDGVVGHKTKTNHILEVVS 183

Query: 1325 VLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
            VLGIEAAR SIV EI+YTMSNHGMSVDPRH+QLLGDVMTYKGEVLGITRFGLSKMRDSVL
Sbjct: 184  VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEVLGITRFGLSKMRDSVL 243

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKDLIPK 1444
            QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTG+FKV+KGTN+S ++L PK
Sbjct: 244  QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTNLSSEELKPK 303

Query: 1445 PCLFESL-SNEAALKAN 1460
              LFESL  N AALK N
Sbjct: 304  ATLFESLCGNTAALKIN 320

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
           similar to uniprot|P04050 Saccharomyces cerevisiae
           YDL140C
          Length = 1744

 Score =  570 bits (1470), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 369/975 (37%), Positives = 529/975 (54%), Gaps = 75/975 (7%)

Query: 7   SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
           S  P R +K ++F   S  +I A S  ++   +  D  + RA +  G  DP++G    SL
Sbjct: 7   SSAPLRTVKEVQFGLFSPEEICAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRSL 65

Query: 66  ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLH 125
           +C TC   +  C GHFGH++LA PVFHIG+     ++ + +C +C  +LL E +      
Sbjct: 66  KCQTCQEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126 ELRRPGV---DNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDT 182
           E  R  +   D+ +R      +   CK +   + C                        T
Sbjct: 120 EQMRQAIKIKDSKKR---FNAVWSLCKAK---MICDTDVPSDEDPTQLISRGGCGNAQPT 173

Query: 183 FRWVGKKSAPEKDIWVGEWKEVLTH--NPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240
            R  G K        VG WK+      N E E+ V      LN  + LN+FK I   D  
Sbjct: 174 IRRDGLK-------LVGSWKKDKNSGDNEEPEQRV------LNMEEILNIFKHISPEDSW 220

Query: 241 LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 221 KLGFNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301 AGLDKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKG 359
                G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKG
Sbjct: 278 TLEHNGAPHHTIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKG 331

Query: 360 KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQEL 419
           K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  L
Sbjct: 332 KEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTML 391

Query: 420 VVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPS 479
           V NGPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH+ D D VLFNRQPS
Sbjct: 392 VRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHVIDNDPVLFNRQPS 449

Query: 480 LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 539
           LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 450 LHKMSMMAHKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQ 509

Query: 540 NLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSD--GVEQFDVPPPAI 597
            +++P+S +P +   QD + G   ++ +D+F +   +  +L  + D  GV    +P PAI
Sbjct: 510 QIVSPQSNKPCMGVVQDTLCGIRKLTLRDNFIELGQVLNMLYWVPDWDGV----IPTPAI 565

Query: 598 MKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVVIR 655
           +KP  LWTGKQ+ S+ I      P  I+L    +    + PK          ++G +VI 
Sbjct: 566 LKPKPLWTGKQLLSVAI------PKGIHLQRFDEGTTLLSPK----------DNGMLVID 609

Query: 656 GSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGIN 715
           G QI+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI 
Sbjct: 610 G-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIG 667

Query: 716 D-VTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVR 774
           D +     ++Q  E + E A  K +++        L  + G    ++ E  +  +L++ R
Sbjct: 668 DTIADGQTMRQITEAIAE-AKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEAR 726

Query: 775 EEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 834
           ++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727 DKAGRLAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPH 786

Query: 835 FPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 894
           F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787 FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 895 DLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFDNQDE 952
           D+   YD T R S   I+QF YG DG+D   +E  A       +R+++  Y I   N D 
Sbjct: 847 DIMVHYDGTTRNSLGNIIQFIYGEDGMDAAHIEKQAVETIGGSDRNFERRYRIDLLNPDY 906

Query: 953 GLLPYAIMETANKIL 967
            L P +++E+ ++I+
Sbjct: 907 SLDP-SLLESGSEII 920

 Score =  183 bits (465), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 133/423 (31%), Positives = 209/423 (49%), Gaps = 56/423 (13%)

Query: 1056 VSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVA 1115
            V Q YR+++Q+ +  L     ++ ++ + PG  +G + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VIQEYRLTKQAFEWVLNNIEVQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1116 SMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVAYYV 1173
            S  VT GVPR+KEI+N +K + TP + A L  D   D+  A++++  +E T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKLIRSVIEHTTLKSVTVAS 1150

Query: 1174 QDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKLKIQAPDVTIIGKDKIAIN 1233
            +  Y  +     +  D   I   QL  ++ D     + A     Q+P +  +  D+ A+N
Sbjct: 1151 EIYYDPDPRSTAIPEDEEII---QLHFSLLDDETEKSLAQ----QSPWLLRLELDRAAMN 1203

Query: 1234 VFPEGYKAKSISTSAKEPSENDVFY------------RMQQLR----------------- 1264
               +      +    KE  +ND+F             R + +R                 
Sbjct: 1204 --DKDLTMGQVGEKIKETFKNDLFVIWSEDNAEQLIIRCRVVRPKSMDLETEAEEDHMLK 1261

Query: 1265 ----RALPDVVVKGLADISRAVINIRD------DGKRE------LLVEGYGLRDVMCTDG 1308
                  L ++ ++G+ +I R V+   D       G+ +      L  +G  L +VM   G
Sbjct: 1262 KIENTMLENITLRGVENIERVVMMKYDRKVPSETGEYQKIPEWVLETDGVNLSEVMTVPG 1321

Query: 1309 VIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEV 1368
            V  S+  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT +G +
Sbjct: 1322 VDASRIYTNSFIDIMEVLGIEAGRAALYKEVFNVIASDGSYVNYRHMALLVDVMTTQGGL 1381

Query: 1369 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSF 1428
              +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F
Sbjct: 1382 TSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAF 1441

Query: 1429 KVI 1431
             V+
Sbjct: 1442 DVM 1444

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
           YDL140C
          Length = 1726

 Score =  557 bits (1435), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 358/970 (36%), Positives = 526/970 (54%), Gaps = 67/970 (6%)

Query: 7   SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
           S  P R IK ++F   S  +I A S  ++   +  D  + RA +  G  DP++G    +L
Sbjct: 7   SSAPLRTIKEVQFGLFSPEEIRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66  ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLH 125
           +C TC   +  C GHFGH+ LA PVFHIG+     ++ + IC +C  +LL E +++  + 
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNEQ--MR 123

Query: 126 ELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTFRW 185
           ++ +   D+ +R      I   CK +   + C                        T R 
Sbjct: 124 QILKIK-DSKKR---FNAIWSLCKTK---MICDTDVPSEHDPTQLVSRGGCGNAQPTVRK 176

Query: 186 VGKKSAPEKDIWVGEWKEV--LTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELLG 243
            G K        VG WK+    +   E E+ +      L+  + LN+FK I   D   +G
Sbjct: 177 DGLK-------LVGSWKKEKNTSDGDEPEQRI------LSTEEILNIFKHISPEDSIAMG 223

Query: 244 IDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGL 303
            +      RPE      LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 224 FNEEF--SRPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 280

Query: 304 DKGISINNMMEHWDYLQLTVAMYINSD-SVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQG 362
             G   + + E    LQ  VA Y+++D +  P  L  S       +P++    RLKGK+G
Sbjct: 281 HNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEG 334

Query: 363 RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELVVN 422
           R RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV N
Sbjct: 335 RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTHLVRN 394

Query: 423 GPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSLHR 482
           GPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH+ D D VLFNRQPSLH+
Sbjct: 395 GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHK 452

Query: 483 LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 542
           +S+++H  ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   ++
Sbjct: 453 MSMMAHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 543 TPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSD--GVEQFDVPPPAIMKP 600
           + +S +P +   QD + G   ++ +D+F +   +  LL  + D  GV    +P PAI+KP
Sbjct: 513 SAQSNKPCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPDWDGV----IPTPAILKP 568

Query: 601 YYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPSEMSQNDGFVVIRGSQ 658
             LW+GKQ+ S+ I      P  I+L    +   F+ PK          ++G ++I G Q
Sbjct: 569 KPLWSGKQILSIAI------PKGIHLQRFDEGTTFLSPK----------DNGMLIIDG-Q 611

Query: 659 ILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVT 718
           I+ GV+DK  +G      + + + R+ GPQ  A   + + K+   +  + GFS GI D  
Sbjct: 612 IIFGVVDKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGIGDTI 670

Query: 719 PADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVG 778
              +  ++    +  A RK +E+        L  + G    ++ E  +  FL++ R++ G
Sbjct: 671 ADGETMREITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAG 730

Query: 779 DVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKN 838
            +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 731 RLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKD 790

Query: 839 SKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 898
             +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 791 DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 850

Query: 899 QYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDHAYNITFDNQDEGLLP 956
            YD+T R S   ++QF YG DG+D   +E  +       + +++  Y I   N +  L P
Sbjct: 851 HYDSTTRNSLGNVIQFVYGEDGIDAGHIEKQSIDTIGGSDAAFEKRYRIDLLNTENSLNP 910

Query: 957 YAIMETANKI 966
            +++E+  +I
Sbjct: 911 -SLLESGAEI 919

 Score =  182 bits (461), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 130/423 (30%), Positives = 208/423 (49%), Gaps = 56/423 (13%)

Query: 1056 VSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVA 1115
            V Q +++++QS +  L     ++ ++ + PG  +G + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEFKLNKQSFQWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1116 SMNVTLGVPRIKEIINASKVISTPIINAVL--VNDNDERAARVVKGRVEKTLLSDVAYYV 1173
            S  VT GVPR+KEI+N +K + TP + A L      D+  A++++  +E T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPAYAADQEKAKLIRSAIEHTTLKSVTV-A 1149

Query: 1174 QDVYKDNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKLKIQAPDVTIIGKDKIAIN 1233
             ++Y D      V  +   I +L   L  E+   ++ +      Q+P +  +  D+ A+N
Sbjct: 1150 SEIYYDPDPRTTVIAEDEEIMQLHFSLMDEETEKSLDQ------QSPWLLRLELDRAAMN 1203

Query: 1234 VFPEGYKAKSISTSAKEPSENDVF--------------------------------YRMQ 1261
               +      +    +E   ND+F                                + ++
Sbjct: 1204 --DKDLTMGQVGEKIRETFRNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDHMLK 1261

Query: 1262 QLRRA-LPDVVVKGLADISRAVINIRD------DGKRE------LLVEGYGLRDVMCTDG 1308
            ++    L ++ ++G+ +I R V+   D       G  E      L  +G  L +VM   G
Sbjct: 1262 KIENTMLENITLRGVENIERVVMMKYDRKIPGTSGAYEKVPEWVLETDGVNLLEVMTVPG 1321

Query: 1309 VIGSKTTTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEV 1368
            V  S+  TN  +++  VLGIEA R ++ +E+   +++ G  V+ RH+ LL DVMT  G +
Sbjct: 1322 VDASRIYTNSFIDITEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTNGSL 1381

Query: 1369 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSF 1428
              +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGSF
Sbjct: 1382 TSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGSF 1441

Query: 1429 KVI 1431
             V+
Sbjct: 1442 DVM 1444

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
           complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  487 bits (1253), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 266/626 (42%), Positives = 380/626 (60%), Gaps = 31/626 (4%)

Query: 348 KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEK 407
           +P++    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE 
Sbjct: 2   RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 408 VTRYNRHKLQELVVNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLE 467
           VT YN  +L +LV NGPN HPGA Y+++ N D R +LRY  R    + LQ G  +ERH+ 
Sbjct: 62  VTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIM 119

Query: 468 DGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEA 527
           D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE 
Sbjct: 120 DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 528 RAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSD-- 585
           RAE   L  V   +++P+S +P +   QD + G   ++ +DSF +   +  +L  + D  
Sbjct: 180 RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFIEFDQVLNMLYWVPDWD 239

Query: 586 GVEQFDVPPPAIMKPYYLWTGKQVFSLLIKPSHKSPVVINLDA--KNKVFVPPKSKSLPS 643
           GV    +P PAI+KP  LWTGKQ+ S+ I      P  I+L    +    + PK      
Sbjct: 240 GV----IPQPAILKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTMLSPK------ 283

Query: 644 EMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCAR 703
               ++G +VI G QI+ GV+DK  +G      + + + R+ GPQ  A     + K+   
Sbjct: 284 ----DNGMLVIDG-QIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKVVNF 337

Query: 704 FLGNRGFSIGINDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLE 763
           +L + GFS GI D     +  ++  E +  A +K +E+        L  + G    ++ E
Sbjct: 338 WLLHNGFSTGIGDTIADGETMKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFE 397

Query: 764 AKIGGFLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRV 823
             +  FL++ R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+
Sbjct: 398 DNVVRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRI 457

Query: 824 PDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETG 883
             GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETG
Sbjct: 458 AFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETG 517

Query: 884 YMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPV--NFNRSWDH 941
           Y+ RRL+K+LED+   YD+T R S   ++QF YG DG+D   +E  +       N++++ 
Sbjct: 518 YIQRRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDASYIEKQSIDTIGGSNQAFEK 577

Query: 942 AYNITFDNQDEGLLPYAIMETANKIL 967
            Y I   + +   L   ++E+ ++I+
Sbjct: 578 RYRIDLMSPEHS-LDTTLLESGSEII 602

 Score =  180 bits (456), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 138/428 (32%), Positives = 218/428 (50%), Gaps = 48/428 (11%)

Query: 1056 VSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVA 1115
            V + YR+++Q+    L     ++ ++ + PG  +G + AQSIGEP TQMTL TFHFAGVA
Sbjct: 713  VLEEYRLTKQAFDWVLSNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 772

Query: 1116 SMNVTLGVPRIKEIINASKVISTPIINAVLVNDN--DERAARVVKGRVEKTLLSDVA--- 1170
            S  VT GVPR+KEI+N +K + TP     L  +   D+  A+ ++  +E T L  V    
Sbjct: 773  SKKVTSGVPRLKEILNVAKNMKTPSSTVYLEPEYAIDQEKAKFIRSAIEHTTLKSVTVAS 832

Query: 1171 --YYVQD----VYKDNLSFIQVRIDL------GTIDK-----LQLEL---TIEDIAVAIT 1210
              YY  D    V  D+   IQ+   L        +D      L+LEL    + D  + + 
Sbjct: 833  EIYYDPDPRSTVIPDDEEIIQLHFSLLDDETEKALDNQSPWLLRLELDRAAMNDKDLTMG 892

Query: 1211 RASKLKIQAP---DVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRRA- 1266
            +  + KI+     D+ +I  +  A  +       +  S  A+  +E D  + ++++    
Sbjct: 893  QVGE-KIKETFKNDLFVIWSEDNADKLIIRCRVVRPKSLDAETEAEED--HMLKKIENTM 949

Query: 1267 LPDVVVKGLADISRAVINIRD------DGKRE------LLVEGYGLRDVMCTDGVIGSKT 1314
            L  + ++G+ DI R V+   D      +G  E      L  +G  L +VM   GV  ++ 
Sbjct: 950  LESITLRGVEDIERVVMMKYDRKMPSENGAYEKVPEWVLETDGVNLLEVMTVTGVDPTRI 1009

Query: 1315 TTNHVLEVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRF 1374
             TN  +++  VLGIEA R ++ RE+   +++ G  V+ RH+ LL DVMT +G +  +TR 
Sbjct: 1010 YTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGSLTSVTRH 1069

Query: 1375 GLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGT 1434
            G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   +GTG+F V+   
Sbjct: 1070 GFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPVGTGAFDVM--- 1126

Query: 1435 NVSEKDLI 1442
             + E+ LI
Sbjct: 1127 -IDEESLI 1133

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  449 bits (1156), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 311/974 (31%), Positives = 495/974 (50%), Gaps = 114/974 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    L  PP   R PS +  +   ++++ L   L++I+ TS LI           
Sbjct: 337  KADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDELSTLQ 393

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ I  + +M  +  +Q  V  +I+S            N GGKV PI G  Q 
Sbjct: 394  KDKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDSTK-------AQGNTGGKV-PIPGVKQA 445

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 446  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 505

Query: 417  QELVVNGPNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSLQ----------IGDVI 462
            ++ ++NGP+  PGA+ +  +NED        +    R  LA  L           +   +
Sbjct: 506  RQAIINGPDKWPGASQI--QNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLNKKV 563

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 564  YRHIKNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 623

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL- 580
            PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSF+ R    Q + 
Sbjct: 624  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 683

Query: 581  -CMM-SDG---VEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFV 634
             C+   DG     +    PPAI KP  LWTGKQ+ + +L+  +      INL + NK+  
Sbjct: 684  GCIRPEDGHATRAKLVTLPPAIHKPIPLWTGKQIITTVLLNVTPPDMPGINLKSSNKI-- 741

Query: 635  PPKSKSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K++       +ND  V+ +  Q+L G++DKS  G   K+ + +++   YGP+ AA  +
Sbjct: 742  --KNEYWGKHSEEND--VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKVL 796

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNKGELE 751
            + + +L   ++ N  F+ G++D+    D  + + ++++ +    R+    +T+ +K    
Sbjct: 797  SVLGRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILKESVDIGRQAAAEVTNLDKDTPS 856

Query: 752  TQPGC-----------NEEQTLEAKIGGFLSKVREEVGDVCI--NELDNW--NAPLIMAT 796
              P             N+   L+A     ++ +  +V   C+    +  +  N+   MA 
Sbjct: 857  NDPELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPENSMQAMAL 916

Query: 797  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 856
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+
Sbjct: 917  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGI 976

Query: 857  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTY 916
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF Y
Sbjct: 977  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFLY 1036

Query: 917  GGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLVR 976
            GGD +D ++            S    +N   DN D  L  Y        + V   +  ++
Sbjct: 1037 GGDAVDVIK-----------ESHMTEFNFCLDNYDALLKKYNPSALVEHVDV---ETALK 1082

Query: 977  YDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLANLRKSRGMLELVNAPP 1036
            Y  +        K++ +H D    E+ + ++L+    L     A         + + A  
Sbjct: 1083 YSKKTL------KNRKKHKD----EKHYKQTLKYDPVLSKYNPA---------KYLGAVS 1123

Query: 1037 KELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQS 1096
            +  Q  D  E        +  +   I+E   KKF  +   KY ++ + PG A+G I +QS
Sbjct: 1124 ENFQ--DKLELFLDKSSKTFKEYESINE---KKFRALMQLKYMRSLINPGEAVGIIASQS 1178

Query: 1097 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAAR 1155
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ND  +  A 
Sbjct: 1179 VGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSDETAD 1238

Query: 1156 VVKGRVEKTLLSDV 1169
                 + K +LS+V
Sbjct: 1239 TFCKSISKVILSEV 1252

 Score = 88.6 bits (218), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 88/163 (53%), Gaps = 2/163 (1%)

Query: 1270 VVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGI 1328
             +++ +  I R +    ++GKR L+ EG   + +   +  I     T+N +  V    G+
Sbjct: 1477 TIIRQVPHIDRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDIASVLQTYGV 1536

Query: 1329 EAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLAS 1388
            EAAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S
Sbjct: 1537 EAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-S 1595

Query: 1389 FEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            +E T   L  A    +++ +E  S  I+LG+  ++GTG+F ++
Sbjct: 1596 YETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDIL 1638

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++F  L++ADI   S   ++   + D      P + G  D  +G    +L C TC  
Sbjct: 11  ISSVDFGILTSADIRNLSAKRITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CGTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   D  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYACKLR 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  446 bits (1147), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 312/971 (32%), Positives = 496/971 (51%), Gaps = 132/971 (13%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--------------AGLDKGIS 308
            PP   R PS +  +   ++++ L   L++I+ TS LI+              A  D+ I 
Sbjct: 357  PPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDEISKLQKDKVALDDRRII 413

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + +M  +  +Q  V  +I+S            N  GK+ P+ G  Q L+ K+G FR ++
Sbjct: 414  FSRLMNAFVTIQNDVNSFIDSSK-------AQGNNSGKL-PVPGVKQALEKKEGLFRKHM 465

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELVVNGPNVHP 428
             GKRV+++ R+VISPDPN+  DE+ VP   A  LTYPE VT YN  +L++ V+NGP+  P
Sbjct: 466  MGKRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWP 525

Query: 429  GANYLLKKNEDARR----NLRYGDRMKLAKSLQ----------IGDVIERHLEDGDVVLF 474
            GA  +  +NED        +    R  LA  L           +   + RH+++ DVV+ 
Sbjct: 526  GATQI--QNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHTLNKKVYRHIKNRDVVIM 583

Query: 475  NRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAIN 533
            NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA N
Sbjct: 584  NRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFN 643

Query: 534  LMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL--CMM-SDGVE-- 588
            L    +  LTP SG P+    QD I+    ++ KDS++ R    Q +  C+   DG    
Sbjct: 644  LANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQYQQYIYGCIRPEDGHSAN 703

Query: 589  -QFDVPPPAIMKPYYLWTGKQVFSLLIKPSHKSPV---VINLDAKNKVFVPPKSKSLPSE 644
             +    PPAI+KP  LWTGKQ+ + ++   + SPV    INL +KNK+    K +     
Sbjct: 704  NKLLTIPPAIIKPVPLWTGKQIITTVL--LNVSPVDMPGINLKSKNKI----KDEYWGQH 757

Query: 645  MSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARF 704
              +N+  V+ +   +L G++DKS  G   K+ + + +   YGP+ AA  ++ + +L   +
Sbjct: 758  SEENE--VLFKDGALLCGILDKSQYG-ASKYGIVHALQEVYGPEVAAKVLSVLGRLFTNY 814

Query: 705  LGNRGFSIGINDVTPADD------------LKQKKEELVEIAYRKCDELITSFNKGEL-- 750
            + N  F+ G++D+   D+            + + ++  VE+   + D   TS +  EL  
Sbjct: 815  ITNTAFTCGMDDLRLTDEGNKWRTDILKTSVDRGRQAAVEVTNLEKD---TSADDSELLK 871

Query: 751  ---ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCI--NELDNW--NAPLIMATCGSKGST 803
               E     N+   L+A     ++ +  +V   C+    +  +  N+   MA  G+KGS 
Sbjct: 872  RLEEILRDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRFPENSMQSMALSGAKGSN 931

Query: 804  LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLF 863
            +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ F
Sbjct: 932  VNVSQIMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMAGGYIKGRFYSGIKPQEYYF 991

Query: 864  HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDP 923
            H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F YGGD +D 
Sbjct: 992  HCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLIEFLYGGDAVDV 1051

Query: 924  LEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFL 983
             +            S+ + ++   DN D  L  Y      + + V   D  ++Y  +   
Sbjct: 1052 TK-----------ESYMNQFDFCLDNYDSLLKRYNPAALIDFLDV---DSALKYSKKTLK 1097

Query: 984  VKDEDKDKAEHVD--QYDAERDFYRSLREYINLKATTLANLRKSRGMLELVNAPPKELQG 1041
             + ++K+   ++   +YD                   LA    ++ +  +      +L+ 
Sbjct: 1098 HRKKNKNVPHYLQNIKYDP-----------------VLAKYNPAKYLGSVSEKFQDKLE- 1139

Query: 1042 MDPDEAVPTNVRTSVSQLYRISEQSV--KKFLEIALFKYRKARLEPGTAIGAIGAQSIGE 1099
                     N   S SQL++ S +SV  KKF  +   KY ++ + PG A+G I +QS+GE
Sbjct: 1140 ---------NFLDSNSQLFK-SHKSVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGE 1189

Query: 1100 PGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAARVVK 1158
            P TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  +  A +  
Sbjct: 1190 PSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVTDDQADIFA 1249

Query: 1159 GRVEKTLLSDV 1169
              + K +LS+V
Sbjct: 1250 KSISKVILSEV 1260

 Score = 91.3 bits (225), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 90/167 (53%), Gaps = 12/167 (7%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLR------DVMCTDGVIGSKTTTNHVLEVFS 1324
            VV+ + +I R V    ++GKR L+ EG   +      D +  DG+     T+N V  V  
Sbjct: 1481 VVRQVPNIDRCVHPNAENGKRVLVTEGVNFQAMWEQNDFVNVDGI-----TSNDVSSVLK 1535

Query: 1325 VLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
              G+EAAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1536 TYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLM 1595

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            ++ S+E T   L  A    +++ +   S  I+LG+  ++GTG+F V+
Sbjct: 1596 KM-SYETTCQFLTKAVLDNEREELNSPSARIVLGKLNNVGTGAFDVL 1641

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++FS LSA +I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFSILSAEEIRNLSTKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSVEVHRYTCKLK 123

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  444 bits (1142), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 306/970 (31%), Positives = 498/970 (51%), Gaps = 106/970 (10%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISIN 310
            + + +    +  PP   R PS M ++   + ++ L   L++I+ TS LI+   D+  +I 
Sbjct: 350  KADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLNDEMSTIQ 406

Query: 311  NMMEHWDYLQLTVAMYINS-----DSVNPAMLPGSSNGGGKVK-PIRGFCQRLKGKQGRF 364
                  D  ++  +  +N+     + VN  +    + G    K P+ G  Q L+ K+G F
Sbjct: 407  KDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGSASSKIPVPGVKQALEKKEGLF 466

Query: 365  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELVVNGP 424
            R ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ V+NGP
Sbjct: 467  RKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELRQAVINGP 526

Query: 425  NVHPGANYLLKKNEDARR----NLRYGDRMKLAKSLQ----------IGDVIERHLEDGD 470
            +  PGA+ +  +NED        +    R  LA  L           +   + RH+++ D
Sbjct: 527  DKWPGASQI--QNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLNKKVYRHIKNRD 584

Query: 471  VVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARA 529
            VVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARA
Sbjct: 585  VVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARA 644

Query: 530  EAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL--CMMSDGV 587
            EA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +  C+  +  
Sbjct: 645  EAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGCIRPEHG 704

Query: 588  E----QFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFVPPKSKSLP 642
                 +    PPA++KP  LWTGKQ+ S +L+  +      INL++ NK+    K++   
Sbjct: 705  HASRGKIVTMPPAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESNNKI----KNEYWG 760

Query: 643  SEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCA 702
               ++ND  V+ +  +++ G++DKS  G   K+ + +++   YGP+ AA  ++ + +L  
Sbjct: 761  KGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSVLGRLFT 817

Query: 703  RFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNKG------EL--- 750
             ++    F+ G++D+    +  + + E+++ +    R+    +T+ +K       EL   
Sbjct: 818  NYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLDKDTPSDDVELLKR 877

Query: 751  --ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMATCGSKGSTL 804
              E     N+   L+A     ++ V  +V   C+ +       +N+   MA  G+KGS +
Sbjct: 878  LEEILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNV 937

Query: 805  NVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFH 864
            NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ FH
Sbjct: 938  NVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSGIKPQEYYFH 997

Query: 865  AISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPL 924
             ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D +
Sbjct: 998  CMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSLIQFLYGGDAVD-V 1056

Query: 925  EMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFLV 984
              E +    +F R          +N D  L  Y  +  A  + V   +  ++Y  +  + 
Sbjct: 1057 TKESHMTQFDFCR----------ENYDALLKKYNPVALAEHLDV---ETALQYSKK--VS 1101

Query: 985  KDEDKD-KAEHVDQ---YDAERDFYRSLREYINLKATTLANLRKSRGMLELVNAPPKELQ 1040
            K+  K+ K  H +Q   YD                   LA    ++ +  +      +L+
Sbjct: 1102 KNRKKNSKTAHYEQKVKYDP-----------------VLAKYNPAKYLGSVSEKFHDKLE 1144

Query: 1041 GMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEP 1100
                D+A     R SV         S K+F  +   KY ++ + PG A+G I +QS+GEP
Sbjct: 1145 SYLEDKAKEFKSRESV---------SAKRFRALMQLKYMRSLINPGEAVGIIASQSVGEP 1195

Query: 1101 GTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAARVVKG 1159
             TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + +D  +  A +   
Sbjct: 1196 STQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSAIKTPQMTLPIWDDVSDEQADLFCK 1255

Query: 1160 RVEKTLLSDV 1169
             + K +LS+V
Sbjct: 1256 SISKVVLSEV 1265

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V++ +  I R V +   + KR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1497 VIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRTYGVE 1556

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1615

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A    +++ +E  S  I+LG+  ++GTGSF ++
Sbjct: 1616 ETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLL 1657

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  L+F+ L+  DI   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSLDFNILTPQDIRNLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L + +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFCHHFRLKKVEVHRYACKLK 123

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  441 bits (1135), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 316/986 (32%), Positives = 492/986 (49%), Gaps = 132/986 (13%)

Query: 254  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------------ 300
            + +    L  PP   R PS +  +   + ++ L   L++I+ TS LI+            
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSRLQKD 409

Query: 301  --AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLK 358
              +  D+ +  N +M  +  +Q  V  +I+S           S+ G KV PI G  Q L+
Sbjct: 410  KVSADDRKVIFNRLMNAFVTIQNDVNAFIDSTK-------AQSSSGNKV-PIPGLKQALE 461

Query: 359  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQE 418
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQ 521

Query: 419  LVVNGPNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSL----------QIGDVIER 464
             V+NGP+  PGA  +  +NED        +    R  LA  L           I   + R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYR 579

Query: 465  HLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 523
            H+++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 524  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL--C 581
             E A+AEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +  C
Sbjct: 640  NENAKAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 582  MM-SDG---VEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFVPP 636
            +   DG     +    PPA+MKP  LWTGKQ+ + +L+     +   INL++KNK+    
Sbjct: 700  IRPEDGHATRNKLVTIPPAVMKPEPLWTGKQIITTVLLNTCPANMPGINLNSKNKI---- 755

Query: 637  KSKSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNR 696
            K++       +N+  VV +  Q+L G++DKS  G   K  + +++   YGP  AA  ++ 
Sbjct: 756  KNEYWGKSSEENN--VVFKDGQLLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLSV 812

Query: 697  MAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNK------ 747
            + +L   ++    F+ G++D+    +  + + ++++ +    R     +T+ +K      
Sbjct: 813  LGRLFTNYITATAFTCGMDDLRLTAEGNKWRNDILQTSVDIGRVAAAEVTNLDKDVKSDD 872

Query: 748  GEL-----ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMATCG 798
            GEL     E     N+   L+A     ++ +  +V   C+ +       +N+   MA  G
Sbjct: 873  GELLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMALSG 932

Query: 799  SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSP 858
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P
Sbjct: 933  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIRP 992

Query: 859  PEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGG 918
             E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGG
Sbjct: 993  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLYGG 1052

Query: 919  DGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLVRYD 978
            D +D +  E +     F            DN D  L  Y                     
Sbjct: 1053 DAVD-ITKESHMTEFKF----------CVDNYDALLKKY--------------------- 1080

Query: 979  NRGFLVKDEDKDKAEHVDQYDAERDFYRSLREY-INLKATTLANLRKSRGMLELVNAPPK 1037
            N   LV        +H+D   A +   ++L+    N K    A   K   +L   N P K
Sbjct: 1081 NPSALV--------DHLDVESALKYSKKTLKNRKKNSKLPHYAQTSKYDPVLSKFN-PSK 1131

Query: 1038 ELQGMDPDEAVPTNVRTSVSQLYRISEQSVK--------KFLEIALFKYRKARLEPGTAI 1089
             L       AV  N +  + +    ++   K        KF  +   KY ++ + PG A+
Sbjct: 1132 YLG------AVSENFQDKLEKFISTNDDFFKKDENVNEKKFRALMQLKYMRSLINPGEAV 1185

Query: 1090 GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVND 1148
            G I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + +D
Sbjct: 1186 GIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQLTMPIRDD 1245

Query: 1149 NDERAARVVKGRVEKTLLSDVAYYVQ 1174
              +  A      + K +LS+V   VQ
Sbjct: 1246 VSDELADTFCKNITKVMLSEVIDKVQ 1271

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +  I R V    ++GKR L+ EG   + +   D  I  +   +N V  V    G+E
Sbjct: 1488 IIRQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDINGIRSNDVAAVLKTYGVE 1547

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1548 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSLMKM-SY 1606

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A    + + ++  S  I++G+   +GTGSF ++
Sbjct: 1607 ETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDLL 1648

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 58/133 (43%), Gaps = 12/133 (9%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++FS L++ +I   S  +V+   + D      P   G  D  +G    +L C TC  
Sbjct: 11  ITSIDFSVLTSDEIRKLSAKQVTNPTVLD--NLGHPIQGGLYDLALGAFLKNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR---- 128
           +   C GH GH++L +P ++  +F      L+  C  C    L  ++   +  +LR    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYACKLRLLQY 127

Query: 129 -----RPGVDNLR 136
                R  +DN+R
Sbjct: 128 ALIDERYQIDNIR 140

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  442 bits (1136), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 313/976 (32%), Positives = 495/976 (50%), Gaps = 120/976 (12%)

Query: 253  PETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----------- 300
            P+ +    +  PP   R PS + ++   + ++ L   L++++ TS LI+           
Sbjct: 353  PDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMSNLQK 409

Query: 301  ---AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRL 357
               +  D+ +  + +M  +  +Q  V  +I+S         GS+  GGKV PI G  Q L
Sbjct: 410  DKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQ-----GST--GGKV-PIPGVKQAL 461

Query: 358  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQ 417
            + K+G FR ++ GKRV+ + R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+
Sbjct: 462  EKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 521

Query: 418  ELVVNGPNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSL----------QIGDVIE 463
            + V+NGP+  PGA  +  +NED        +    R  LA  L           +   + 
Sbjct: 522  QAVINGPDKWPGATQI--QNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLNKKVF 579

Query: 464  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 522
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 580  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 639

Query: 523  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL-- 580
            Q E AR+EA NL    +  LTP SG P+    QD I+    +++KDSF+ R    Q +  
Sbjct: 640  QNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQYIYG 699

Query: 581  CMM-SDGVE---QFDVPPPAIMKPYYLWTGKQVFSLLIKPSHKSPVV-INLDAKNKVFVP 635
            C+   DG     +    PPA+MKP  LWTGKQ+ + +I     + +  INL +KNK+   
Sbjct: 700  CIRPEDGHSTRPKIVTVPPAVMKPVPLWTGKQIITTVIMNVTPADMPGINLLSKNKI--- 756

Query: 636  PKSKSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMN 695
             K++      ++N+  V+ +   +L G++DKS  G   K+ + +++   YGP+ AA  ++
Sbjct: 757  -KNEYWGQGSTENE--VIFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKVLS 812

Query: 696  RMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSF------N 746
             + +L   F+ N  FS G++D+    +  + +++L++ +    R+    +T+       N
Sbjct: 813  VLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGRQAAAEVTNLPTDTPSN 872

Query: 747  KGEL-----ETQPGCNEEQTLEA----KIGGFLSKVREEVGDVCINELDNWNAPLIMATC 797
              EL     E     N+   L+A    K+    SKV   V      +    N+   MA  
Sbjct: 873  DPELLKRLEEILRDDNKSGILDAVTSSKVNSVTSKVVSTVIPKGTMKKFPQNSMQAMALS 932

Query: 798  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLS 857
            G+KGST+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ 
Sbjct: 933  GAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSGIK 992

Query: 858  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYG 917
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF YG
Sbjct: 993  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYDNTVRDGDGTLVQFLYG 1052

Query: 918  GDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLVRY 977
            GD +D  +     Q           ++   +N D  L  Y        + V   +  ++Y
Sbjct: 1053 GDAVDTTKESHMTQ-----------FDFCLENYDALLRKYNPSALVEHLDV---ESALKY 1098

Query: 978  DNRGFLVKDEDKDKAEHV---DQYDAERDFYRSLREYINLKATTLANLRKSRGMLELVNA 1034
              +  L   +  DK  H    D+YD                   L+    ++ +  +   
Sbjct: 1099 SKKA-LKSRKKIDKEPHYKNSDKYDP-----------------VLSKYNPAKYLGSVSEK 1140

Query: 1035 PPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGA 1094
               +L+G          + +   QL   S  + KKF  +   KY ++ + PG A+G I A
Sbjct: 1141 FQDKLEGF---------LDSHSKQLKLHSGINEKKFRALMQLKYMRSLVNPGEAVGIIAA 1191

Query: 1095 QSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERA 1153
            QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP ++  + N   +  
Sbjct: 1192 QSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIVMTASAAIKTPQMSLPVWNHVSDDQ 1251

Query: 1154 ARVVKGRVEKTLLSDV 1169
            A +    + K +LS+V
Sbjct: 1252 ASIFCKSITKVVLSEV 1267

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 82/162 (50%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V++ +  ISR +       +R L  EG   + +   +  I      +N V  V    G+E
Sbjct: 1500 VIREVPHISRCIPGEPVGDRRMLTTEGVNFQAMWDQEMFIDVDGIRSNDVAAVLRTYGVE 1559

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1560 AARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQGMETSTSSFMKM-SY 1618

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A     ++ ++  S  I+LG+  ++GTG+F V+
Sbjct: 1619 ETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVL 1660

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++F+  SA +I   S  +++   + D      P + G  D  +G    +L C TC  
Sbjct: 11  ISSVDFNVFSAEEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  +F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFACKLR 123

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  439 bits (1128), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 307/980 (31%), Positives = 491/980 (50%), Gaps = 116/980 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS + ++   + ++ L   L++I+ TS LI+          
Sbjct: 346  RADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 402

Query: 301  ----AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
                +  DK +  N +M  +  +Q  V  +I+S            N GGKV PI G  Q 
Sbjct: 403  KDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTK-------AQGNTGGKV-PIPGVKQA 454

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 455  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 514

Query: 417  QELVVNGPNVHPGANYLLKKNEDARRNLRYG----DRMKLAKSL----------QIGDVI 462
            ++ V+NGP+  PGA  +  +NED       G     R  LA  L           +   +
Sbjct: 515  RQAVINGPDKWPGATQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKV 572

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 573  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 632

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL- 580
            PQ E ARAEA NL    +  LTP SG P+    QD I+    +++KDSF+ R    Q + 
Sbjct: 633  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIY 692

Query: 581  -CMM-SDG---VEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFV 634
             C+   DG     +    PPA+ KP  LWTGKQ+ + +L+  +      INL +KNK+  
Sbjct: 693  GCIRPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKI-- 750

Query: 635  PPKSKSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K++      ++ND  VV +  ++L G++DKS  G   K+ + +++   YGP  +A  +
Sbjct: 751  --KNEYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVSAKVL 805

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNK---- 747
            + + +L   ++    F+ G++D+   ++  + + ++++ +    R     +T+ +K    
Sbjct: 806  SVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLDKDVSA 865

Query: 748  --GEL-----ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCI-----NELDNWNAPLIMA 795
               EL     E     N+   L+A     ++ +  +V   C+      +  N N+   MA
Sbjct: 866  NDSELLKRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPN-NSMQAMA 924

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 925  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKGRFYSG 984

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF 
Sbjct: 985  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1044

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLV 975
            YGGD +D  +     Q           +    DN D  L  Y        + V   +  +
Sbjct: 1045 YGGDAVDVTQESHMTQ-----------FKFCADNYDALLKKYNPAALIEHLDV---ESAL 1090

Query: 976  RYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLANLRKSRGMLELVNAP 1035
            +Y  +      + + K E V  Y  +  +              ++    S+ +  +    
Sbjct: 1091 KYSKKAL----KHRKKTEKVPHYSQKVKY-----------DPVVSKFNPSKYLGSVSENF 1135

Query: 1036 PKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQ 1095
              +L+            R +VS+         KKF  +   KY ++ + PG A+G I +Q
Sbjct: 1136 QDKLESFIDSNNDLFKSRDTVSE---------KKFRALMQLKYMRSLINPGEAVGIIASQ 1186

Query: 1096 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAA 1154
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  +  A
Sbjct: 1187 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADVTDPQA 1246

Query: 1155 RVVKGRVEKTLLSDVAYYVQ 1174
                  V K +LS+V   V+
Sbjct: 1247 DTFCKSVTKVMLSEVVDRVE 1266

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 90/162 (55%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V++ + +I R V    ++GKR L+ EG   +++   D  I  +  T+N V  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVE 1546

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A    + + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1606 ETTCQFLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVL 1647

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 63/138 (45%), Gaps = 13/138 (9%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++F  ++A DI   S ++++   + D      P + G  D  +G    +L C TC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELRRPGV 132
           +   C GH GH++L +P ++  +F      L+  C  C    L  ++  ++  +L+    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYACKLK---- 123

Query: 133 DNLRRMGILKKILDQCKK 150
             L + G    ++D+C K
Sbjct: 124 --LLQYG----LIDECYK 135

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  435 bits (1118), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 296/916 (32%), Positives = 476/916 (51%), Gaps = 114/916 (12%)

Query: 304  DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGR 363
            D+ I  + +M  +  +Q  V  +I+S              GGK+ PI G  Q L+ K+G 
Sbjct: 423  DRRIIFSRLMNAFVTIQNDVNAFIDSTK-------AQGTAGGKL-PIPGVKQALEKKEGL 474

Query: 364  FRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELVVNG 423
            FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ V+NG
Sbjct: 475  FRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVING 534

Query: 424  PNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSLQ----------IGDVIERHLEDG 469
            P+  PGA  +  +NED        +    R  LA  L           +   + RH+++ 
Sbjct: 535  PDKWPGATQI--QNEDGSLVSLIGMSTEQRKALANQLMTPSSNITTHTLNKKVYRHIKNR 592

Query: 470  DVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEAR 528
            D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E AR
Sbjct: 593  DIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENAR 652

Query: 529  AEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL--CMM-SD 585
            AEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +  C+   D
Sbjct: 653  AEASNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPED 712

Query: 586  G---VEQFDVPPPAIMKPYYLWTGKQVFS---LLIKPSHKSPVVINLDAKNKVFVPPKSK 639
            G     +    PP I KP  LWTGKQ+ S   L I P++     INL + NK+    K++
Sbjct: 713  GHATRSKLITMPPTIHKPVPLWTGKQIISTVLLNITPANMPG--INLKSSNKI----KNE 766

Query: 640  SLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAK 699
               +   +N+  V+ +  ++L G++DKS  G   K  + +++   YGP  AA  ++ + +
Sbjct: 767  YWGTGSQENE--VLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSVAAKVLSVLGR 823

Query: 700  LCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNKGELETQPGC 756
            L   ++ +  F+ G++D+   ++  + + ++++ +    R+    +T+ +K      P  
Sbjct: 824  LFTNYIMSTAFTCGMDDLRLTEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTPANDPEL 883

Query: 757  -----------NEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMATCGSKG 801
                       N+   L+A     ++ +  +V   C+ +       +N+   MA  G+KG
Sbjct: 884  LKRLQEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSGAKG 943

Query: 802  STLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEF 861
            S +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+
Sbjct: 944  SNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEY 1003

Query: 862  LFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGL 921
             FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF YGGD +
Sbjct: 1004 YFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHISYDNSVRDTDGTLIQFLYGGDAV 1063

Query: 922  DPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPY---AIMETANKILVPLEDRLVRYD 978
            D  +            S    ++   DN D  L  Y   A++E  +       +  ++Y 
Sbjct: 1064 DVTK-----------ESHMTEFDFCLDNYDALLNKYNPSALIEHLDV------ESALKYS 1106

Query: 979  NRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLANLRKSRGMLELVNAPPKE 1038
             +        K++ +H+ +       Y+   +Y       L+    ++ +  +      +
Sbjct: 1107 KKSL------KNRKKHIKE-----PHYKQNIKY----DPVLSKFNPAKYLGSVSEKFQDK 1151

Query: 1039 LQG-MDPDEAVPTNVRTSVSQLYRISEQSV--KKFLEIALFKYRKARLEPGTAIGAIGAQ 1095
            L+G +D +           S+L++ S  SV  KKF  +   KY ++ + PG A+G I +Q
Sbjct: 1152 LEGYLDKN-----------SKLFK-SHDSVNEKKFRALMQLKYMRSLINPGEAVGIIASQ 1199

Query: 1096 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVND-NDERA 1153
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ND +DE+A
Sbjct: 1200 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSDEQA 1259

Query: 1154 ARVVKGRVEKTLLSDV 1169
                K  + K +LS+V
Sbjct: 1260 DTFCKS-ISKVVLSEV 1274

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +  I R +    ++GKR L+ EG     +   +  I     T+N V  V    G+E
Sbjct: 1505 IIREVPHIDRCIHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1564

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1565 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1623

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A    +++ +E  S  I++G+  ++GTGSF ++
Sbjct: 1624 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1665

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++F  L++ +I   S  +++   + D      P   G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTSDEIRQLSAKQITNPTVLD--NLGHPITGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  +F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFASKLR 123

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  433 bits (1114), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 303/981 (30%), Positives = 489/981 (49%), Gaps = 126/981 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            +P+ +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 353  KPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 409

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S           + GG  V P  G  Q 
Sbjct: 410  KDKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDSSKAQ------GNTGGNDVIP--GVKQA 461

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 462  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSYNIAEL 521

Query: 417  QELVVNGPNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSLQ----------IGDVI 462
            ++ V+NGP+  PGA  +  +NED        +    R  LA  L           +   +
Sbjct: 522  RQAVINGPDKWPGA--IQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHVLNKKV 579

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 580  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 639

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL- 580
            PQ E ARAE++ L    +  LTP SG P+    QD I+    +++KDSF+ R    Q + 
Sbjct: 640  PQNENARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 699

Query: 581  -CMM-SDG---VEQFDVPPPAIMKPYYLWTGKQVFS---LLIKPSHKSPVVINLDAKNKV 632
             C+   DG     +    PP I KP  LWTGKQ+ +   L I PS      INL +KNK+
Sbjct: 700  GCIRPEDGHATRAKIVTLPPTIFKPIPLWTGKQIITTVLLNITPSDMPG--INLHSKNKI 757

Query: 633  FVPPKSKSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAAN 692
                  K+       N+  V+ +   +L G++DK+  G  K + + +++   YGP  AA 
Sbjct: 758  ------KNEYWGKGSNENEVIFKDGALLCGILDKNQYGSSK-YGIVHSLHELYGPDVAAK 810

Query: 693  AMNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNKGE 749
             ++ + +L   ++    F+ G++D+   D+  + + ++++ +    R+    +T+ +K  
Sbjct: 811  VLSVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNLSKDT 870

Query: 750  LETQPGC-----------NEEQTLEAKIGGFLSKVREEVGDVCI----NELDNWNAPLIM 794
                P             N+   L+A     ++ +  +V   C+     +   +N+   M
Sbjct: 871  PADDPELLKRLEEILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFPYNSMQAM 930

Query: 795  ATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFS 854
            A  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+S
Sbjct: 931  ALSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGRFYS 990

Query: 855  GLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQF 914
            G+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F
Sbjct: 991  GIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIEF 1050

Query: 915  TYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLL----PYAIMETANKILVPL 970
             YGGD +D  +            S+   +    +N D GL+    P A++E  N      
Sbjct: 1051 LYGGDAVDVTK-----------ESYMTQFKFCLENYD-GLVKKYNPSALIEHLNV----- 1093

Query: 971  EDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLANLRKSRGMLE 1030
             +  ++Y  +      + + K   V  Y     +   L +Y   K     + +    + E
Sbjct: 1094 -ESALKYSKKAL----KYRKKHSSVPHYLQNSKYDPVLAKYNPSKYLGSVSEKFQDKLEE 1148

Query: 1031 LVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIG 1090
             +N   K ++  +                  ++E   KKF  +   KY ++ ++PG ++G
Sbjct: 1149 FLNENSKLVKSTEG-----------------VNE---KKFRALMQLKYMRSLIDPGESVG 1188

Query: 1091 AIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDN 1149
             I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +N  ++ND 
Sbjct: 1189 IIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSSIKTPQMNLPILNDV 1248

Query: 1150 DERAARVVKGRVEKTLLSDVA 1170
              + A      + K LLS V 
Sbjct: 1249 SNQQAETFCKSITKVLLSQVT 1269

 Score = 91.3 bits (225), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V++ + +I R V    ++G R L+ EG   + +   D  I   K T+N V  V    G+E
Sbjct: 1492 VIREVPNIERCVYPEANNGDRSLITEGVNFQAMWDQDTFIDVDKITSNDVSAVLRTYGVE 1551

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1552 AARNTIVNEIDRVFSTYAISVSSRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1610

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A    + + +   S  I+LG+  ++GTGSF ++
Sbjct: 1611 ETTCQFLTKAVLDNEHEELNSPSARIVLGKLNNVGTGSFDIL 1652

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++F  LS+  I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFEILSSDQIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGQ 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   D   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLDTHLYSCKLK 123

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  430 bits (1105), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 302/976 (30%), Positives = 491/976 (50%), Gaps = 118/976 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S               GKV PI G  Q 
Sbjct: 408  KDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PIPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QELVVNGPNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSL----------QIGDVI 462
            ++ V+NGP+  PGA  +  +NED        + +  R  LA  L           +   +
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSFEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL- 580
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 581  -CMM-SDG---VEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFV 634
             C+   DG     +    PP I KPY LWTGKQ+ + +L+  +      INL +KNK+  
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKN 757

Query: 635  PPKSK-SLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANA 693
                K SL SE+   DG        +L G++DKS  G   K+ + +++   YGP+ AA  
Sbjct: 758  EYWGKGSLESEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKV 809

Query: 694  MNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNKGEL 750
            ++ + +L   ++    F+ G++D+    +  + + ++++ +    R+    +T+ +K   
Sbjct: 810  LSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKETP 869

Query: 751  ETQPGC-----------NEEQTLEAKIGGFLSKVREEVGDVCINE--LDNW--NAPLIMA 795
               P             N+   L+A     ++ +  +V   C+ +  +  +  N+   MA
Sbjct: 870  SDDPELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMA 929

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG
Sbjct: 930  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSG 989

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++QF 
Sbjct: 990  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQFM 1049

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLV 975
            YGGD +D   +   +    F    D+ Y +        L+ +  +E+A K       + +
Sbjct: 1050 YGGDAVD---ITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALK----YSKKTL 1102

Query: 976  RYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLANLRKSRGMLELVNAP 1035
            +Y           + K      Y     +   L +Y   K     +      +   ++  
Sbjct: 1103 KY-----------RKKHSKEPHYKQSMKYDPVLAKYSPAKYLGSVSENFQDKLESFLDEN 1151

Query: 1036 PKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQ 1095
             K  +  D                  ++E+  +  +++   KY ++ + PG A+G I +Q
Sbjct: 1152 SKLFKSTDG-----------------VNEKKFRALMQL---KYMRSLINPGEAVGIIASQ 1191

Query: 1096 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVND-NDERA 1153
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + +D +DE+A
Sbjct: 1192 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDVSDEQA 1251

Query: 1154 ARVVKGRVEKTLLSDV 1169
                K  + K LLS+V
Sbjct: 1252 DTFCKS-ISKVLLSEV 1266

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +  I R V    ++GKR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EIN   S + +SV  RH+ LL D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++F  L+A +I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  424 bits (1089), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 304/968 (31%), Positives = 489/968 (50%), Gaps = 125/968 (12%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--------------AGLDKGIS 308
            PP   R PS M ++   ++++ L   L++I+ T+ LI+              +  D+ I 
Sbjct: 367  PPTRFRLPSKMGEEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRII 423

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + +M  +  +Q  V  +I+S         GS+  GG V P+ G  Q L+ K+G FR ++
Sbjct: 424  FSRLMNGFVTIQNDVNAFIDSTKAQ-----GST--GGNV-PVPGVKQALEKKEGLFRKHM 475

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELVVNGPNVHP 428
             GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ V+NGP+  P
Sbjct: 476  MGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWP 535

Query: 429  GANYLLKKNEDARR----NLRYGDRMKLAKSLQ-----------IGDVIERHLEDGDVVL 473
            GA  L  +NED        +    R  LA  L            +   + RH+++ D+V+
Sbjct: 536  GA--LQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRDIVI 593

Query: 474  FNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAI 532
             NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA 
Sbjct: 594  MNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAF 653

Query: 533  NLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL--CMM-SDGVE- 588
            NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +  C+   DG   
Sbjct: 654  NLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHAT 713

Query: 589  --QFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEM 645
              +    PPA+ KP  LWTGKQ+ + +L+  +      INL + NK+    K++      
Sbjct: 714  RPKLVTVPPAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI----KNEYWGKSS 769

Query: 646  SQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFL 705
             +N+  V+ +  ++L G++DK+  G   K+ + +++   YGP  AA  ++ + +L   ++
Sbjct: 770  EENE--VLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFTNYI 826

Query: 706  GNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNKGELETQPGC------ 756
                F+ G++D+    +  + ++++++ +    R+    +T+  K      P        
Sbjct: 827  MATAFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKRLQE 886

Query: 757  -----NEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMATCGSKGSTLNVS 807
                 N+   L+A     ++ +  +V   C+ +       +N+   MA  G+KGS +NVS
Sbjct: 887  VLRDNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNVNVS 946

Query: 808  QMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAIS 867
            Q++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH ++
Sbjct: 947  QIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMA 1006

Query: 868  GREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEME 927
            GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF Y   G D +++ 
Sbjct: 1007 GREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLY---GGDAVDVT 1063

Query: 928  GNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFLVKDE 987
              +    F+           +N D  L  Y                     N   L+   
Sbjct: 1064 KESHMTKFD--------FCLENYDALLKKY---------------------NPSALI--- 1091

Query: 988  DKDKAEHVDQYDAERDFYRSLR-EYINLKATTLANLRKSRGMLELVNAPPKELQGMDPDE 1046
                 EH+D   A +   +SL+    + K        K   +L   N P K L  +   E
Sbjct: 1092 -----EHLDVESALKYSKKSLKYRKKHAKEAHYKQSPKYDPVLAKYN-PAKYLGSVS--E 1143

Query: 1047 AVPTNVRTSV---SQLYRISEQ-SVKKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGT 1102
                 + T +   S+L++ ++  S KKF  +   KY ++ + PG A+G I +QS+GEP T
Sbjct: 1144 KFQDKLETFIDKNSKLFKHNDDISEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPST 1203

Query: 1103 QMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAARVVKGRV 1161
            QMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  ++ A      +
Sbjct: 1204 QMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDQQADTFSKSI 1263

Query: 1162 EKTLLSDV 1169
             K LLS+V
Sbjct: 1264 SKVLLSEV 1271

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 89/167 (53%), Gaps = 12/167 (7%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLR------DVMCTDGVIGSKTTTNHVLEVFS 1324
            ++  +  I R V    ++GKR L+ EG   +      D +  DG+     T+N V  V  
Sbjct: 1501 IINQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEDFIDVDGI-----TSNDVSAVLK 1555

Query: 1325 VLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
            V G+EAAR +IV EI+     + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1556 VYGVEAARNTIVNEISNVFGRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLM 1615

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            ++ S+E T   L  A    +++ ++  S  I++G+  ++GTGSF ++
Sbjct: 1616 KM-SYETTCQFLTKAVLDHERENLDSPSARIVVGKLNNVGTGSFDIL 1661

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 52/117 (44%), Gaps = 3/117 (2%)

Query: 12  RIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCH 71
           RI  ++F   SA ++ A S  +++   + D      P + G  D  +G    ++ C +C 
Sbjct: 10  RISSVDFDVFSAKEVRALSVKQITNPTVLD--NLGHPISGGLYDLALGAFLRNM-CASCG 66

Query: 72  GNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
            +   C GH GH++L +P ++  +F      L+  C  C    L   +   F  +LR
Sbjct: 67  LDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFAMKLR 123

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  417 bits (1071), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 299/974 (30%), Positives = 481/974 (49%), Gaps = 114/974 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+          
Sbjct: 340  KADMFFMEVVVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 396

Query: 301  ----AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
                +  D+ +  N +M  +  +Q  V  +I+       +     N GGKV PI G  Q 
Sbjct: 397  KDKVSVDDRKVIFNRLMNAFVTIQNDVNAFID-------VTKAQGNTGGKV-PIPGVKQA 448

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 449  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEL 508

Query: 417  QELVVNGPNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSLQ----------IGDVI 462
            ++ V+NGP+  PGA  +  +NED        +    R  LA  L           +   +
Sbjct: 509  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKV 566

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 567  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 626

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL- 580
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 627  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 686

Query: 581  -CMM-SDG---VEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFV 634
             C+   DG     +    PPA++KP  LWTGKQ+ + +L+  +      INL +KNK+  
Sbjct: 687  GCIRPEDGHATRNKIVTVPPAVVKPVPLWTGKQIITTVLLNSTPPEMPGINLISKNKI-- 744

Query: 635  PPKSKSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
                K+       N+  V+ +  ++L G++DKS  G   K  + +++   YGP  A   +
Sbjct: 745  ----KNEYWGEGSNESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIAGKVL 799

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNKGELE 751
            + + +L   ++    F+ G++D+   ++  + + E+++ +    R     +T+       
Sbjct: 800  SVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNLEGDVKA 859

Query: 752  TQPGC-----------NEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMAT 796
              P             N+   L+A     ++ +  +V   C+ +       +N+   MA 
Sbjct: 860  DDPELLKRLEEILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNSMQAMAL 919

Query: 797  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 856
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+
Sbjct: 920  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGI 979

Query: 857  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTY 916
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     ++QF Y
Sbjct: 980  RPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIQFLY 1039

Query: 917  GGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLVR 976
            GGD +D  +            S    +    DN D  L  Y        + V   +  ++
Sbjct: 1040 GGDAVDVTK-----------ESHMTEFKFCVDNYDALLKKYNPSALIEHLDV---ESALK 1085

Query: 977  YDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLANLRKSRGMLELVNAPP 1036
            Y  +      +++ K E +  Y     +   L +Y   K     +      + + +++  
Sbjct: 1086 YSKKAM----KNRKKNEKIPHYAHNIKYDPVLSKYNPSKYLGSVSENFQDKLEKFIDSNS 1141

Query: 1037 KELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKARLEPGTAIGAIGAQS 1096
            K L+  D       NV               KKF  +   KY ++ + PG A+G I +QS
Sbjct: 1142 KLLKSKD-------NVNE-------------KKFRALMQLKYMRSLINPGEAVGIIASQS 1181

Query: 1097 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAAR 1155
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  +  A 
Sbjct: 1182 VGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVTDDQAD 1241

Query: 1156 VVKGRVEKTLLSDV 1169
                 + K +LS+V
Sbjct: 1242 TFCKSITKVMLSEV 1255

 Score = 89.0 bits (219), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V+  + +I R V    ++GKR L+ EG   + +   +  I  +  T+N V  V    G+E
Sbjct: 1483 VITEVPNIDRCVHPEPENGKRVLVTEGVNFQSMWDQEAFIDVNGITSNDVASVLKTYGVE 1542

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1543 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1601

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A    +++ ++  S  I++G+   +GTGSF ++
Sbjct: 1602 ETTCQFLTKAVLDNEREELKSPSAKIVMGKLNGVGTGSFDIL 1643

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++FS L+A +I   S  +++   + D      P + G  D  +G    +L C TC  
Sbjct: 11  IISVDFSVLTAQEIRKLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L  ++  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYCHHFRLKTSEVHRYACKLK 123

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  409 bits (1052), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 303/993 (30%), Positives = 493/993 (49%), Gaps = 152/993 (15%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S               GKV P+ G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PVPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QELVVNGPNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSL----------QIGDVI 462
            ++ V+NGP+  PGA  +  +NED        +    R  LA  L           +   +
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL- 580
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 581  -CMM-SDG---VEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFV 634
             C+   DG     +    PP I KPY LWTGKQ+ + +L+  +      INL +KNK+  
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLLSKNKI-- 755

Query: 635  PPKSKSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K++       +N+  V+ +   +L G++DKS  G   K+ + +++   YGP+ AA  +
Sbjct: 756  --KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVL 810

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNKGELE 751
            + + +L   ++    F+ G++D+    +  + + ++++ +    R+    +T+ +K    
Sbjct: 811  SVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKDTPA 870

Query: 752  TQPGC-----------NEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMAT 796
              P             N+   L+A     ++ +  +V   C+ +       +N+   MA 
Sbjct: 871  DDPELLKRLQEILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMAL 930

Query: 797  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 856
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+
Sbjct: 931  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGI 990

Query: 857  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTY 916
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF Y
Sbjct: 991  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMY 1050

Query: 917  GGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANK----------- 965
            GGD +D   +   +    F    D+ Y +        L+ +  +E+A K           
Sbjct: 1051 GGDAID---ITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALKYSKKTLKYRKK 1107

Query: 966  -ILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYIN-----LKATTL 1019
             I  P   + ++YD    L K    + A+++       +F   L  +++      K+   
Sbjct: 1108 HIKEPHYKQSIKYD--PVLAK---YNPAKYLGS--VSENFQDKLESFLDKGSKLFKSADG 1160

Query: 1020 ANLRKSRGMLELVNAPPKELQGM-DPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKY 1078
             N +K R +++L     K ++ + +P EAV             I+ QSV           
Sbjct: 1161 VNEKKFRALMQL-----KYMRSLINPGEAVGI-----------IASQSV----------- 1193

Query: 1079 RKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVIS 1137
                               GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I 
Sbjct: 1194 -------------------GEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIK 1234

Query: 1138 TPIINAVLVND-NDERAARVVKGRVEKTLLSDV 1169
            TP +   + +D +DE+A    K  + K LLS+V
Sbjct: 1235 TPQMTLPIWDDVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +  I R V    ++GKR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1498 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++F  L+A +I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  409 bits (1052), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 308/999 (30%), Positives = 487/999 (48%), Gaps = 164/999 (16%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    L  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S               GKV PI G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PIPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QELVVNGPNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSL----------QIGDVI 462
            ++ V+NGP+  PGA  +  +NED        +    R  LA  L           +   +
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL- 580
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 581  -CMM-SDG---VEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFV 634
             C+   DG     +    PP I KPY LWTGKQ+ + +L+  +      INL +KNK+  
Sbjct: 698  GCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKN 757

Query: 635  PPKSK-SLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANA 693
                K SL +E+   DG        +L G++DKS  G   K+ + +++   YGP+ AA  
Sbjct: 758  EYWGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKV 809

Query: 694  MNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNKGEL 750
            ++ + +L   ++    F+ G++D+    +  + + ++++ +    R+    +T+ +K   
Sbjct: 810  LSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTP 869

Query: 751  ETQPGC-----------NEEQTLEAKIGGFLSKVREEVGDVCINELDNWNAPL----IMA 795
               P             N+   L+A     ++ +  +V   C+ +      P      MA
Sbjct: 870  ADDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMA 929

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG
Sbjct: 930  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSG 989

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF 
Sbjct: 990  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFM 1049

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLV 975
            YGGD +D   +   +    F    D+ Y +        L+ +  +E+A K       + +
Sbjct: 1050 YGGDAID---ITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALK----YSKKTL 1102

Query: 976  RYDNRGFLVKDEDKDKAEHVDQ---YD--------------AERDFYRSLREYIN----- 1013
            +Y  +          K  H  Q   YD                 +F   L  +++     
Sbjct: 1103 KYRKK--------HSKEPHYKQSVKYDPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKL 1154

Query: 1014 LKATTLANLRKSRGMLELVNAPPKELQGM-DPDEAVPTNVRTSVSQLYRISEQSVKKFLE 1072
             K++   N +K R +++L     K ++ + +P EAV             I+ QSV     
Sbjct: 1155 FKSSDGVNEKKFRALMQL-----KYMRSLINPGEAVGI-----------IASQSV----- 1193

Query: 1073 IALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-N 1131
                                     GEP TQMTL TFHFAG  + NVTLG+PR++EI+  
Sbjct: 1194 -------------------------GEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMT 1228

Query: 1132 ASKVISTPIINAVLVND-NDERAARVVKGRVEKTLLSDV 1169
            AS  I TP +   + ND +DE+A    K  + K LLS+V
Sbjct: 1229 ASAAIKTPQMTLPIWNDVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +  I R V    ++GKR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1497 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1556

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1615

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1616 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++F  L+A +I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  408 bits (1049), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 309/1006 (30%), Positives = 490/1006 (48%), Gaps = 168/1006 (16%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+          
Sbjct: 345  RADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEEMSKLQ 401

Query: 301  ----AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
                +  DK +  N +M  +  +Q  V  +I+S            + GGKV PI G  Q 
Sbjct: 402  KDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDSTK-------AQGSAGGKV-PIPGVKQA 453

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 454  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 513

Query: 417  QELVVNGPNVHPGANYLLKKNEDARRNLRYG----DRMKLAKSL----------QIGDVI 462
            ++ V+NGP+  PGA+ +  +NED       G     R  LA  L           +   +
Sbjct: 514  RQAVINGPDKWPGASQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHSLNKKV 571

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 572  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 631

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL- 580
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 632  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIY 691

Query: 581  -CMM-SDG---VEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFV 634
             C+   DG     +    PPA+MKP  LWTGKQ+ + +L+  +      INL +KNK+  
Sbjct: 692  GCIRPEDGHATRNKLVTVPPAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISKNKI-- 749

Query: 635  PPKSKSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K+       ++ND  V+ +  ++L G++DKS  G   K+ + +++   YGP  +A  +
Sbjct: 750  --KNDYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAVSAKVL 804

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELIT------SF 745
            + + +L   ++    F+ G++D+   DD  + + ++++ +    R     +T      S 
Sbjct: 805  SVLGRLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTNLDPDVSA 864

Query: 746  NKGEL-----ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCI-----NELDNWNAPLIMA 795
            N  EL     E     N+   L+A     ++ +  +V   C+      +  N N+   MA
Sbjct: 865  NDTELLKRLEEILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NSMQAMA 923

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 924  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKGRFYSG 983

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF 
Sbjct: 984  IRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1043

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPY---AIMETANKILVPLED 972
            YGGD +D  +            S    +    DN D  L  Y   A++E  +       +
Sbjct: 1044 YGGDAVDVTQ-----------ESHMTEFKFCADNYDALLKKYNPSALIEHLDV------E 1086

Query: 973  RLVRYDNRGFLVKDEDKDKAEHVDQ---YD--------------AERDFYRSLREYIN-- 1013
              ++Y  +  L   +  ++  H  Q   YD                 +F   L  +I+  
Sbjct: 1087 SALKYSKKA-LKNRKKNERVPHFAQKVKYDPVVSKFNPSKYLGSVSENFQDKLESFIDSN 1145

Query: 1014 ---LKATTLANLRKSRGMLELVNAPPKELQGM-DPDEAVPTNVRTSVSQLYRISEQSVKK 1069
                K+    N +K R +++L     K ++ + +P EAV             I+ QSV  
Sbjct: 1146 NELFKSRDSVNEKKFRALMQL-----KYMRSLINPGEAVGI-----------IASQSVG- 1188

Query: 1070 FLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEI 1129
                          EP T               QMTL TFHFAG  + NVTLG+PR++EI
Sbjct: 1189 --------------EPST---------------QMTLNTFHFAGHGAANVTLGIPRMREI 1219

Query: 1130 I-NASKVISTPIINAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQ 1174
            I  AS  I TP +   ++ D  +  A      + K +LS+V   V+
Sbjct: 1220 IMTASAAIKTPQMTLPILADVTDSQADTFCKSITKVMLSEVVDRVE 1265

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 92/168 (54%), Gaps = 2/168 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V++ + +I R V    ++GKR L+ EG   +++   D  +  +  T+N V  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFVDVNGITSNDVSSVLKTYGVE 1546

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVS 1437
            E T   L  A    + + ++  S  ++LG+  ++GTG+F V+   + S
Sbjct: 1606 ETTCQFLTKAVLDNESENLDSPSARLVLGKLNNVGTGAFDVLAKVSAS 1653

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++F  ++A DI   S ++++   + D      P + G  D  +G    +L C TC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYACKLK 123

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  405 bits (1040), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 308/993 (31%), Positives = 494/993 (49%), Gaps = 152/993 (15%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ T+ LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTALLIRDLNDDLSKLQ 407

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S               GKV PI G  Q 
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGRTSGKV-PIPGVKQA 459

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 460  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAEL 519

Query: 417  QELVVNGPNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSL----------QIGDVI 462
            ++ V+NGP+  PGA  +  +NED        +    R  LA  L           +   +
Sbjct: 520  RQAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKV 577

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 578  YRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHF 637

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL- 580
            PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 638  PQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 697

Query: 581  -CMM-SDG---VEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFV 634
             C+   DG     +    PPAI KPY LWTGKQ+ + +L+  +      INL + NK+  
Sbjct: 698  GCIRPEDGHTTRNKIITLPPAIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISTNKIKN 757

Query: 635  PPKSK-SLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANA 693
                K SL +E+   DG        +L G++DKS  G   K+ + +++   YGP+ AA  
Sbjct: 758  EYWGKGSLENEVLFKDG-------ALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKV 809

Query: 694  MNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNK--- 747
            ++ + +L   ++    F+ G++D+    +  + + ++++ +    R+    +T+ NK   
Sbjct: 810  LSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLNKDTP 869

Query: 748  ---GEL-----ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCINE--LDNW--NAPLIMA 795
                EL     E     N+   L+A     ++ +  +V   C+ +  +  +  N+   MA
Sbjct: 870  ADDAELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMA 929

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG
Sbjct: 930  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSG 989

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF 
Sbjct: 990  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFM 1049

Query: 916  YGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLV 975
            YGGD +D   +   +    F    D+ Y +        L+ +  +E+A K       + +
Sbjct: 1050 YGGDAVD---ITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALK----YSKKTL 1102

Query: 976  RYDNRGFLVKDEDKDKAEHVD----QYDAER-------DFYRSLREYIN-----LKATTL 1019
            +Y  R    K+    +A   D    +Y+  +       +F   L  +++      K+   
Sbjct: 1103 KY--RKKHSKEPHYKQAVKYDPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKLFKSADG 1160

Query: 1020 ANLRKSRGMLELVNAPPKELQGM-DPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKY 1078
             N +K R +++L     K ++ + +P EAV             I+ QSV           
Sbjct: 1161 VNEKKFRALMQL-----KYMRSLINPGEAVGI-----------IASQSV----------- 1193

Query: 1079 RKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVIS 1137
                               GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I 
Sbjct: 1194 -------------------GEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIK 1234

Query: 1138 TPIINAVLVND-NDERAARVVKGRVEKTLLSDV 1169
            TP +   + +D +DE+A    K  + K LLS+V
Sbjct: 1235 TPQMTLPIWDDVSDEQADTFCKS-ISKVLLSEV 1266

 Score = 86.7 bits (213), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +  I R V    ++GKR L+ EG   + +   +  I     T+N V  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLRTYGVE 1557

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR ++V EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTVVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A    +++ ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGRLNNVGTGSFDVL 1658

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++F  L+A +I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLK 123

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  401 bits (1031), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 292/985 (29%), Positives = 482/985 (48%), Gaps = 159/985 (16%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK--------------AGLDKGIS 308
            PP   R PS + ++   ++++ L   L++I+ TS LI+              +  D+ I 
Sbjct: 362  PPTRFRLPSKLGEEVHENSQNQL---LSKILTTSLLIRDLNDEMSKLQKDKVSVDDRRII 418

Query: 309  INNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNL 368
             + +M  +  +Q  V  +I+S            N  GKV P+ G  Q L+ K+G FR ++
Sbjct: 419  FSRLMNAFVTIQNDVNAFIDSTK-------AQGNTSGKV-PVPGVKQALEKKEGLFRKHM 470

Query: 369  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELVVNGPNVHP 428
             GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT +N  +L++ V+NGP+  P
Sbjct: 471  MGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSFNIAELRQAVINGPDKWP 530

Query: 429  GANYLLKKNEDARR----NLRYGDRMKLAKSLQ-----------IGDVIERHLEDGDVVL 473
            GA  +  +NED        +    R  LA  L            +   + RH+++ D+V+
Sbjct: 531  GATQI--QNEDGSLVSLIGMSAEQRKALANQLMTPTSHNGATHTLNKKVYRHIKNRDIVI 588

Query: 474  FNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAI 532
             NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA 
Sbjct: 589  MNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAF 648

Query: 533  NLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL--CMM-SDG--- 586
            NL    +  LTP SG P+    QD I+    +++KDSF+ R    Q +  C+   DG   
Sbjct: 649  NLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIRPEDGHAT 708

Query: 587  VEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEM 645
              +    PPA+MKP  LWTGKQ+ + +L+  +      INL + NK+      K+     
Sbjct: 709  RAKLATVPPAVMKPVPLWTGKQIITTVLLNITPPDMPGINLKSSNKI------KNDYWGK 762

Query: 646  SQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFL 705
              N+  V+ +  ++L G++DKS  G   K+ + + +   YGP  +A A++ + +L   ++
Sbjct: 763  GSNENEVIFKNGELLCGILDKSQYG-ASKYGIIHCLHEVYGPDVSAKALSVLGRLFTNYI 821

Query: 706  GNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNKGELETQPGC------ 756
                F+ G++D+   ++  + ++E+++ +    R+    +T+  K      P        
Sbjct: 822  TATAFTCGMDDLRLTEEGNKWRKEILKTSVDTGREAAAEVTNLPKDTPSNDPELLKRLEE 881

Query: 757  -----NEEQTLEAKIGGFLSKVREEVGDVCI--NELDNW--NAPLIMATCGSKGSTLNVS 807
                 N+   L+A     ++ +  +V   C+    +  +  N+   MA  G+KGS +NVS
Sbjct: 882  IIRDNNKSGILDAVTSSKVNTITSKVVSTCVPGGTMKKFPENSMQSMALSGAKGSNVNVS 941

Query: 808  QMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAIS 867
            Q++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P E+ FH ++
Sbjct: 942  QIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDARAGGYIKGRFYSGIRPQEYYFHCMA 1001

Query: 868  GREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEME 927
            GREGL+DTAVKTA +GY+ R L K LE +   YDN++R +   ++Q  YGGD +D   + 
Sbjct: 1002 GREGLIDTAVKTASSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQMLYGGDAID---VT 1058

Query: 928  GNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFLVKDE 987
              +    FN   ++   +        L+ +  +ETA           ++Y  +    + +
Sbjct: 1059 KESHLTKFNFCLENYDALLKKYNPSALIEHLDVETA-----------LKYSKKSLKYRKK 1107

Query: 988  DKDKAEHVD--QYD--------------AERDFYRSLREYIN-----LKATTLANLRKSR 1026
               +A +    +YD                 +F   L  +++     LK+    N +K R
Sbjct: 1108 HAKEAHYQQTVKYDPILSKYNPAKYLGSVSENFQDQLENFLHDNSKLLKSHEDVNEKKFR 1167

Query: 1027 GMLELVNAPPKELQGM-DPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKARLEP 1085
             +++L     K ++ + +P EAV             I+ QSV                EP
Sbjct: 1168 ALMQL-----KYMRSLINPGEAVGI-----------IASQSVG---------------EP 1196

Query: 1086 GTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAV 1144
             T               QMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   
Sbjct: 1197 ST---------------QMTLNTFHFAGHGAANVTLGIPRLREIIMTASAAIKTPQMTLP 1241

Query: 1145 LVNDNDERAARVVKGRVEKTLLSDV 1169
            +++D  +  A      + K +LS+V
Sbjct: 1242 ILDDVTDEQADTFAKSISKVVLSEV 1266

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 88/167 (52%), Gaps = 12/167 (7%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEG------YGLRDVMCTDGVIGSKTTTNHVLEVFS 1324
            V++ +  I R V    ++GKR L+ EG      +   D +  DG+      +N V  V  
Sbjct: 1495 VIRQVPKIDRCVHPEPENGKRVLVTEGVNFNAMWDQEDFIDVDGI-----RSNDVSAVLK 1549

Query: 1325 VLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1384
              G+EAAR ++V EIN   S + +SV  RH+ LL D+MT +G  L   R G+     S++
Sbjct: 1550 TYGVEAARNTVVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSLM 1609

Query: 1385 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            ++ S+E T   L  A    +++ +   S  I+LG+  ++GTGSF V+
Sbjct: 1610 KM-SYETTCQFLTKAVLDNEREELNTPSARIVLGKLNNVGTGSFDVL 1655

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++FS L++ DI + S  ++    + D      P + G  D  +G    +L CTTC  
Sbjct: 11  ITSVDFSILTSKDIRSLSAKQIINPTVLD--NLGHPISGGLYDLSLGAFLRNL-CTTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +PV++  +F      L+  C  C    L   +  +F  +L+
Sbjct: 68  DEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHRFALKLK 123

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  395 bits (1016), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 287/930 (30%), Positives = 459/930 (49%), Gaps = 142/930 (15%)

Query: 304  DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGR 363
            D+ +  + +M  +  +Q  V  +I+S              GGKV PI G  Q L+ K+G 
Sbjct: 418  DRRVIFSRLMNAFVTIQNDVNAFIDS-------TKAQGTTGGKV-PIPGVKQALEKKEGL 469

Query: 364  FRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELVVNG 423
            FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L++ V+NG
Sbjct: 470  FRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVING 529

Query: 424  PNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSLQ----------IGDVIERHLEDG 469
            P+  PGA  +  +NED        +    R  LA  L           +   + RH+++ 
Sbjct: 530  PDKWPGAAQI--QNEDGSLVSLVGMSAEQRKALANQLMTPSSNVGTHTLNKKVYRHIKNR 587

Query: 470  DVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEAR 528
            D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E AR
Sbjct: 588  DIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENAR 647

Query: 529  AEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL--CMM-SD 585
            AEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q +  C+   D
Sbjct: 648  AEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPED 707

Query: 586  GVE---QFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFVPPKSKSL 641
            G     +    PP I KP  LWTGKQ+ S +L+  +      INL + NK+      K+ 
Sbjct: 708  GHATRPKLITLPPTIYKPVPLWTGKQIISTVLLNVTPADMPGINLTSSNKI------KNE 761

Query: 642  PSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLC 701
                S N+  V+ +  ++L G++DKS  G   K  + +++   YGP  AA  ++ + +L 
Sbjct: 762  YWGKSSNENEVLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSIAAKVLSVLGRLF 820

Query: 702  ARFLGNRGFSIGINDVTPADDLKQKKEELVEIAY---RKCDELITSFNK------GEL-- 750
              ++ +  F+ G++D+  +++  + + ++++ +    R+    +T+ +K       EL  
Sbjct: 821  TNYIMSTAFTCGMDDLRLSEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTAADDAELLK 880

Query: 751  ---ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMATCGSKGST 803
               E     N+   L+A     ++ +  +V   C+ +       +N+   MA  G+KGS 
Sbjct: 881  RLEEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSGAKGSN 940

Query: 804  LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLF 863
            +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ F
Sbjct: 941  VNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKPQEYYF 1000

Query: 864  HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDP 923
            H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D 
Sbjct: 1001 HCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVD- 1059

Query: 924  LEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLVRYDNRGFL 983
              +   +    F+   D+   +        L+ +  +ETA           ++Y  +   
Sbjct: 1060 --VTKESHMTEFDFCLDNYDALLNKYNPSALIEHLDVETA-----------LKYSKKTLK 1106

Query: 984  VKDEDKDKAEHVD--QYD--------------AERDFYRSLREYIN-----LKATTLANL 1022
             + +   +A H +  +YD                  F   L  Y++      K+    + 
Sbjct: 1107 NRKKHAKEAHHKNATKYDPVLSKFNPAKYLGSVSEKFQDKLESYLDKNSKLFKSHDNVSE 1166

Query: 1023 RKSRGMLELVNAPPKELQGM-DPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRKA 1081
            +K R +++L     K ++ + +P EAV             I+ QSV              
Sbjct: 1167 KKFRALMQL-----KYMRSLINPGEAVGI-----------IASQSVG------------- 1197

Query: 1082 RLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPI 1140
              EP T               QMTL TFHFAG  + NVTLG+PR++EII  AS  I TP 
Sbjct: 1198 --EPST---------------QMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQ 1240

Query: 1141 INAVLVND-NDERAARVVKGRVEKTLLSDV 1169
            +   +  D +DE+A    K  + K +LS+V
Sbjct: 1241 MTLPIWQDVSDEQADTFCKS-ISKVVLSEV 1269

 Score = 89.4 bits (220), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            +++ +  I R V    ++GKR L+ EG     +   +  I     T+N V  V    G+E
Sbjct: 1502 IIREVPHIDRCVHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1561

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1562 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1620

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A    +++ +E  S  I++G+  ++GTGSF ++
Sbjct: 1621 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1662

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++F  L++ +I   S  +++   + D      P + G  D  +G    +L C++C  
Sbjct: 11  ITSVDFGILTSEEIRQLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSSCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C  + L + +  +F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFACKLR 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  390 bits (1002), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 303/996 (30%), Positives = 482/996 (48%), Gaps = 158/996 (15%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 387

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ I  N +M  +  +Q  V  +I+S         GS+  GGKV PI G  Q 
Sbjct: 388  KDKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDSTKAQ-----GST--GGKV-PIPGVKQA 439

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  ++
Sbjct: 440  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEM 499

Query: 417  QELVVNGPNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSLQ----------IGDVI 462
            ++ V+NGP+  PGA  +  +NED        +    R  LA  L           +   +
Sbjct: 500  RQAVINGPDKWPGATQI--QNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKV 557

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 558  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 617

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL- 580
            PQ E AR+EA  L    +  LTP SG P+    QD I+    +++KDSF+ R    Q + 
Sbjct: 618  PQNENARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIY 677

Query: 581  -CMM-SDG---VEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFV 634
             C+   DG     +    PPA++KP  LWTGKQ+ + +L+  +      INL +KNK+  
Sbjct: 678  GCIRPEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKI-- 735

Query: 635  PPKSKSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K++       +N+  V+ +   +L G++DKS  G   K+ + +++   YGP  ++  +
Sbjct: 736  --KNEYWGKSSYENE--VIFKNGALLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKVL 790

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPAD-------DLKQKKEELVEIAYRKCDELITSF-- 745
            + + +L   ++ +  F+ G++D+   D       D+ +K  ++   A  +   L      
Sbjct: 791  SILGRLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGGDVRP 850

Query: 746  NKGEL-----ETQPGCNEEQTLEAKIGGFLSKVREEVGDVCINELDN----WNAPLIMAT 796
            +  EL     E     N+   L+A     ++ +  EV   C+ +       +N+   MA 
Sbjct: 851  DDAELLKRLEEILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMAL 910

Query: 797  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 856
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+
Sbjct: 911  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSGI 970

Query: 857  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTY 916
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF Y
Sbjct: 971  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFLY 1030

Query: 917  GGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIMETANKILVPLEDRLVR 976
            GGD +D  +            S    +    DN D  L  Y        + V   +  ++
Sbjct: 1031 GGDAIDVTK-----------ESHMSEFKFCVDNYDALLKRYNPSALIQHLDV---ESALK 1076

Query: 977  YDNRGFLVKDEDKDKAEHV--DQYD--------------AERDFYRSLREYIN-----LK 1015
            Y  +    + ++ +   +   D+YD                 +F   L  +I+      K
Sbjct: 1077 YSKKAMKNRKKNLNLPHYARHDKYDPVLSKYNPSKFLGSVSENFQDKLESFIDSNASLFK 1136

Query: 1016 ATTLANLRKSRGMLELVNAPPKELQGM-DPDEAVPTNVRTSVSQLYRISEQSVKKFLEIA 1074
                 N +K R +++L     K ++ + +P EAV             I+ QSV       
Sbjct: 1137 GQATVNEKKFRALMQL-----KYMRSLINPGEAVGI-----------IASQSV------- 1173

Query: 1075 LFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NAS 1133
                                   GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS
Sbjct: 1174 -----------------------GEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTAS 1210

Query: 1134 KVISTPIINAVLVNDNDERAARVVKGRVEKTLLSDV 1169
              I TP +   ++ D  +  A +      K +LS+V
Sbjct: 1211 AAIKTPQMTLPILPDVTDETADIFCKNTTKVILSEV 1246

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 90/162 (55%), Gaps = 2/162 (1%)

Query: 1271 VVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGIE 1329
            V+K + +I R V    ++GKR L+ EG   + +   +  I  +  T+N V  V    G+E
Sbjct: 1473 VIKEVPNIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVNGITSNDVSAVLKTYGVE 1532

Query: 1330 AARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1389
            AAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1533 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1591

Query: 1390 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            E T   L  A    +++ ++  S  ++LG+  S+GTG+F ++
Sbjct: 1592 ETTCQFLTKAVLDNEREELKSPSAKLVLGKLNSVGTGAFDIL 1633

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++FS +SAA+I A S  +++   + D      P   G  D  +G    +L C TC  
Sbjct: 11  ISSVDFSVMSAAEIRALSVKQITNPTVLD--HLGHPIRGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P +   +F      L+  C  C    L   +  ++  +L+
Sbjct: 68  DEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYCHHFRLKAVEVHRYACKLK 123

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  375 bits (964), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 238/727 (32%), Positives = 385/727 (52%), Gaps = 77/727 (10%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +T+    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 346  KADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 402

Query: 300  --KAGL-DKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQR 356
              K  L D+ +  + +M  +  +Q  V  +I+S            N GGKV PI G  Q 
Sbjct: 403  KDKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDSTK-------AQGNTGGKV-PIPGVKQA 454

Query: 357  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKL 416
            L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L
Sbjct: 455  LEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAEL 514

Query: 417  QELVVNGPNVHPGANYLLKKNEDARR----NLRYGDRMKLAKSLQ----------IGDVI 462
            ++ V+NGP+  PGA+ +  +NED        +    R  LA  L           +   +
Sbjct: 515  RQAVINGPDKWPGASQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSSNIATHTLNKKV 572

Query: 463  ERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHV 521
             RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H 
Sbjct: 573  YRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHF 632

Query: 522  PQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLL- 580
            PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSF+ R    Q + 
Sbjct: 633  PQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY 692

Query: 581  -CMMSD----GVEQFDVPPPAIMKPYYLWTGKQVFS-LLIKPSHKSPVVINLDAKNKVFV 634
             C+  +       +    PPA+ KP  LWTGKQ+ + +L+  +      INL++ NK+  
Sbjct: 693  GCIRPEHGHTTRSKIVTVPPAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSSNKI-- 750

Query: 635  PPKSKSLPSEMSQNDGFVVIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAM 694
              K++   +  ++ND  V+ +  ++L G++DKS  G   K+ + +++   YGP  AA  +
Sbjct: 751  --KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVAAKVL 805

Query: 695  NRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYRKCDELITSFNKGELETQP 754
            + + +L   ++    F+ G++D+   D+  + ++++++ +     +        E ET  
Sbjct: 806  SVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAACEVTNLEKETAS 865

Query: 755  GCNE-----EQTL-------------EAKIGGFLSKVREE-VGDVCINELDNWNAPLIMA 795
              +E     E+ L              +K+    SKV  + V D  + +   +N+   MA
Sbjct: 866  DDSELLKRLEEILRDDNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFP-YNSMQAMA 924

Query: 796  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 855
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 925  LSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAMAGGYIKGRFYSG 984

Query: 856  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFT 915
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF 
Sbjct: 985  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFL 1044

Query: 916  YGGDGLD 922
            YGGD +D
Sbjct: 1045 YGGDSVD 1051

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 72/110 (65%), Gaps = 3/110 (2%)

Query: 1063 SEQSV--KKFLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1120
            S++SV  KKF  +   KY ++ + PG ++G I +QS+GEP TQMTL TFHFAG  + NVT
Sbjct: 1152 SDKSVNEKKFRALMQLKYMRSLINPGESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVT 1211

Query: 1121 LGVPRIKEII-NASKVISTPIINAVLVNDNDERAARVVKGRVEKTLLSDV 1169
            LG+PR++EII  AS  I TP +   +++D  +  A V    + K LLS+V
Sbjct: 1212 LGIPRMREIIMTASAAIKTPQMTLPILDDVSDDQADVFSKSISKVLLSEV 1261

 Score = 89.0 bits (219), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 88/163 (53%), Gaps = 2/163 (1%)

Query: 1270 VVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIG-SKTTTNHVLEVFSVLGI 1328
             V++ +  I R V    ++GKR L+ EG   + +   +  IG    T+N V  V    G+
Sbjct: 1488 TVIRQVPFIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIGVDGITSNDVSAVLKTYGV 1547

Query: 1329 EAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLAS 1388
            EAAR +IV EIN   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S
Sbjct: 1548 EAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-S 1606

Query: 1389 FEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVI 1431
            +E T   L  A    + + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1607 YETTCQFLTKAVLDNENEELKSPSARIVLGKLNNVGTGAFDVL 1649

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSLECTTCHG 72
           I  ++FS L+A +I   S  +++   + D      P + G  D  +G    +L C+TC  
Sbjct: 11  ITSIDFSILTAQEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  NLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLHELR 128
           +   C GH GH++L +P ++  +F      L+  C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSIEVHRYTCKLK 123

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 84/290 (28%), Positives = 131/290 (45%), Gaps = 29/290 (10%)

Query: 7   SETPKR-IKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGVSSSSL 65
           S  P R IK ++F   S  ++ A S  ++   +  D  + RA +  G  DP++G    ++
Sbjct: 7   SSAPVRTIKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNV 65

Query: 66  ECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRKFLH 125
           +C TC   +  C GHFGH+ LA PVFHIG+     ++ + +C +C  +LL E +++  ++
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNEQ--MN 123

Query: 126 ELRRPGVDNLRRMGILKKILDQCKKQRRCLHCXXXXXXXXXXXXXXXXXXXXIIHDTFRW 185
           +  +   D  +R   +  +   CK +   + C                        T R 
Sbjct: 124 QAIKIK-DPKKRFNAVWTL---CKTK---MICETDVPSEDDPTKLVSRGGCGNAQPTIRK 176

Query: 186 VGKKSAPEKDIWVGEWKEVLTHN--PELERYVKRCMDDLNPLKTLNLFKQIKSADCELLG 243
            G K        VG WK+    N   E E+ V      L+  + LN+FK I S D   LG
Sbjct: 177 DGLK-------LVGSWKKDKNTNDGDEPEQRV------LSTEEILNIFKHISSEDYIRLG 223

Query: 244 IDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIV 293
            +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+
Sbjct: 224 FNEEF--ARPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADIL 270

>Suva_13.410 Chr13 complement(702373..703176) [804 bp, 267 aa] {ON}
            YMR226C (REAL)
          Length = 267

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 7/128 (5%)

Query: 1015 KATTLANLRKSRGMLELVNAPPKELQGMDP-----DEAVPTNVRTSVSQLYRISEQSVKK 1069
            KAT L  L  S G ++L+ A  + L+ ++      DE  P N +  V QL     + +K 
Sbjct: 27   KATALEYLEASNGNMKLILAA-RRLEKLEELKKTIDEEFP-NAKVHVGQLDITQAEKIKP 84

Query: 1070 FLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEI 1129
            F+E     ++   +    A  A+G++ +GE  TQ     F     A +NVT  V  I + 
Sbjct: 85   FIENLPEAFKDIDILINNAGKALGSERVGEIATQDIQDVFDTNVTALINVTQAVLPIFQA 144

Query: 1130 INASKVIS 1137
             N+  +++
Sbjct: 145  KNSGDIVN 152

>TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {ON}
           Anc_5.359
          Length = 875

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 54/128 (42%), Gaps = 6/128 (4%)

Query: 267 CIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMY 326
           C +   ++ + P  + + +    T   +TS L+   L     +   + H+DY++ +    
Sbjct: 160 CDKSLTVLSNMPEESVETIKNLSTTTFYTSPLMSTYL-----VAWAIGHYDYIEDSTEKK 214

Query: 327 INSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPN 386
           I        +  GSS   G + PIR F  + K  QGRF  N++ + VD        P P 
Sbjct: 215 IYPTLDGYDIRDGSSGTKGSL-PIRLFTAKGKSHQGRFAMNVTRRVVDLFSELFEIPYPL 273

Query: 387 LSIDEVAV 394
             +D V V
Sbjct: 274 PKLDIVCV 281

>Smik_13.434 Chr13 complement(705526..706329) [804 bp, 267 aa] {ON}
            YMR226C (REAL)
          Length = 267

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 7/128 (5%)

Query: 1015 KATTLANLRKSRGMLELVNAPPKELQGMDP-----DEAVPTNVRTSVSQLYRISEQSVKK 1069
            KAT L  L  S G ++L+ A  + L+ ++      DE  P N +  V++L     + +K 
Sbjct: 27   KATALEYLEASNGDMKLILAA-RRLEKLEELKKTIDEEFP-NAKVHVTKLDITQTEKIKP 84

Query: 1070 FLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEI 1129
            F+E    +++   +    A  A+G   +GE  TQ     F     A +NVT  V  I + 
Sbjct: 85   FIENLPEEFKDIDILVNNAGKALGTDRVGEIDTQDVQDVFDTNVSALINVTQAVLPIFQA 144

Query: 1130 INASKVIS 1137
             N+  +++
Sbjct: 145  KNSGDIVN 152

>Skud_13.395 Chr13 complement(695660..696463) [804 bp, 267 aa] {ON}
            YMR226C (REAL)
          Length = 267

 Score = 32.0 bits (71), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 57/128 (44%), Gaps = 7/128 (5%)

Query: 1015 KATTLANLRKSRGMLELVNAPPKELQGMDP-----DEAVPTNVRTSVSQLYRISEQSVKK 1069
            KATTL  L  S G ++L+ A  + L+ ++      DE  P N +   +QL       +K 
Sbjct: 27   KATTLEYLNASNGEMKLILAA-RRLEKLEELKTAIDEEFP-NAKVHAAQLDITEAGKIKP 84

Query: 1070 FLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEI 1129
            F+     +++   +    A  A+G   +GE  TQ     F     A +NVT  V  I + 
Sbjct: 85   FIANLPEEFKDIDILVNNAGKALGTDRVGEIATQDIQDVFDTNVTALINVTQAVLPIFQA 144

Query: 1130 INASKVIS 1137
             N+  +++
Sbjct: 145  KNSGDIVN 152

>YMR226C Chr13 complement(721593..722396) [804 bp, 267 aa] {ON}
            NADP(+)-dependent dehydrogenase; acts on serine,
            L-allo-threonine, and other 3-hydroxy acids; green
            fluorescent protein fusion protein localizes to the
            cytoplasm and nucleus; may interact with ribosomes, based
            on co-purification experiments
          Length = 267

 Score = 32.0 bits (71), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 60/128 (46%), Gaps = 7/128 (5%)

Query: 1015 KATTLANLRKSRGMLELVNAPPKELQGMDP-----DEAVPTNVRTSVSQLYRISEQSVKK 1069
            KAT L  L  S G ++L+ A  + L+ ++      D+  P N +  V+QL     + +K 
Sbjct: 27   KATALEYLEASNGDMKLILAA-RRLEKLEELKKTIDQEFP-NAKVHVAQLDITQAEKIKP 84

Query: 1070 FLEIALFKYRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEI 1129
            F+E    +++   +    A  A+G+  +G+  T+     F     A +N+T  V  I + 
Sbjct: 85   FIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALINITQAVLPIFQA 144

Query: 1130 INASKVIS 1137
             N+  +++
Sbjct: 145  KNSGDIVN 152

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 150,138,524
Number of extensions: 6578953
Number of successful extensions: 17548
Number of sequences better than 10.0: 72
Number of HSP's gapped: 17627
Number of HSP's successfully gapped: 180
Length of query: 1460
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1338
Effective length of database: 39,492,147
Effective search space: 52840492686
Effective search space used: 52840492686
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)