Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.4223.497ON1127112760460.0
Skud_7.4453.497ON1123113045710.0
YGR134W (CAF130)3.497ON1122113344880.0
Smik_6.2303.497ON1124113244500.0
ZYRO0D09790g3.497ON1180113525230.0
TDEL0D056503.497ON1077111724320.0
NCAS0E007703.497ON1150115723960.0
KAFR0C020003.497ON1066107923510.0
SAKL0F02596g3.497ON1132113622180.0
Kpol_480.123.497ON1114116120550.0
AFR316W3.497ON1191119920150.0
Ecym_12323.497ON1204119320030.0
Kwal_47.188863.497ON1105115719850.0
KNAG0B007703.497ON1038110519730.0
TBLA0C045103.497ON1307127419840.0
KLTH0G02442g3.497ON1113111319620.0
NDAI0G009003.497ON127989619010.0
CAGL0I10428g3.497ON1163112218410.0
TPHA0A056803.497ON1074115316400.0
KLLA0E03961g3.497ON1132114610871e-128
Ecym_42068.368ON187747830.47
KLLA0D17358g8.368ON184847820.57
TPHA0B003804.351ON1310154791.6
TPHA0C008708.313ON168633782.0
Smik_12.605.215ON94665772.6
Kwal_14.11868.39ON781104763.2
ZYRO0F14432g8.368ON193047754.1
SAKL0H14520g8.368ON183847745.7
Kwal_23.34018.368ON179547737.6
TPHA0C005308.368ON192641738.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.422
         (1127 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...  2333   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...  1765   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...  1733   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...  1718   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   976   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   941   0.0  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   927   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   910   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...   858   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   796   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   780   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   776   0.0  
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   769   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   764   0.0  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   768   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   760   0.0  
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   736   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   713   0.0  
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   636   0.0  
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   423   e-128
Ecym_4206 Chr4 (426316..431949) [5634 bp, 1877 aa] {ON} similar ...    37   0.47 
KLLA0D17358g Chr4 complement(1477523..1483069) [5547 bp, 1848 aa...    36   0.57 
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    35   1.6  
TPHA0C00870 Chr3 (181654..186714) [5061 bp, 1686 aa] {ON} Anc_8....    35   2.0  
Smik_12.60 Chr12 (130182..133022) [2841 bp, 946 aa] {ON} YLL003W...    34   2.6  
Kwal_14.1186 s14 complement(233250..235595) [2346 bp, 781 aa] {O...    34   3.2  
ZYRO0F14432g Chr6 complement(1185443..1191235) [5793 bp, 1930 aa...    33   4.1  
SAKL0H14520g Chr8 (1256509..1262025) [5517 bp, 1838 aa] {ON} sim...    33   5.7  
Kwal_23.3401 s23 (272950..278337) [5388 bp, 1795 aa] {ON} YDR170...    33   7.6  
TPHA0C00530 Chr3 (94676..100456) [5781 bp, 1926 aa] {ON} Anc_8.3...    33   8.2  

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score = 2333 bits (6046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1127/1127 (100%), Positives = 1127/1127 (100%)

Query: 1    MNKKKGATNDAENQILASGVNDSLGNVHRYAQFISLQELLKDRHYTPSVENLEKLLYDET 60
            MNKKKGATNDAENQILASGVNDSLGNVHRYAQFISLQELLKDRHYTPSVENLEKLLYDET
Sbjct: 1    MNKKKGATNDAENQILASGVNDSLGNVHRYAQFISLQELLKDRHYTPSVENLEKLLYDET 60

Query: 61   ILNDQEIRFPLLFEALSVTLFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR 120
            ILNDQEIRFPLLFEALSVTLFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR
Sbjct: 61   ILNDQEIRFPLLFEALSVTLFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR 120

Query: 121  SWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNML 180
            SWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNML
Sbjct: 121  SWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNML 180

Query: 181  KDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKL 240
            KDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKL
Sbjct: 181  KDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKL 240

Query: 241  NHNINLLMDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTL 300
            NHNINLLMDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTL
Sbjct: 241  NHNINLLMDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTL 300

Query: 301  QIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFL 360
            QIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFL
Sbjct: 301  QIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFL 360

Query: 361  YQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDT 420
            YQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDT
Sbjct: 361  YQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDT 420

Query: 421  VHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLS 480
            VHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLS
Sbjct: 421  VHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLS 480

Query: 481  CVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLN 540
            CVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLN
Sbjct: 481  CVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLN 540

Query: 541  TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE 600
            TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE
Sbjct: 541  TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE 600

Query: 601  CEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANASTNN 660
            CEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANASTNN
Sbjct: 601  CEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANASTNN 660

Query: 661  DSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYY 720
            DSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYY
Sbjct: 661  DSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYY 720

Query: 721  SPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFT 780
            SPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFT
Sbjct: 721  SPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFT 780

Query: 781  SIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEML 840
            SIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEML
Sbjct: 781  SIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEML 840

Query: 841  MCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQ 900
            MCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQ
Sbjct: 841  MCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQ 900

Query: 901  KNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEGEDADKVSLYSLGL 960
            KNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEGEDADKVSLYSLGL
Sbjct: 901  KNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEGEDADKVSLYSLGL 960

Query: 961  VKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKSRLAMEEDGI 1020
            VKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKSRLAMEEDGI
Sbjct: 961  VKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKSRLAMEEDGI 1020

Query: 1021 TDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLRSFITDY 1080
            TDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLRSFITDY
Sbjct: 1021 TDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLRSFITDY 1080

Query: 1081 SFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAELDMGDSE 1127
            SFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAELDMGDSE
Sbjct: 1081 SFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAELDMGDSE 1127

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score = 1765 bits (4571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 876/1130 (77%), Positives = 988/1130 (87%), Gaps = 10/1130 (0%)

Query: 1    MNKKKGATNDAENQILASGVNDSLGNVHRYAQFISLQELLKDRHYTPSVENLEKLLYDET 60
            M KKK ATND E Q+L    ++S  +  RY QF+ LQ LLKD++Y PS+ENLEKLLY+E+
Sbjct: 1    MTKKKIATNDVERQLLLG--DNSSNDALRYEQFVPLQVLLKDKNYVPSLENLEKLLYNES 58

Query: 61   ILNDQEIRFPLLFEALSVTLFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR 120
            IL+DQ+IR  +LFEALS+ LFTTKSGKSILQ ++AST KE+K W +S  + DSNYAS+++
Sbjct: 59   ILDDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQSLRDDDSNYASVVQ 118

Query: 121  SWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNML 180
             WK++DVL LKFLRF+LANKTT LQID+YNLP+YKLPLSFLIVSK+N PSIILNEG+NML
Sbjct: 119  GWKDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNML 178

Query: 181  KDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKL 240
            KDYLY++SGR++ LI  NS   +SA + K  L+ YDR++EF N YFWYSF+ E +   + 
Sbjct: 179  KDYLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFEF 238

Query: 241  NHNINLLMDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTL 300
            + N +LLM+S ED+ DG   +DD  KSDN QK  K+TII RT+NDQEQIYSFEL+QDGTL
Sbjct: 239  SDNFDLLMNSPEDHADG-GVIDDRCKSDNPQKHAKNTIIKRTINDQEQIYSFELDQDGTL 297

Query: 301  QIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFL 360
            QIPN+MEHSL+RHELLFKILNL  VLTPLLE QF  LCGLVDPL QP+PND+ +ISIDFL
Sbjct: 298  QIPNIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFL 357

Query: 361  YQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDT 420
            +QLFLGLMYPSIK+SQEHN+HYDWKFY CFNMQKIIDATMLRLNC  FE+LNS+NNTD  
Sbjct: 358  FQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSV 417

Query: 421  VHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLS 480
            +HWRTQLH WLPHGLNTQDLELLYMIDILA+YTIYKLYE+IPIQLNPFLFSLLSLWKNLS
Sbjct: 418  IHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLS 477

Query: 481  CVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLN 540
            CVILLALEIDRIEEE GTYETPLMVRATIRGAAALRSVIA+VLNGLVKSNDHDFKHESLN
Sbjct: 478  CVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLN 537

Query: 541  TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE 600
            TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE
Sbjct: 538  TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE 597

Query: 601  CEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANAS--- 657
            CEDYNE FS+  DE+L E  NS  K K+S  NGFYQRRCNCIFNDDKLVAEDG N +   
Sbjct: 598  CEDYNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEI 657

Query: 658  TNNDSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFN 717
            + N +++NE+ ++ N   +TA TN+N   SSINP SVRSRSTFEFDYSGEDWRDVPKDFN
Sbjct: 658  SGNSNMENEMPNNVNVIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFN 717

Query: 718  IYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGS 777
            +YYSPSYSFIQEPKLD+IFNLTLRGATEKL+R++S++LV SVASCVKNEQDQMIL+DLGS
Sbjct: 718  MYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGS 777

Query: 778  NFTSIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMD 837
            NF  I EN E   +   + KTN+EELRRTTPDDIYEIWSEESAFERML VNHDVAWRLMD
Sbjct: 778  NFAEIDENPEAKSSNNIT-KTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMD 836

Query: 838  EMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILK 897
            EMLMCTGYRRILIWFLTHLELKHSLIYYVFEL+MGLRG PFSGEASDQDRKDDMIYEILK
Sbjct: 837  EMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILK 896

Query: 898  KKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEGEDADKVSLYS 957
            KK+KNE+ SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKN EEE ED +K+SLYS
Sbjct: 897  KKRKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNDEEENEDGEKISLYS 956

Query: 958  LGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKSRLAMEE 1017
            LGLVKLICYMVQTLIANDKF FTKSECTFELQTLLMTWIG+LPEAKDLFFQIK+RLAMEE
Sbjct: 957  LGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRLAMEE 1016

Query: 1018 DGITDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLRSFI 1077
            D   D   Q+ D  DL+++  ++P+TKS S+LN+K+L+LFPSNP  N+DNSAISTLRSFI
Sbjct: 1017 DSDKDGQ-QNDDNKDLEVE--RRPHTKSNSELNVKLLNLFPSNPAGNNDNSAISTLRSFI 1073

Query: 1078 TDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAELDMGDSE 1127
            TDY FDTQ+  PGR+VVF+D KILPL KADKPIPLHEYITLAE+D+G+SE
Sbjct: 1074 TDYPFDTQITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEIDVGESE 1123

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score = 1733 bits (4488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 871/1133 (76%), Positives = 986/1133 (87%), Gaps = 17/1133 (1%)

Query: 1    MNKKKGATNDAENQILASGVNDSLGNVHRYAQFISLQELLKDRHYTPSVENLEKLLYDET 60
            M KKK ATN AE Q LAS   DS G+   +  FI LQELLKD++Y PSVENLEK+LY+ET
Sbjct: 1    MTKKKAATNYAERQNLAS--EDSSGDSVHFKDFIPLQELLKDKNYVPSVENLEKILYNET 58

Query: 61   ILNDQEIRFPLLFEALSVTLFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR 120
            + NDQ+I   LL EAL +TLFTT SGKS L+ ++ S+ KERK+W +SFEN+ S+YASI+ 
Sbjct: 59   MFNDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLKERKSWAQSFENNSSSYASIVL 118

Query: 121  SWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNML 180
            SWK++D+LLLKFLRF+LANKT PLQI+RYNLP+YKLPLSFLIVSK+ +PSI+LNE YN+L
Sbjct: 119  SWKDNDILLLKFLRFLLANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLL 178

Query: 181  KDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKL 240
            KDYLY+I+GR+E LI C+STFD+ A + +  L+ Y+RMIE RNFYFWYSF+AE       
Sbjct: 179  KDYLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENRVNLTF 238

Query: 241  NHNINLLMDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTL 300
            + NI+LLM++ E N    S +DD+    +HQKQP++ I+ RT+NDQEQIYSFELNQDGTL
Sbjct: 239  SDNISLLMENDEGN--AGSGLDDS--RFDHQKQPREAIMGRTINDQEQIYSFELNQDGTL 294

Query: 301  QIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFL 360
            +IPNVMEHSLLRHELLFKILNLT VLTPLLE QFSTLCGLVDPL QPTPNDKHIISIDFL
Sbjct: 295  EIPNVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFL 354

Query: 361  YQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDT 420
            +QLFLGLM  SIKTSQEHN+HYDWKFY+CFNMQKIIDATMLRLNCF F+ LNS+NNTD+ 
Sbjct: 355  FQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNA 414

Query: 421  VHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLS 480
            VHW+TQLH WLPHGLNTQDLELLYMIDILAVYTIYKLYE+IPIQLNPFLFSL+SLWKNLS
Sbjct: 415  VHWKTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLS 474

Query: 481  CVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLN 540
            CVILLALEIDRIEEE GTYETPLMVRATIRGAAALRSVIA VLNGLVK+NDHDFKHESLN
Sbjct: 475  CVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLN 534

Query: 541  TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE 600
            TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE
Sbjct: 535  TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE 594

Query: 601  CEDYNESFSDCGDEELGEG-VNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGAN---A 656
            CEDY+ESFS+     L E  VN  EK  +  +N F++RRCNCIFNDDKLVAEDGAN    
Sbjct: 595  CEDYDESFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFG 654

Query: 657  STNNDSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDF 716
            STN+++++  + ++ NA  N     ++H  +S NP SVRSRSTFEFDYSGEDWRDVP+DF
Sbjct: 655  STNSENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDF 714

Query: 717  NIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLG 776
            N+YYSPSYSFI EPKLD+IF+LTLRGATEKL++EES+LLVRSVASCV+NEQDQMILADL 
Sbjct: 715  NMYYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLE 774

Query: 777  SNFT-SIGENFEG-GDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWR 834
            SNF+ SI  + EG G+T ++  K ++E+LRRTTPDDIYEIWSEESAFERML VNHDVAWR
Sbjct: 775  SNFSASINGDVEGEGNTKMS--KIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWR 832

Query: 835  LMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYE 894
            LMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRG PFSGEASDQD+KDDMIYE
Sbjct: 833  LMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYE 892

Query: 895  ILKKKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEGEDADKVS 954
            ILKKKQKNE+ SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKN EEE ED +K+S
Sbjct: 893  ILKKKQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNNEEENEDGEKIS 952

Query: 955  LYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKSRLA 1014
            LYSLGLV+LICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFF+IK+RLA
Sbjct: 953  LYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLA 1012

Query: 1015 MEEDGITDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLR 1074
            MEE+   D T+QH+ + + D++  KK N K  S+LN+K+L+LFPS P   DD+S I+TLR
Sbjct: 1013 MEEEDSAD-TMQHEGRKNSDIE--KKLNAKPASELNLKLLNLFPSKPANKDDSSPINTLR 1069

Query: 1075 SFITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAELDMGDSE 1127
            SFI DYSFDTQV  PGRRVVF+D KILPLPKADKPIPLHEYITLAELD+GDSE
Sbjct: 1070 SFIADYSFDTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYITLAELDVGDSE 1122

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score = 1718 bits (4450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 858/1132 (75%), Positives = 980/1132 (86%), Gaps = 13/1132 (1%)

Query: 1    MNKKKGATNDAENQILASGVNDSLGNVHRYAQFISLQELLKDRHYTPSVENLEKLLYDET 60
            M KKK   N  +  +LA G  D  G      +F+ LQELLKD++Y PSVENLEK+L DET
Sbjct: 1    MTKKKTTVNHVQKPVLAGG--DPSGGSVCCERFVPLQELLKDKNYVPSVENLEKVLCDET 58

Query: 61   ILNDQEIRFPLLFEALSVTLFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR 120
            +LNDQ++RF LLFEAL++TLFTT SGKSILQ+++  TSK+RK W +SFEN++SNYASI+ 
Sbjct: 59   MLNDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKKRKLWAQSFENNNSNYASIVF 118

Query: 121  SWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNML 180
            SWK++D+LLLKF+RF+LANKT PL+IDRYNLP++KLPLSFLIVSK+N+PSI+LNEGYN+L
Sbjct: 119  SWKDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLL 178

Query: 181  KDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKL 240
            KDYLY+I+GR+E L+ C+  F+Q A + K TL+ YDRMIE  N Y WY F+AE +A  K 
Sbjct: 179  KDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAENSAHLKF 238

Query: 241  NHNINLLMDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTL 300
            + NI  LM S  +  +G+   D    ++N+ KQPKD ++ RT+NDQEQIYSFELN DGTL
Sbjct: 239  DDNIACLMGSENNTENGLG--DSRVNNNNYHKQPKDVVMSRTINDQEQIYSFELNHDGTL 296

Query: 301  QIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFL 360
            +IPNVM+HSLLRHELLFKILNLTPV TPLLE QFSTLCGLVDPL QPTPNDKHIISIDFL
Sbjct: 297  EIPNVMKHSLLRHELLFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFL 356

Query: 361  YQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDT 420
            ++LFLGLMYP+IK+SQ HN+HYDWKFY CFNMQKIIDATM RLNCF F  LNS+NNTD +
Sbjct: 357  FKLFLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSS 416

Query: 421  VHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLS 480
            VHWRTQLH WLPHGLNTQDLELLYMIDILAVYTIYKLYE++PIQLNPFLFSL+SLWKNLS
Sbjct: 417  VHWRTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLS 476

Query: 481  CVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLN 540
            CVILLALEIDRIEEE GTYETPLMVRATIRGAAALRSVIA +LNGLVK+N+HDFKHESLN
Sbjct: 477  CVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLN 536

Query: 541  TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE 600
            TFMSPYGRKL HGALYADLRSH+ASLLA G SIEDVTDLFADLQSGDRFDEDIRYMFDYE
Sbjct: 537  TFMSPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYE 596

Query: 601  CEDYNESFSDCGDEELGEG-VNSGEKTKTSIHNG-FYQRRCNCIFNDDKLVAEDGAN--- 655
            C DY+ESFS+  DE L EG VN+ EK K+S  N  F QRRCNCIFNDDKLVAEDG N   
Sbjct: 597  CADYDESFSESDDEGLEEGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVF 656

Query: 656  ASTNNDSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKD 715
             ST N + +  +R++ +  SNTAIT +NH ++SINP+SVR+RSTFEFDYSGEDWRDVP+D
Sbjct: 657  ESTCNRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRD 716

Query: 716  FNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADL 775
            FN+YYSPSY FI +PKLD+IFNLTLRGATEKL+REES+LLVRSVASCVKNEQDQM+LADL
Sbjct: 717  FNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADL 776

Query: 776  GSNFTSIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRL 835
             +N T I ++ EG ++   S KT++EELRRTTPDDIYEIWSEESAFERML VNHDVAWRL
Sbjct: 777  KTNLTGISKHAEGENSTSIS-KTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRL 835

Query: 836  MDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEI 895
            MDEMLMCTGYRRILIWF THLELKHSLIYYVFELIMGLRG  FSG+ASDQD+KDDMIYEI
Sbjct: 836  MDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEI 895

Query: 896  LKKKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEGEDADKVSL 955
            LKKKQKN++ S LPFSRQGPI+LSDIETKMLLQEFFMNAAIFLSS N+EEE ED +K+SL
Sbjct: 896  LKKKQKNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLSSNNSEEENEDGEKISL 955

Query: 956  YSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKSRLAM 1015
            YSLGLV+LICYMVQTLI NDKFFFTKSECTFELQTLLMTWIGILPEAKDLFF+IK+RLAM
Sbjct: 956  YSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLAM 1015

Query: 1016 EEDGITDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLRS 1075
            EED  T  T+QH+ +  LD++  KK NTK  SKLN+K+LSLFPSN  +N +NSAI+TLR+
Sbjct: 1016 EEDNDT-GTMQHEGRRSLDIE--KKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRN 1072

Query: 1076 FITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAELDMGDSE 1127
            FITDYSFDTQV  PGR+VVF+D KILPL KADKPIPLHEYITLAELD+GDSE
Sbjct: 1073 FITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDVGDSE 1124

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  976 bits (2523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1135 (45%), Positives = 729/1135 (64%), Gaps = 88/1135 (7%)

Query: 45   YTPSVENLEKLLYDETILNDQEIRFPLLFEALSVTLFTTKSGKSILQTMKASTS------ 98
            Y    E L++LL D     D ++++ LL E + V L TT++G S+L  +K S S      
Sbjct: 61   YDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPK 120

Query: 99   --KERKAWEKSFENHDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKL 156
                ++ W    E     ++ +I  W+ DD + LKFL F+L N+   L  +  N  ++K+
Sbjct: 121  CISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKV 180

Query: 157  PLSFLIVSKVNLPSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYD 216
            PLSFLI SK     +IL+  YN+L DY  A+    E  +    ++     + K T+  Y+
Sbjct: 181  PLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHL-KRTVINYN 239

Query: 217  RMIEFRNFYFWYSFSAEKNATPKLNHNINL-LMDSYEDNLDGVSSVDDAGKSDNHQ--KQ 273
            R+ +F  ++ WY+     +  P ++  I   L+DS +  ++ VS ++   + +  Q   Q
Sbjct: 240  RVYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESNDQEERIQIIDQ 299

Query: 274  PKDTI---------------------------IHRTVNDQEQIYSFELNQDGTLQIPNVM 306
             +  I                            H  VN  EQ++SF+LNQDG+L++PN+M
Sbjct: 300  IRSAIQDISSASLNSGFYGDEDRSALEEYSDNYHHQVNQNEQVFSFDLNQDGSLELPNLM 359

Query: 307  EHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLG 366
             H+ +RHE+L K+L L    +PLL+ QF  + GLVDPLTQP PNDKH+IS+D LYQ+FLG
Sbjct: 360  SHAAVRHEILMKVLKLNNSSSPLLQLQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLG 419

Query: 367  LMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDTVHWRTQ 426
             + P I+ + E     DW+F++CFNMQKIIDA+++RLN   FE+LNSINN+DD V WR+Q
Sbjct: 420  FLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQ 479

Query: 427  LHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILLA 486
            L  WLPHG NTQDLEL+ M+DI+AVYTIYKLYE +PIQLNPFL SL+SLWKNL+CVILL 
Sbjct: 480  LDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLG 539

Query: 487  LEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSPY 546
            LEIDRIEEE  T++TPLMVRATIRGAAALR+++A VLNG V++  HD KHESLNTFMSP+
Sbjct: 540  LEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPH 599

Query: 547  GRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNE 606
            GRKLC GALYA+LRSH A+LLALG+ +EDVT LF+DLQ GDRFDED+RYMF+YE EDYN+
Sbjct: 600  GRKLCQGALYAELRSHAAALLALGSELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYND 659

Query: 607  SFSDCGDEELGEGVNS----GEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANASTNNDS 662
              S    EE   G +      + +KT    GF  RRCNCIF+DD+++ ++          
Sbjct: 660  LSS---REEDYSGFDKYDDYTDSSKTHARKGF-GRRCNCIFDDDEMLEDEDYENEYEGHK 715

Query: 663  IKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYYSP 722
               +I    N  ++ +++          P+++RS  +FEFDYSG+DWRD+P+  N+YYSP
Sbjct: 716  APKQILPQQNPTTSVSMSTTG------KPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYSP 769

Query: 723  SYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFTSI 782
            +Y F+++   + I +LT +   + LS+ ES+LL+ SVA+CVKNEQD+++L     N T +
Sbjct: 770  NYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLG----NITEL 825

Query: 783  -GENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEMLM 841
              +N   G   I       ++L+  +PDDIYE+W ++S FE+M+Y NH+VAWRLMDEMLM
Sbjct: 826  HHQNGSRGSQVI-------DKLKDISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLM 878

Query: 842  CTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQK 901
            C+G+RR+LIWF+TH+EL HSLI+Y+FEL+MGLR +    E ++ D  D+ I E+   K+ 
Sbjct: 879  CSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKS--FDENNENDNGDESISEM--TKEA 934

Query: 902  NENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEGEDA----------- 950
             E  + LPFSRQG I LS IETKMLLQEFF NAAIFL+ K+ E  GE+            
Sbjct: 935  PEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEWIGEEPMEDEATINDGE 994

Query: 951  -DKVSLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQI 1009
               VSLY++GL+KLIC MV+  I   KF F +SEC FELQTLLM WI I+PEAKDLFF++
Sbjct: 995  NGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFEL 1054

Query: 1010 KSRLA------MEEDGITDNTVQHKDKTDLDLDSGKKPNTKSI-SKLNMKILSLFPSNPT 1062
            K+ +A      M+++ +++N      K    +++      +++ S+ N K++SL      
Sbjct: 1055 KALVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVDSEYNRKLISLLSPVMH 1114

Query: 1063 ENDDNSAISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYIT 1117
              ++N+A+  LR+FI  YSFDT V   GR+VV+  ++ILPLP+++ P+ L +Y+ 
Sbjct: 1115 RKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPESETPMSLLDYLV 1169

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1117 (46%), Positives = 715/1117 (64%), Gaps = 104/1117 (9%)

Query: 36   LQELLKDRHYTP--SVENLEKLLYDETILNDQEIRFPLLFEALSVTLFTTKSGKSILQTM 93
            L ELL + +  P   VE L + L +E +L + + R  L+ E L + LFTT++G S+L   
Sbjct: 12   LHELLVEANLQPLKGVEGLAEALREEKVLKNDQWRPSLICETLIIALFTTRAGISLLPLF 71

Query: 94   KASTSKERKAWEKSFENHDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQIDRYNLPK 153
              S  ++R                 +  W  D+ L+L+F  +IL N+++ ++   +   +
Sbjct: 72   SESAKRKR-------------VGPRVLEWHNDEELMLRFFSYILENRSSRIEPRLFEKAR 118

Query: 154  YKLPLSFLIVSKVNLPSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQ 213
            +KLPL FLI SK    S++L++ YN+L DY++ I+  ++   W +  F Q    FK T+ 
Sbjct: 119  WKLPLFFLIESKFLAASMVLDQNYNLLLDYVHTITPMIKR--WVHRAFTQGT-FFKDTVV 175

Query: 214  QYDRMIEFRNFYFWYSFSAEKNATPK------LNHNINLLMDSYEDNLDGVSSVDDAGKS 267
             Y+R+ E ++   WYSF  +K+   +      L  N   ++D+Y + +          + 
Sbjct: 176  CYNRVYELKDSSEWYSFGTKKSNEERRAIQQFLRENSEQVLDTYHEMV----------RP 225

Query: 268  DNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTLQIPNVMEHSLLRHELLFKILNLTPVLT 327
             N +        H  ++  E +YSF++NQDG+L+IPN+M H+ +RH++L  ++ L    +
Sbjct: 226  SNERAINDTASYHHRISQHENVYSFDINQDGSLEIPNIMSHASVRHDILQNLMRLPLCDS 285

Query: 328  PLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFY 387
            PLL+ QF  + GLVDPLTQP PNDKHIIS+D LYQ+ LGLM P+I  +   ++  DWKF+
Sbjct: 286  PLLQWQFKLMAGLVDPLTQPPPNDKHIISLDLLYQMLLGLMEPAISNTL-GSDGCDWKFH 344

Query: 388  ICFNMQKIIDATMLRLNCFGFEKLNSINNTDDTVHWRTQLHIWLPHGLNTQDLELLYMID 447
            +CFNMQKII A++ RLN   F+ LNSINN+D+ V WR  LH WLPHGLNTQ+LEL+YMID
Sbjct: 345  LCFNMQKIIQASLKRLNLQDFDTLNSINNSDEDVSWRDNLHSWLPHGLNTQNLELIYMID 404

Query: 448  ILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEEKGTYETPLMVRA 507
            ILAVYTIYKLYE++P+QLNPFL  ++SLWKNL+CVILL LEIDR EEE  T+ETP++VRA
Sbjct: 405  ILAVYTIYKLYEDLPVQLNPFLSPMISLWKNLTCVILLGLEIDRFEEEHETFETPVLVRA 464

Query: 508  TIRGAAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLL 567
            TIRGAAALR+V+A +LNG V +  HDF HE LNTFMSP+GRKLC GALYADLRSH A+LL
Sbjct: 465  TIRGAAALRAVVATILNGHVDTYKHDFMHEPLNTFMSPHGRKLCQGALYADLRSHAAALL 524

Query: 568  ALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNESFSDCGDEEL-GEGVNSGEKT 626
            ALG  +EDVT+L ADLQ+GDRFDED+RYMF+YEC++YNE     GD E   +G  + E+ 
Sbjct: 525  ALGTELEDVTNLLADLQAGDRFDEDVRYMFEYECDNYNE-----GDSESEKDGKLAVEQP 579

Query: 627  KTSIHNGFYQRRCNCIFNDDKLVAEDGANASTNNDSIKNEIRSDGNAGSNTAITNANHAT 686
            K        QRRCNCIF+DD++  ++  +   +       +    NA ++ ++      +
Sbjct: 580  K------ILQRRCNCIFDDDEMAEDEDFDGENDEAFFSKHLILQQNAQTSLSM------S 627

Query: 687  SSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYYSPSYSFIQEPKLDIIFNLTLRGATEK 746
            SS  P +VRS   FEFDYSG+DWRD+P+  N YYSP + FI+ P L  +  LT + ++EK
Sbjct: 628  SSGKPRAVRSGGAFEFDYSGKDWRDIPRGSNFYYSPDFEFIESPSLSSLLALTKKASSEK 687

Query: 747  LSREESVLLVRSVASCVKNEQDQMILADLGSNFTSIGENFEGGDTGITSDKTNDEELR-- 804
            L  +ES+ L+RSVASCVKNEQD++ L +L                    D   DEE R  
Sbjct: 688  LVEKESLTLLRSVASCVKNEQDEITLGNL---------------IDPHQDSQADEESRNA 732

Query: 805  -RTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLI 863
             +  PDDIYE+W E S FE+++Y NH +AW+LMDEML+C GYRR+LIWF+TH+EL HSLI
Sbjct: 733  DKIEPDDIYEMWCENSTFEKIVYFNHTLAWKLMDEMLLCIGYRRVLIWFITHMELNHSLI 792

Query: 864  YYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQKNENTSGLPFSRQGPIVLSDIET 923
            +Y+FEL+MGLRGN     + + DR  D+    L+   K +    + FSRQG + LS IET
Sbjct: 793  HYIFELVMGLRGN-----SDENDRDVDLAGPPLQDVDKVKGELSVGFSRQGALQLSTIET 847

Query: 924  KMLLQEFFMNAAIFLSSK--------NTEEEGEDAD------KVSLYSLGLVKLICYMVQ 969
            KMLLQEFF NAAIF+S K        N E+  E+ D       VSLY++GL+KLIC+MV+
Sbjct: 848  KMLLQEFFTNAAIFISKKSEESTDIANEEQNNENRDLNGNSENVSLYAMGLMKLICFMVR 907

Query: 970  TLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKSRLAMEEDGI-TDNTVQHK 1028
            T I  +KF F++SEC FELQ LLM WIGI+PEAK LFF++KS +A    G  T  +VQ +
Sbjct: 908  TFINKEKFDFSESECVFELQALLMNWIGIIPEAKTLFFELKSLIA----GFSTATSVQEQ 963

Query: 1029 D----KTDLDLDSGKKPNTKSIS-----KLNMKILSLFPSNPTENDDNSAISTLRSFITD 1079
                 K D   D  K+ +   +S     + N K+++L P      ++N+A+ TLRSFI  
Sbjct: 964  KNAEVKNDTQEDVPKEQSPVRVSNTAGFEFNRKLMTLLPPLVKNKEENAAMQTLRSFIKT 1023

Query: 1080 YSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYI 1116
             SF   V   GR++V+ DDKILPLPK+D P+ LHEYI
Sbjct: 1024 SSFLNTVPVIGRKIVYEDDKILPLPKSDVPLALHEYI 1060

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/1157 (45%), Positives = 729/1157 (63%), Gaps = 119/1157 (10%)

Query: 33   FISLQELLKDRHYTPSVENLEKLLYDETILND----QEIRFPLLFEALSVTLFTTKSGKS 88
            +  L+EL  +R+Y PS+  L  LL D+ +LN+    QE    LL E + +   +T+SGK 
Sbjct: 31   YTPLRELFAERNYQPSLSQLLNLLSDDALLNNLTPIQE--HSLLVECVIIGFLSTRSGK- 87

Query: 89   ILQTMKASTSKER--------KAWEKSFENHDSNYASIIRSWKEDDVLLLKFLRFILANK 140
            +LQ+   +   ++        K W  S +   + +  + + W  + +  LKF +F+L N 
Sbjct: 88   LLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRKKWSSNKLYFLKFTKFLLVNA 147

Query: 141  TTPLQIDRYNLPKYKLPLSFLIVSKVNL-PSIILNEGYNMLKDYLYAISGRMEGLIWCNS 199
               + +D+Y  P YKLPL+FL     NL P+ IL+  YN+L+DY+YA    ++ ++    
Sbjct: 148  DGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLLQDYIYACGPLLKCVM--KD 205

Query: 200  TFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKLNHNINLLMDSYEDNLDGVS 259
            T +    +    + + D  ++F   Y WY                +LL   +E +L+   
Sbjct: 206  TLENGICLDLPGIYKLDIDLQFP--YPWY----------------DLLPPMHEGHLNATK 247

Query: 260  SVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTLQIPNVMEHSLLRHELLFKI 319
              +++       +    T  +   N+ + +YSF+LN D T ++ NV+ H+  RH +L ++
Sbjct: 248  QNNNSNNIPLTMQPSIKTNNNGANNNNQTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQL 307

Query: 320  LNLTPV-LTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEH 378
            +N   +  TPLL  QF+ + GLVDPL+QP PN+K +IS+  LY +F+GLMYP++K     
Sbjct: 308  INNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNA 367

Query: 379  NNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSI----------NNTDDTVHWRTQLH 428
            N+ ++WKF+ICFNM K+I+ +M+ L C  F KLN I             DD   W+ +L+
Sbjct: 368  NDGFNWKFHICFNMVKLINNSMVILKCDNFNKLNDIINSNNDNDEGTENDDDDAWKLKLN 427

Query: 429  IWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILLALE 488
             W+PHG+NTQDLEL+YMI+I+AVYTIY+LY ++PIQ+NPFL  L++LWKNLS +ILL L+
Sbjct: 428  EWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLD 487

Query: 489  IDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSPYGR 548
            IDR EE + T+ TPL+VRATIRGAA+LR+V+A +LN  V  N+HDFKHE LNTFMSP+GR
Sbjct: 488  IDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGR 547

Query: 549  KLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNESF 608
            KLC GALYAD+RSH A++LALGA +EDVTDL  DLQ+GDRFDEDIRYMFDYE +DYN+  
Sbjct: 548  KLCQGALYADIRSHAAAILALGAELEDVTDLLTDLQAGDRFDEDIRYMFDYEYDDYNDFK 607

Query: 609  SDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANASTNN-------- 660
             D  ++E  E +            G + RRCNCIF DD ++ +D  N + N+        
Sbjct: 608  DDVEEQEEMEIM------------GSFPRRCNCIFEDDNIINDDTDNINENDEDDDDEQE 655

Query: 661  ---DSIKNEIR--SDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKD 715
               D+I+   +     N   + AI   N      +P S RS+S+FEFDY G+DWRD+P+ 
Sbjct: 656  EYVDAIEGVTKDTPHNNLNPHDAIRTRNS-----HPNSKRSKSSFEFDYGGKDWRDIPRG 710

Query: 716  FNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADL 775
            FN+YYSPSY FI+ P ++ I  LT +   EKL+ E+S LL+ +VASC+K EQD+MI  +L
Sbjct: 711  FNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKEL 770

Query: 776  GSNFTSIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRL 835
              + T    +         ++  +D + +  TPDDIY++WSEES FERMLY+N DVAWRL
Sbjct: 771  LKHNTVKHPH--------AAENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRL 822

Query: 836  MDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEI 895
            MDEMLMC GYRR+LIWF+TH+EL HSLI Y+FEL+MGLRG+PFSGE  + D K+D+++EI
Sbjct: 823  MDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEI 882

Query: 896  LKKKQKNE----NTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEE------ 945
            +  + KN+    + + LPFSRQGP++LS+IE KMLLQEFF NAAI+ SSK+  E      
Sbjct: 883  MYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSNNEGTTNND 942

Query: 946  --EGEDADKV--SLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPE 1001
              EG D + V  S+YS GLVKLIC+MVQ+L+ N+KF F KSECTFELQTLLM WIGI+PE
Sbjct: 943  NGEGIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPE 1002

Query: 1002 AKDLFFQIKS----------RLAMEEDGITDNTVQHKDKTDLD------LDSGKKPNTKS 1045
            A+DLFF +KS          R + + D    + +   D  D         D+   P  +S
Sbjct: 1003 AEDLFFTLKSGVSSSSTKTGRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSPPNES 1062

Query: 1046 ISKLNMKILSLFPSNPTENDDNSAISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPK 1105
            I   N +++SL P    + D+N+A+STLR FI  YSFD +    GR+VV+ D+ +LPLP 
Sbjct: 1063 I--FNKRLVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPA 1120

Query: 1106 ADKPIPLHEYITLAELD 1122
            AD+PI  HEY+T  ELD
Sbjct: 1121 ADQPISFHEYLT--ELD 1135

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1079 (47%), Positives = 704/1079 (65%), Gaps = 99/1079 (9%)

Query: 71   LLFEALSVTLFTTKSGKSILQTMKASTS-----KERKAWEKSFENHDSNYASIIRS-WKE 124
            +L E L ++LFTTKSG SIL  +    +     +   +W +S  + D NY  +    W+ 
Sbjct: 52   VLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLES-SSGDLNYKYLKHELWQS 110

Query: 125  D-DVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILN-EGYNMLKD 182
            + +  L +F +F+L N+  P  ++ Y+L KYKL L  LI S+ N+ S+ILN + YN+L D
Sbjct: 111  NRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRLINSESNIISLILNSDNYNLLLD 170

Query: 183  YLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKLNH 242
            ++      M  LI    ++      F   + +Y+R+ E   F+ WY+ +   N +  + +
Sbjct: 171  FIMFFQPYMNDLI----SYIVEGNKFFEIIAKYNRIYELNGFHTWYTLTIASNTSIAVRY 226

Query: 243  NINLLMDSYEDNLDGVSSVD-------DAGKSDNHQKQPKDTII---HRTVNDQEQIYSF 292
                        L+ V S+D        +   D   ++ ++T++    +T  D + I+SF
Sbjct: 227  ------------LNDVLSIDPMITDQFTSNYRDKAFQESEETLLMSQQQTAKD-DIIFSF 273

Query: 293  ELNQDGTLQIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDK 352
            +LN+ G L  PN+++HS +RH++++ ILNL  + +P L++QF  +CGLVDPLTQP PN++
Sbjct: 274  DLNETGDL--PNLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLLICGLVDPLTQPQPNNE 331

Query: 353  HIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLN 412
            HIISID +YQLF+GLMY          +     F ICFNMQKII  +++ LNC  ++ L+
Sbjct: 332  HIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDYDTLS 391

Query: 413  SINNTDDTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSL 472
            +I N D    ++T L+ WLPHG+NTQDLEL+YMI+I+A+YTIYKLY  +PIQLNPFL +L
Sbjct: 392  TILN-DFPNDYKTALNKWLPHGINTQDLELIYMINIIAIYTIYKLYSNLPIQLNPFLQTL 450

Query: 473  LSLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDH 532
            +SLWK LS ++L+ LEIDRIEE   TY+TP++VRATIRGAAALR+VIA +LN  V + +H
Sbjct: 451  VSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHVSTKEH 510

Query: 533  DFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALG-ASIEDVTDLFADLQSGDRFDE 591
            DFKHES NTFMSP+GRKLC GAL ADLRSH A++LALG   + DVT+L ADLQ+GDRFDE
Sbjct: 511  DFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAGDRFDE 570

Query: 592  DIRYMFDYECEDYNESFSDCGDEELGEGVNSGEK-TKTSIHNGFYQRRCNCIFNDDKLVA 650
            D++Y+F+YE +DYNE     G+E+  E  N  E+  K S+     +RRCNCIF DDK++ 
Sbjct: 571  DVKYIFEYEYQDYNE----LGEED--EQTNELEELEKRSVK----KRRCNCIFEDDKML- 619

Query: 651  EDGANASTNNDSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWR 710
            ED       N+S     R D N  S+ + T         NPYSVR  S FEFDYSG+DWR
Sbjct: 620  EDYEYYEVGNES----RREDMNLESDKSRT---------NPYSVRVNSIFEFDYSGKDWR 666

Query: 711  DVPKDFNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQM 770
            DVP+ FN+YYSPSY FI+ PKL  + + TL+  TEKLS E+S+LL++SVASCVK EQ++M
Sbjct: 667  DVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTEKLSDEDSLLLLQSVASCVKLEQEKM 726

Query: 771  ILADLGSNFTSIGENFEGGDTGITSDKTNDEEL-RRTTPDDIYEIWSEESAFERMLYVNH 829
            IL           EN+       T + + +E+L R  TPDD+YEIW EESAFERM+Y+N 
Sbjct: 727  IL-----------ENYSN-----TKNCSTEEDLDREVTPDDVYEIWCEESAFERMIYLNK 770

Query: 830  DVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKD 889
            +VAWRLMDEMLMC GYRR+L+WF+TH+E+ HSL++Y+FEL+MGLRG          DR  
Sbjct: 771  EVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLK 830

Query: 890  DMIYEILKKKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEE-EGE 948
             ++ + +   +K   +  +PFSRQG I+LS+IETKMLLQEFF NAAIF S+ +T      
Sbjct: 831  SLLLQDMMTDKK--GSEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSN 888

Query: 949  DADKVSLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQ 1008
            D++ VSLY++GLVKLIC+MV+TL+ NDKF F+KSECTFELQTLLM WIGI+PEA++LFF 
Sbjct: 889  DSENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFT 948

Query: 1009 IKSRLAMEEDGITDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNS 1068
            +K+        + + +++ K  +D     G   N   +S  N K+L+L PS      +N 
Sbjct: 949  LKA-------NVGEPSMEGKSDSD-----GTDSNEGELSWYNSKLLALLPSPTNSGLENP 996

Query: 1069 AISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYI--TLAELDMGD 1125
            AI TLRSF+  YSF  +V   GR+V++ DDKILP+PK  +PI L E I     E D GD
Sbjct: 997  AIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILLRELIDENFEEDDDGD 1055

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1136 (43%), Positives = 689/1136 (60%), Gaps = 80/1136 (7%)

Query: 34   ISLQELLKDRHYTPSVENLEKLLYDETILNDQEIRFPLLFEALSVTLFTTKSGKSILQ-- 91
            ++L  L KD  Y P   NL       TI + +E    ++ E L ++LF T  G SIL+  
Sbjct: 20   MALSRLCKD--YYPDQRNL-------TIPHVEEFPDAVVQEMLILSLFVTLPGHSILELY 70

Query: 92   ---TMKASTSKERKAWEKSFENHDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQIDR 148
               +         K W+ S       Y  +++ W    ++LL+F   +L NK  PL+  +
Sbjct: 71   YDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVKRWSTSTLVLLRFTDLLLQNKNVPLEYTK 130

Query: 149  YNLPKYKLPLSFLIVSKVNLPSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIF 208
            +N  +YKL L FL+  +     +IL+  YN+L DYL      +E ++  N        + 
Sbjct: 131  HNTAEYKLSLIFLLDKQNEF--LILDPDYNLLLDYLLHAKPMIESILLGNI-----PGLL 183

Query: 209  KGTLQQYDRMIEFRNFYFWYSFSAEKNATPKLNHNINL-LMDSYEDN-----------LD 256
            K  + QY+++ EF   + WY+F    + T ++ H   + L D +  +           ++
Sbjct: 184  KALVYQYNKLPEFNGCHTWYTFRTHYHGTQEIFHKFFIALTDKFTASKEIMPELEGWFVE 243

Query: 257  GVSSVDDAG----KSDNHQKQP------KDTIIHRTVNDQEQIYSFELNQDGTLQIPNVM 306
            G  S D         D++          +D    +  N QEQ+YSFELN+DGTL+IPNV 
Sbjct: 244  GPVSRDSGCIKPITGDDYTSSAAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIPNVF 303

Query: 307  EHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLG 366
             H+  RH+ L+K+L L    TPLL+  F T C L DP+TQP PNDKHI+S+D L  +FLG
Sbjct: 304  AHTKRRHDALYKVLGLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLG 363

Query: 367  LMYPSIKTSQEHNNHYD-WKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDTVHWRT 425
            LMYP I        + D W  +ICFN+QKII+AT+ RLNC  F +LN INN+DD+V WR 
Sbjct: 364  LMYPEITADLVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRK 423

Query: 426  QLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILL 485
             L+ WLP GLNTQDLEL+YM+DILA YTIYKLY   PIQ+NPFL  ++SLWKNL+CV+LL
Sbjct: 424  NLYKWLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLL 483

Query: 486  ALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSP 545
             LEIDR+EEE+ T+ TP+MVRATIRGA+ALRSV+A ++NG  +   HDFKHE +N FMSP
Sbjct: 484  GLEIDRLEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSP 543

Query: 546  YGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYN 605
            +GRKLC+GALYADLRSH A++LALG  +E +TDL +DLQ GDRFDED++YMFDYE +DYN
Sbjct: 544  HGRKLCNGALYADLRSHAATMLALGIELETLTDLLSDLQPGDRFDEDVKYMFDYEFDDYN 603

Query: 606  ESFSDC-GDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANASTNNDSIK 664
            E  ++   D+EL E + S E+ K     G+Y +RC+C+F+DD LV E+        D   
Sbjct: 604  EVDTELMADDEL-EDIESRERIKEV--RGYY-KRCHCVFDDDSLVPENEDGGGEEGDQED 659

Query: 665  NEIR-SDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYYSPS 723
             +    D +        N   +T+S  P +VRSR T EFD++G DWRD+P+  N YY+ +
Sbjct: 660  TKKHLQDSHEDQLPPQQNVVMSTTS-KPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDA 718

Query: 724  YSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFTSIG 783
            Y F+ +   D++  L      +KL R  +  ++RS+A+CVK EQ++ I+        ++G
Sbjct: 719  YIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVR------RALG 772

Query: 784  ENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEMLMCT 843
                   +  T+ KT +E     T D IYE W E+S FE+M+Y N D+ WR+MDEMLMC+
Sbjct: 773  NQDGDKSSNATTIKTENE----LTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCS 828

Query: 844  GYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQKNE 903
            GYRR+LIWF+THLE+ HS+I+Y+FEL+MGLRGN    +  ++ +  D +  + +    +E
Sbjct: 829  GYRRVLIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSE 888

Query: 904  NTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTE----------EEGEDADKV 953
             T  LPFSRQGPI+LS IE  MLLQEFF NAAIF SSK  E          E  ED D+ 
Sbjct: 889  LT--LPFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRESFDSENEELDENFEDEDEF 946

Query: 954  SL--YSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKS 1011
            S+  + +GL+KL+C+MV TL+   KF FT SE  FELQTLLM WIGI+PEA+DLFF++KS
Sbjct: 947  SVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKS 1006

Query: 1012 RL-AMEEDGITDNT-VQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSA 1069
            ++ A  +D     T V+  +K D+D     + N  ++S+ N K++ L P  P   ++ +A
Sbjct: 1007 QIVATSQDTQEQGTPVKESEKDDIDAPDTLEMN-DTMSEHNKKLMMLIP--PGTTNERNA 1063

Query: 1070 ISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAELDMGD 1125
            ++ LR FI  YS   +    GR++++ DD+I+ +   DK +   E++    +D  D
Sbjct: 1064 LTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDYND 1119

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/1161 (39%), Positives = 682/1161 (58%), Gaps = 120/1161 (10%)

Query: 24   LGNVHRYAQFISLQELLKDRHYTPSVENLEKLLYDET----ILNDQEIRFPLLFEALSVT 79
            +  V   ++   + E+L   +Y PS+  LE+LL DE     +L D E++   + E   + 
Sbjct: 1    MAKVAHVSKLKRIAEILSP-NYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIA 59

Query: 80   LFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR-------SWKEDDVLLLKF 132
            LFTT+ G S+L  +  +   +        +N D N  S++         W  D+++L+KF
Sbjct: 60   LFTTRPGISLLNCLTDNFGIDE-------DNKDFNPNSLLPRMPQLALKWMHDELILIKF 112

Query: 133  LRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVN--LPSIILNEGYNMLKDYLYAISGR 190
            LRFI+ N+   +     N    KL L FLI ++ +  +   +L    +++++YL AI  +
Sbjct: 113  LRFIIDNRNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPK 172

Query: 191  MEGLIWC-----NSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKLNHNIN 245
            ++ +I       N   D     F  T+  Y R+ E    + +Y +S+ K       +  +
Sbjct: 173  LKNIIKISLNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMKT------NGSD 226

Query: 246  LLMDSYEDNLDGVSSVDDA---------GKSDNHQKQP-KDTIIHRTVND-----QEQIY 290
            + + +   +L G+S+                DN    P K   I  +V+      +E   
Sbjct: 227  IYVKALMKHLTGLSNFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGEVEENQE 286

Query: 291  SFELNQDGTLQIPNVMEHSLLRHELLFKILNLTPVL-----TPLLEQQFSTLCGLVDPLT 345
            +  + Q   L  P++M  +  RH  L K++  + +      +PLL+ Q+ TL  L+DPLT
Sbjct: 287  TDNILQPSLLDFPDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLT 346

Query: 346  QPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNC 405
            QP PND H+ISID L  +FLGLM P I     +++  DW+F+ICFNMQ+II A++  LNC
Sbjct: 347  QPVPNDTHVISIDLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNC 406

Query: 406  FGFEKLNSINNTDDTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQL 465
              FE+L +++ + D   WR+QLH+WLP GLNTQ+LEL+YM  ILAVYTIYKLY + P+  
Sbjct: 407  NDFERLGTVDESKD---WRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHF 463

Query: 466  NPFLFSLLSLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNG 525
            NPFL SL+SLWK+L+CV+L  L+IDR+EE   +++TP++VRATIRGAAALRS++A VLN 
Sbjct: 464  NPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNE 523

Query: 526  LVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQS 585
             ++   HDF HESLNTFMSP+GRKLC GALYADL+++TAS+LALGA  ++VTDL + LQ+
Sbjct: 524  QMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQA 583

Query: 586  GDRFDEDIRYMFDYECEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFN- 644
            GD+FDED++YMF+YE EDYNE + D           +  +    I   F +RRCNCIF+ 
Sbjct: 584  GDQFDEDVKYMFEYEYEDYNEIYEDSS---------NENEENEEIDYAFNKRRCNCIFSD 634

Query: 645  ---DDKLVAEDGANASTNNDSIKNEIRSDGNAGSNTAITNANHATSSIN-PYSVRSRSTF 700
                ++   ++  +       I  EI +     +   I + +  ++ ++ P++VRS+S F
Sbjct: 635  DNLIEEEEDDEEESDVEKTSDIDGEIATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNF 694

Query: 701  EFDYSGEDWRDVPKDFNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVA 760
            EFDYSG+DWRD+P+++N+YYSP Y+FI  P L+ +F LTL+  +EKL++EE+ LL+ SVA
Sbjct: 695  EFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSEKLTKEEAALLLCSVA 754

Query: 761  SCVKNEQDQMILADLGSNFTSIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESA 820
            S VKNEQD+MI  +L              D   T+D+  D + +  TPDDIYEIW EESA
Sbjct: 755  STVKNEQDRMIFGNLLEQ-----------DKSSTADEHEDTK-KEATPDDIYEIWCEESA 802

Query: 821  FERMLYVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSG 880
            FER+L+ N D+AW+LMDEMLMC+GYRR+LIWF+TH+EL HSLI Y+F+L+MG RG     
Sbjct: 803  FERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRG----- 857

Query: 881  EASDQDRKDDMIYEILKKKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSS 940
              +  D   ++    + +   + N++ L FSR G + LS++ET+M+LQE F NAAI+ S 
Sbjct: 858  -INKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKLSELETRMILQELFTNAAIYFSD 916

Query: 941  KNTEEEGE----------------DADKVSLYSLGLVKLICYMVQTLIANDKFFFTKSEC 984
            K  +                    +    S+YS+GL+KLIC MV  LI N KF   +S+C
Sbjct: 917  KARKSNQSILTPDYSTEEEEFDEENEGGYSIYSVGLMKLICIMVSKLIENSKFNVNESDC 976

Query: 985  TFELQTLLMTWIGILPEAKDLFFQIKSRLA----MEEDGITD----NTVQHKDKTDLDLD 1036
             FELQTLLM WI ILPEAK+L F+I S L+    +E   +      +T  HK   D + +
Sbjct: 977  VFELQTLLMGWISILPEAKELSFKINSSLSEFSHVENSELASIEGASTKSHKQLVDKNSE 1036

Query: 1037 SGKKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLRSFITDYSFDTQVVAPGRRVVFH 1096
            S          K N  +L L P      ++N   +T R +I DYSFD++V    R+++  
Sbjct: 1037 S---------YKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTMCRKIIHQ 1087

Query: 1097 DDKILPLPKADKPIPLHEYIT 1117
             D+ILPL  ++KP   H+Y+T
Sbjct: 1088 SDEILPLQDSEKPFSFHDYLT 1108

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/1199 (38%), Positives = 661/1199 (55%), Gaps = 178/1199 (14%)

Query: 45   YTPSVENLEKLLYDETILNDQEIRFPLLFEALSVTLFTTKSGKSILQTM------KASTS 98
            Y PS+++L +L   E    D      ++ E + VTLF T+ G SIL  +      +   S
Sbjct: 25   YKPSIQSLLELNVQE---GDPHFEL-MIVEKVVVTLFMTRGGNSILHLLYDLSCGRIKLS 80

Query: 99   KERKAWEKSFENHDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPL 158
            + R++ +     H   + +  + W      L +FL F L N+   L    Y     KLPL
Sbjct: 81   EYRQSLKVRSNVH--QWKTCYKEWGSRRDTLSRFLDFCLRNEDCALDYTEYGRVMRKLPL 138

Query: 159  SFLIVSKVNLPSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRM 218
             FL+     L + +L+EGYN+L DY+  I+ R   L+W         R+    ++ Y+R+
Sbjct: 139  QFLL--PAGLHAYVLDEGYNLLLDYI--INSR---LMWEELLIQGIPRLLPELIEDYNRV 191

Query: 219  IEFRNFYFWY--------------------------SFSAEKNATPKLN----------- 241
             EF  +Y WY                            +  K   P+LN           
Sbjct: 192  FEFNGYYTWYGGAPSGAGAANSTRELHTKVLYALFDKLTVAKELLPRLNATVWSHSWPPM 251

Query: 242  ---HNINLLMDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDG 298
               H IN   +  ED  D  S ++             D+      + +EQ+Y+FELN+DG
Sbjct: 252  YHKHGINEFSNEEEDLYDFDSELE------------GDSWPQHKSSAKEQVYTFELNRDG 299

Query: 299  TLQIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISID 358
            +L+ PNV  H+  RHE L++IL L     PLL  QF TLC LVDP+TQP P +KHIISID
Sbjct: 300  SLEFPNVFLHTRRRHETLYRILGLPNRECPLLRAQFMTLCALVDPITQPPPTEKHIISID 359

Query: 359  FLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTD 418
             +YQ+FLG +   +++S       DW+F++C N+QKII ATM RLNC   E LNSINN+D
Sbjct: 360  LIYQMFLGSISSLLESSLRGQ---DWRFHVCHNLQKIILATMKRLNCHDSEVLNSINNSD 416

Query: 419  DTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKN 478
            +TVHW   +  W P GLNTQDLELLYM+D+L +YTIY+LY ++P+Q+NPFL     LWKN
Sbjct: 417  ETVHWNVNIGKWTPRGLNTQDLELLYMVDMLGIYTIYQLYSDLPVQMNPFLPLSFHLWKN 476

Query: 479  LSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHES 538
            L+ V+LL LEIDR EE++ T+ TP++VRATIRG+AALRSV+A ++N      +HDFKHE 
Sbjct: 477  LTNVLLLGLEIDRFEEDRETFSTPIIVRATIRGSAALRSVVATMINSHFSIKEHDFKHEP 536

Query: 539  LNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFD 598
            +N FMSP+GRKLC GALYAD+RSH A++LALG  + DVTDL +DLQ GDRFD+D++YMFD
Sbjct: 537  INLFMSPHGRKLCQGALYADVRSHAAAMLALGIELNDVTDLLSDLQPGDRFDDDVKYMFD 596

Query: 599  YECEDYN----ESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVA-EDG 653
            YE +DYN    E   D  +E+L       ++ +     G+Y +RC+C+F+DD+L++ E+G
Sbjct: 597  YEYDDYNAIDPEQLYDENEEDLERLEEIQQRERIKDMRGYY-KRCHCVFDDDELLSDEEG 655

Query: 654  ANASTNNDSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVP 713
             +   + D   N I     +     +T    +TS     +VRSR   EFD++G+DWRD+P
Sbjct: 656  TDTGEHTD---NHITETVQSAPLNLVTGV--STSGPQKVAVRSRDYVEFDFNGKDWRDIP 710

Query: 714  KDFNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILA 773
            +  N YY   Y F+ +   D++  L     ++KL   +S  ++RSVA+C+K EQ++ ++ 
Sbjct: 711  RGMNFYYVEDYVFVNKLHADVLHYLMKEATSKKLESNQSSFILRSVATCIKLEQEKTMVH 770

Query: 774  DL---GSNFTSIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHD 830
            D      + + +  +   G  G+TSD              IYE W E++ FE+M+Y N+D
Sbjct: 771  DAIFKSKDKSPLSASGSEGSNGLTSDF-------------IYEKWCEDALFEKMMYYNND 817

Query: 831  VAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQ---DR 887
            + WR+MDEMLMC+GYRR+LIWF+THLEL HS+I+Y+FEL+MG+RGN    +  ++   +R
Sbjct: 818  LVWRMMDEMLMCSGYRRVLIWFITHLELSHSVIHYIFELVMGMRGNVAYKDLEEEYIINR 877

Query: 888  KDDMIYEILKKKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSS---KNTE 944
              D++         +   + +PFSRQGPIVLS IE  MLLQEFF+NAAI+ S+       
Sbjct: 878  NLDLLDSF--SLGSSCIPASIPFSRQGPIVLSTIEVNMLLQEFFINAAIYFSNYLRDTAS 935

Query: 945  EEGEDADK----------------------VSLYSLGLVKLICYMVQTLIANDKFFFTKS 982
             E  D ++                       S + LGL+KL+C+MV  LI   K  FT S
Sbjct: 936  YEHLDVEQPEEQTEIEEGEAEDEIADERLTASSHVLGLMKLLCFMVDMLIEKKKLDFTDS 995

Query: 983  ECTFELQTLLMTWIGILPEAKDLFFQIKSRLAMEEDGITDNTVQH--------------- 1027
            E  FELQTLLM WIG++PEA+ LFF++KS L +    +  + + H               
Sbjct: 996  EYLFELQTLLMNWIGLVPEARTLFFKLKSTL-LNSSALNGSALSHLEGELASNDNDDSEP 1054

Query: 1028 ----KDKTDLDLDSG----------------------KKPNTKS---ISKLNMKILSLFP 1058
                +D   +D  +G                        PN  S   IS  N  ++ L P
Sbjct: 1055 VDTAEDAGPMDKSNGLDGLPLCDIGALTNGQPTSAANSAPNGMSESNISYCNQMLIKLLP 1114

Query: 1059 SNPTENDDNSAISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYIT 1117
              P   D+N+A++ LRSFI  +   T+    GRRV++ D+ I+ L  ADK +   E++ 
Sbjct: 1115 --PHSADENAAVTALRSFIAKHPLTTKTAIFGRRVIYQDNAIMGLYMADKELQQREFLA 1171

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/1193 (38%), Positives = 661/1193 (55%), Gaps = 148/1193 (12%)

Query: 43   RHYTPSVENLEKLLYDETILNDQEIRF-PLLFEALSVTLFTTKSGKSILQTMKASTSKER 101
            R Y P + +L      E  LN  +  F  L+ E + VTLF T+SG S+L  +        
Sbjct: 23   RTYKPDIRSLV-----EFRLNVGDEHFDALITEKVVVTLFMTRSGNSMLHMLYDLCCGRI 77

Query: 102  KAWE-----KSFENHDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKL 156
            K  E     K   NH S + S  + W     +L +FL F L N+   L    Y     KL
Sbjct: 78   KLTEYKQSLKVRSNH-SYWKSCYKDWGSRRDILSEFLDFCLRNENCALDYIEYASATRKL 136

Query: 157  PLSFLIVSKVNLPSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYD 216
            PL FL+     L   ++++ YN+L DY+  I  R    +W         +     + +Y+
Sbjct: 137  PLQFLLPEP--LRPYLIDDEYNLLLDYM--IQSRP---MWEMLLTQGIPKFLPELVDEYN 189

Query: 217  RMIEFRNFYFWYS---------------------------FSAEKNATPKLNHNI--NLL 247
            R  EF  +Y WY                             +  K   PKLN  +  +  
Sbjct: 190  RSYEFNGYYVWYGNVTCSQVQVQSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSW 249

Query: 248  MDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTLQIPNVME 307
              SY        S DD    D       D    + ++ +EQ+++F+LN+DGTL+ PNV  
Sbjct: 250  PASYTKQTLLDLSNDDDDHYDQDVDSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFL 309

Query: 308  HSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLGL 367
            H+  RHE+L+++L L     PLL+ QF TL  LVDP+TQP P + HIISID ++Q+FLG 
Sbjct: 310  HAKKRHEILYRVLGLPDAEGPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGS 369

Query: 368  MYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDTVHWRTQL 427
                I+         DW+F++C+NMQKI+ ATM RLNC   + LN++NN+D++VHW   L
Sbjct: 370  TSNLIENMLISRGR-DWRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNL 428

Query: 428  HIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILLAL 487
              W P GLNTQDLELLYM+D+L++Y +Y+LY  +P+Q+NPFL   L LWKNL+ V+L  L
Sbjct: 429  DKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGL 488

Query: 488  EIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSPYG 547
            EIDR EE++ T+ TP++VRA IRG AALRSV+A ++N    S +HDFKHE +N FMSP+G
Sbjct: 489  EIDRFEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHG 548

Query: 548  RKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYN-- 605
            RKLCHGALYAD+RSH A++L+LG  + DVTDL +DLQ GDRFD+D++YMFDYE +DYN  
Sbjct: 549  RKLCHGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAI 608

Query: 606  --ESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVA--EDGANASTNND 661
              E   D  +E+L       ++ +     G+Y +RC+C+F+DD+L++  E+G  AS+N D
Sbjct: 609  DPEQLYDENEEDLERLEEIQQRERIKDMRGYY-KRCHCVFDDDELLSDEEEGETASSNID 667

Query: 662  SIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYYS 721
              K    S  N  S+   T  N   S    +++RSR   +FD++G+DWRD+P+  N YY+
Sbjct: 668  RPKYSHNS-LNLPSSMLSTTFNGPNSQ--KFAIRSRDGVDFDFNGKDWRDIPRGLNFYYT 724

Query: 722  PSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFTS 781
              Y F+ +   D+++ L     T+K+    +  ++RS+A+C+K EQ++ ++ D+ +  T 
Sbjct: 725  EHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTD 784

Query: 782  IGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEMLM 841
             G          +S  +N + +   T D IYE W EES F +M+Y N+D+ WR+MDEMLM
Sbjct: 785  KG----------SSSNSNSDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLM 834

Query: 842  CTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGN-PFSGEASDQDRKDDMIYEILKKKQ 900
            C+GYRR+LIWF+THLE+ HSLI+Y+FEL+MG+RGN  +  EA D  +  ++         
Sbjct: 835  CSGYRRVLIWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNLDILDSLSLG 894

Query: 901  KNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSS-------------KNTEEEG 947
             +  T  +PFSRQGPI+LS IE  MLL EFF+NA I+ S                +E EG
Sbjct: 895  SSSVTIKIPFSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEG 954

Query: 948  ---------EDADK----VSLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMT 994
                     ED DK    VS + +GL+KL+C+MV  L+   KF FT SE  FELQTLLM 
Sbjct: 955  SDDLEYGLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMN 1014

Query: 995  WIGILPEAKDLFFQIKS----------------------------RLAMEEDGITDNTVQ 1026
            WIGI+PEA++LFF++KS                             L  E +GI    V 
Sbjct: 1015 WIGIIPEARNLFFKLKSSILEASSQNDSSKSDKQGTENIRKKSSQSLVTEGEGIEQKIVN 1074

Query: 1027 HK-------------------DKTDLDLDSGKKP---NTKSISKLNMKILSLFPSNPTEN 1064
                                 D  +L L++   P   N  ++SK N  ++ L P +   +
Sbjct: 1075 IDREDHLENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHV--D 1132

Query: 1065 DDNSAISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYIT 1117
            ++N+A++ LRSFIT +S   +    GRRV++ D  I+ L  ADK +   E++ 
Sbjct: 1133 NENTAVTALRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLA 1185

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/1157 (40%), Positives = 677/1157 (58%), Gaps = 141/1157 (12%)

Query: 39   LLKDRHYTPSVENLEKLLYDETILNDQEIRFPLLFEALSVT------LFTTKSGKSILQT 92
            L+ D     S+E L KL+  +   N+ E R    + +LS+       LFTTK G SIL+ 
Sbjct: 9    LVNDPERRSSLETLPKLV--DPKPNESEARGTNSYASLSIQEKLVIGLFTTKPGLSILKL 66

Query: 93   M-KASTSK----ERKAWEKS-FEN-HDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQ 145
              + S  +      K W++S F++  D+ Y  +++ W      +   + ++L N +T L 
Sbjct: 67   YYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSSDYISALMEYLLRNDSTSLD 126

Query: 146  IDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSA 205
               +   +YKL ++FL+     L  +I+++ YN+L D+L      +E L+   S  D  +
Sbjct: 127  YVSFYSAEYKLSMAFLLDQDTEL--LIIDDEYNLLLDFLLQTRASVEELL---SQADLPS 181

Query: 206  RIFKGTLQQYDRMIEFRNFYFWYSFSAEKNA-------------TPKLNHNINL------ 246
             I K  L  + R+ +    Y WY+FS E+ A             T KL    +L      
Sbjct: 182  LIAKSALSHH-RLFQLSGRYVWYTFSDERFAEAQDICYKYLSVLTDKLTAQQDLIPQIQP 240

Query: 247  LMDSYE----------DNL--DGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFEL 294
            L DS            D+L  +GV S  D+    +H  Q K       ++  E+IYSF+L
Sbjct: 241  LFDSVNSSRLAHLSQGDSLYSEGVES--DSNSDSDHWPQKK-------LSAHERIYSFDL 291

Query: 295  NQDGTLQIPNVMEHSLLRHELLFKILNLTPV-LTPLLEQQFSTLCGLVDPLTQPTPNDKH 353
              DGTL+ PNV   +  RH+ L+++L L     +P L+ QF TLC LVDP+TQPTPND H
Sbjct: 292  KDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVDPVTQPTPNDSH 351

Query: 354  IISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNS 413
            IISID L  +F+GL++  IK        ++W+F+ICFN+QKI+ +T+ RLNC  F++LNS
Sbjct: 352  IISIDLLSDMFIGLLHSEIKQLP-----FNWRFHICFNLQKILQSTLPRLNCHDFQQLNS 406

Query: 414  INNTDDTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLL 473
            +NN+DD++ WR  LH WLP GLNTQDLEL+YMIDILA+Y I+KLY + P+Q+NPFL S++
Sbjct: 407  VNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMI 466

Query: 474  SLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHD 533
            SLWKNL+ V+LL LEIDR EEE+ T+ TP++VRA IRG++ALRSV+A VLNG V+   HD
Sbjct: 467  SLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHD 526

Query: 534  FKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDI 593
            F+HE +N FMSP+GRKLCHGALY D+RSH A++LALG  +EDVT+L +DLQ GDRFDED+
Sbjct: 527  FQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDV 586

Query: 594  RYMFDYECEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDG 653
            +YMFDYE ++YNE  ++  DEE  E V S E+ K       Y +RC+C F+DD+L+ E+ 
Sbjct: 587  KYMFDYEYDNYNEVGTEDMDEEELEDVESRERIK---EMRAYYKRCHCQFDDDELLPEEE 643

Query: 654  ANAS--TNNDSIKNEIRSDGNAG-SNTAITNANHATSSINPYSVRSRS-TFEFDYSGEDW 709
              +    ++  I  E+  D N   SNTA            P ++R++  T EFD++G DW
Sbjct: 644  EESGIPISHTRISKELPPDTNVKLSNTA-----------KPVALRNKKDTIEFDFNGRDW 692

Query: 710  RDVPKDFNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQ 769
            RD+P+  N Y++ +Y F +  K      L    A  +LS+EE+V L+R V++CV  EQ+ 
Sbjct: 693  RDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLVSTCVAKEQEH 752

Query: 770  MILADLGSNFTSIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNH 829
             +L             F   D+   S ++        T D IYE W ++S F++ML+ N 
Sbjct: 753  TVLR----------SAFAADDSQALSCQSTLVADGDLTTDYIYENWCQDSLFDKMLFHNE 802

Query: 830  DVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKD 889
             + WR+MDEMLMC+GYRR+LIWF+THLE+  S+I Y++ L+MG RG              
Sbjct: 803  TLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRG-------------- 848

Query: 890  DMIYEILKKKQKNENT--SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEG 947
                    +K  NE T    LPFSRQG IVLS+IE KMLLQEFF NAAIF S +  E  G
Sbjct: 849  --------EKLANEETPFGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLG 900

Query: 948  EDADK------VSLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPE 1001
            ++ ++      +S Y +GL++L+C+MV++LI  + F F   +  FEL+TLLM+WI ILPE
Sbjct: 901  DEEEEETENLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPE 960

Query: 1002 AKDLFFQIKSRL-------------AMEEDGITDNTVQHKDKTDLDLDSGKKPNTKSISK 1048
            A+DLFF ++SR+             AM    + + +   +  TD +  S     T S+S 
Sbjct: 961  ARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFR-TTDENDGSSDSEETNSVSI 1019

Query: 1049 LNMKILSLFPSNPTENDDNSAISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPKADK 1108
             N K++SL P  P    +N+A++ LRSFI+ +S        GRRV+ HDD+I+ +  +DK
Sbjct: 1020 YNKKLISLLP--PVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDK 1077

Query: 1109 PIPLHEYITLAELDMGD 1125
             I    ++    +D  D
Sbjct: 1078 DIDNRNFLAEFGIDYND 1094

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1105 (40%), Positives = 649/1105 (58%), Gaps = 137/1105 (12%)

Query: 68   RFPLLFEALSVTLFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR-SWKEDD 126
            +F  L E   VTLFTT  G+ + Q ++     +      S     S     +R +W E+ 
Sbjct: 7    QFDSLLEECVVTLFTTYRGQHVCQMLE-----QLDLGVFSLSKTPSRIVQQVRTAWTEEA 61

Query: 127  V--LLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNMLKDYL 184
            +   +  F + +  +      I +YN P +KL +S L  S+ +   ++LN  Y++L D++
Sbjct: 62   LSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLLDFV 121

Query: 185  YAISGRMEGLIWCNSTFDQSARIFKGTL-----QQYDRMIEFRNFYFWYSFSAEKNATPK 239
              +  +++GLI          +  +G+L     ++Y R+ EF +++ W++ S +K A   
Sbjct: 122  NTVRPQLKGLI---------RQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFA--- 169

Query: 240  LNHNINLLMDSYEDNLDG-VSSVDDAGKSDNHQKQP--------KDTIIHRTVNDQEQIY 290
             N ++ +L     D     ++S       D H   P         + + ++ +   E +Y
Sbjct: 170  -NRDVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQLGTNEHVY 228

Query: 291  SFELNQD-----GTLQIP-NVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPL 344
             F+L+++     G   +  ++M+ S  RHE+L ++LNL  + +P L +QF  +  LVDPL
Sbjct: 229  EFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYEQFKCMISLVDPL 288

Query: 345  TQPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLN 404
            TQP P+D +++S+D LY+LFL  +  +  T Q         F +CFNMQKII  T+ RL 
Sbjct: 289  TQPPPSDTYVVSLDLLYKLFLAFLPKNQDTEQNDT------FLLCFNMQKIITRTLWRLK 342

Query: 405  CFGFEKLNSINNT-----DDTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYE 459
            C+ + KL SI+       +   ++R  L  W+P+GLNTQDLELLYM+DI+AVYTIY  Y 
Sbjct: 343  CWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTIYNAYS 402

Query: 460  EIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVI 519
             +PIQLNPFL  L+SLWKNLS V+LL+LE+DR EE   T++TPL+VRATIRGA+ALR+V+
Sbjct: 403  HLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGASALRAVV 462

Query: 520  AAVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDL 579
            A VLNG V+ N+HDFKHE LNTFMSP+GRKLC G+LYADLRSH A++L+LG  +EDVT+L
Sbjct: 463  ACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDLEDVTEL 522

Query: 580  FADLQSGDRFDEDIRYMFDYECEDYNESFSDCGDEE-------------------LGEGV 620
             +DLQ GDRFDEDIRYMF+YE EDYN    D  DE+                     EG 
Sbjct: 523  LSDLQPGDRFDEDIRYMFEYEYEDYN--LVDFEDEDEDAAAAATTATASAAAITAANEGT 580

Query: 621  NSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANASTNNDSIKNEIRSDGNAGSNTAIT 680
             + +K           RRCNCIF DDK++  D +  S                G N    
Sbjct: 581  GASQK-----------RRCNCIFTDDKIIQSDESKVSL-------------GGGKN---- 612

Query: 681  NANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYYSPSYSFIQEPKLDIIFNLTL 740
                      PYSVR++S+FEFDYSG DWRDVP+  N+Y+ PSY F+  P L    N++ 
Sbjct: 613  ---------RPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSS 663

Query: 741  RGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFTSIGENFEGGDTGITSDKTND 800
            + A  KL+  ES  L++ VAS +K EQ+ +I   +G+ +    E    GD G+       
Sbjct: 664  KAAGGKLNPMESQQLLKLVASAIKIEQECII---MGTVYPQT-EGIAVGDDGL------- 712

Query: 801  EELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKH 860
                  TPD+IY+ W ++  F+R+L++N ++AW+LMDE+LMC GYRR+L+WF+TH+EL H
Sbjct: 713  -----LTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNH 767

Query: 861  SLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQKNENTSGLPFSRQGPIVLSD 920
            S+I+Y+FEL+MGLRG   S + + ++++   ++ +++    N  T  L FSRQG + LS+
Sbjct: 768  SVIHYIFELVMGLRGQELSADVTLEEQRKQALHNLMEIDTPNGGT--LMFSRQGNLALSE 825

Query: 921  IETKMLLQEFFMNAAIFLSSKNTEEEGEDADKVSLYSLGLVKLICYMVQTLIANDKFFFT 980
            IE KMLLQEFF NAAIFLS+  +EE   +   VSLYS+GLVKLIC+MV+TLI N KF F+
Sbjct: 826  IEVKMLLQEFFTNAAIFLSASESEEPESETSDVSLYSIGLVKLICFMVKTLIVNHKFEFS 885

Query: 981  KSECTFELQTLLMTWIGILPEAKDLFFQIKSRLAMEEDGITDNTVQHK-------DKTDL 1033
            KSECTFELQTLLM W+GI+P+A++LFF +K  ++  +   T  T             T  
Sbjct: 886  KSECTFELQTLLMNWLGIVPDAQELFFLLKKNISDTKTATTTTTTTSALGAPGDIFPTLT 945

Query: 1034 DLDSGKKPNTKSISKLNMKILSLFP-SNPTENDDNS-AISTLRSFITDYSFDTQVVAPGR 1091
            D D       +++S+ N K++ L P +  +E   +S AI  LR+F+  +S  +++   GR
Sbjct: 946  DADDDNNAVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGR 1005

Query: 1092 RVVFHDDKILPLPKADKPIPLHEYI 1116
            R+V    +ILP    ++ + L EY+
Sbjct: 1006 RIVRRGSQILPQATPERTVTLREYL 1030

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1274 (38%), Positives = 705/1274 (55%), Gaps = 224/1274 (17%)

Query: 45   YTPSVENLEKLLYDETILNDQEIRFPLLFEALSVTLFTTKSGKSILQ---TMKASTSKER 101
            Y P+++ LE L+  +    D E    LLFE+L + LFTT  G S+L    T+K+ T+ ++
Sbjct: 18   YKPNIQLLETLI--DYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDKQ 75

Query: 102  K----------AWEKSFENHDSN---------------------------YASIIRSWKE 124
            K          A   S  N D N                           +  ++  W+ 
Sbjct: 76   KKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRN 135

Query: 125  DDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVS----------------KVNL 168
            D + LLKF +FIL N   PL  + +  P  KLPL FL+++                 +  
Sbjct: 136  DKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYN 195

Query: 169  PSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRN--FYF 226
             ++++++ YN+L DYL+  +  +  L+  N        +F   +  Y++  E  N     
Sbjct: 196  NTLLMDKNYNLLLDYLHVSTPLLISLLHTN----LDPLLFNNIISSYNKSFELTNDNKCL 251

Query: 227  WYSFSAEKNAT--PKLNHNINLLMDSYE---------------DNLDGVSSVDDAGKSDN 269
            WY F   K+ T    + + I+++ +  E               ++L  +SS      + +
Sbjct: 252  WYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEISNSLFNISSSSTTKSNMH 311

Query: 270  HQKQPKDTIIHRTVNDQ-EQIYSFEL---NQDGTLQIPNVMEHSLLRHELLFKILNLTP- 324
            ++ +  D  +    N   E   SF L   N +  +  P++M H   RH++L KILN+   
Sbjct: 312  NENEGADLNLLMDENSMGEHTLSFNLFENNINHGILHPDLMAHISKRHDILAKILNVGDN 371

Query: 325  ---VLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEHNNH 381
                 +PLL  QF  LC LVDPLTQPTPN K+IISID L+QLFLG + P +       + 
Sbjct: 372  DKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAEDG 431

Query: 382  YDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDTVHWRTQLHIWLPHGLNTQDLE 441
             +WKF +CFNM+KII++ M +LNC  F  LNSINN+D++VHWRTQLH WLP G NTQDLE
Sbjct: 432  TNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQDLE 491

Query: 442  LLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEEKGTYET 501
            LLYM++ILA YTIYKL E++PIQLNPFL S++S WKNLSC ILL LEIDR+EEE  T++T
Sbjct: 492  LLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETFDT 551

Query: 502  PLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRS 561
            PL+VRAT+R + ALRS+IA +LN  V +  HDFKHESLNTFMSPYGRKLC+GALY D RS
Sbjct: 552  PLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDFRS 611

Query: 562  HTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNESFSDCG--DEELGEG 619
            H +++LAL   +E VT L +DLQ GDRFDED++YMF++  EDYN   +  G  D+E    
Sbjct: 612  HASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEF--EDYNTLPNVLGGEDDETSTD 669

Query: 620  VNSGEKTKTSIHNGFY-------------------------QRRCNCIFNDDKL----VA 650
                 +    IHNG +                          RRCNCIF+DD++    ++
Sbjct: 670  TLKNREMLKEIHNGNFIPDNEENDEREIRNYLEQKLREMNCHRRCNCIFSDDEIKDTSIS 729

Query: 651  EDGANASTNNDSIKNEI---------RSDGNAGSNTA----------------------- 678
            +     +++++ I++ I         R  GN G+N+                        
Sbjct: 730  DKNYMGNSSSNGIESRIALLLNNNSSRKGGN-GTNSEDDEDVIRKNIENLTKDQLSSTEM 788

Query: 679  ----ITNAN--HA--TSSI--NPYSVRSRST---FEFDYSGEDWRDVPKDFNIYYSPSYS 725
                +T  N  HA  TS++  NP SV +++    F+FDY+G+DWRD P+  N+YY+ +Y 
Sbjct: 789  ESLRVTGFNKPHAVRTSNLNNNPSSVNNKNNQNIFDFDYNGKDWRDTPRGMNLYYNLNYE 848

Query: 726  FIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFTSIGEN 785
            FI++P LD++F LTL+    KL +++S LL+R VAS VKNEQD++I +D       + E 
Sbjct: 849  FIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSD-NQVSKEVKEI 907

Query: 786  FEGGDTGITSDK----------TNDEE-LRRTTPDDIYEIWSEESAFERMLYVNHDVAWR 834
             E  + G+ ++K           N++E +   TPDDIYEIW EESAFERM+ +N++V +R
Sbjct: 908  MEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFR 967

Query: 835  LMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQ---DRKDDM 891
            LMDEMLMC GYRR+LIWF+THLEL HS+I+Y+FEL+MG RG      A++    + K ++
Sbjct: 968  LMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGATEDKHTNTKGNV 1027

Query: 892  IYEILKKKQKNENT----------SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSK 941
                 K + +  N             LPFSRQG I LS+IE KML+QEF  NAAI  + +
Sbjct: 1028 NELENKNENELVNMLLNDYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHFNER 1087

Query: 942  NTEE-----------------EGEDADKVSLYSLGLVKLICYMVQTLIANDKFFFTKSEC 984
            N  +                 + ED D++SLYS+GL++LIC+M+Q  + N+K      + 
Sbjct: 1088 NNLKHNPNSNDNSNSNEDNINKDEDEDEISLYSIGLMRLICFMIQAFLDNNKLKIEVDDS 1147

Query: 985  TFELQTLLMTWIGILPEAKDLFFQIKSRLAMEEDGIT-------------DNTVQHKDKT 1031
             FELQTLLM WI I+PEAK LFFQIK  ++  +                 +NT++++   
Sbjct: 1148 IFELQTLLMNWITIIPEAKKLFFQIKDIISNNQIDNNNFNNNLILDLDQDNNTIENQTSK 1207

Query: 1032 DLDLDSGKKPNTKSISKLNMKILSLFPS-NPTENDDNSAISTLRSFITDYSFDTQVVAPG 1090
            D +    +     S S  N K++ LFP  + T  ++N+AI TL++++  + F  +V   G
Sbjct: 1208 DNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVPIIG 1267

Query: 1091 RRVVFHDDKILPLP 1104
            R+V++ D KIL +P
Sbjct: 1268 RKVIYEDGKILKIP 1281

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/1113 (39%), Positives = 646/1113 (58%), Gaps = 124/1113 (11%)

Query: 74   EALSVTLFTTKSGKSILQTM-KASTSK----ERKAWEKSFENH--DSNYASIIRSWKEDD 126
            E L + LFTT+ G S L+   + S  +      K W++S      D+ Y  +++ W    
Sbjct: 51   EKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQRVSDAAYKRMVKRWTSST 110

Query: 127  VLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNMLKDYLYA 186
              +   +   L N    L    +  P +KL ++FL+  +  +  +++++ YN+L D+   
Sbjct: 111  EHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLLDPETEV--LVIDDEYNLLLDFALQ 168

Query: 187  ISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEK------------ 234
                +E L+   +  D  + + K     + R+ +    Y WY+FSAE+            
Sbjct: 169  CRALVEQLL---NQIDLPSLLAKCAYG-HGRLFQLCGRYVWYTFSAEQFDEAQDICYKYL 224

Query: 235  -----------NATPKLNHNINLLMDS------YEDNLDGVSSVDDAGKSDNHQKQPKDT 277
                       +  P++     ++  S      Y D L   +   D+    +H  Q    
Sbjct: 225  SVLTDKLTAQQDLIPQIQPLFEIISSSKASHWVYGDGLFTENPESDSNSDSDHWPQ---- 280

Query: 278  IIHRTVNDQEQIYSFELNQDGTLQIPNVMEHSLLRHELLFKILNLTPVLT-PLLEQQFST 336
               + ++ QE++YSF+L  DGTL+  NV   +  RH+ L+++LNL    T PLL  QF T
Sbjct: 281  ---KRLSAQERVYSFDLKDDGTLEASNVFNRTRRRHQALYQVLNLQKQNTAPLLSSQFFT 337

Query: 337  LCGLVDPLTQPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKII 396
            LC LVDP+TQPTPND HI+SID L  +FLGL+Y  I     +  H DW+F++CFN+QKI+
Sbjct: 338  LCALVDPVTQPTPNDSHIVSIDLLSDMFLGLLYSEI-----NELHIDWRFHVCFNLQKIV 392

Query: 397  DATMLRLNCFGFEKLNSINNTDDTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYK 456
             AT+ RLNC  F++LNS+NN+DD++ WR  LH WLP GLNTQDLEL+YMIDILA+Y I+K
Sbjct: 393  QATLPRLNCHDFQRLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELIYMIDILAIYIIHK 452

Query: 457  LYEEIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALR 516
            LY ++P Q+NPFL S++SLWKNL+ V+LL LEIDR EEE+ T+ TP++VRA IRG++ALR
Sbjct: 453  LYRDLPAQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALR 512

Query: 517  SVIAAVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDV 576
            SV+A +LNG V+   HDF+HE +N FMSP+GRKLCHGALY D+RSH A++LALG  +EDV
Sbjct: 513  SVVATILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDV 572

Query: 577  TDLFADLQSGDRFDEDIRYMFDYECEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQ 636
            T+L +DLQ GDRFDED++YMFDYE ++YNE  ++  DE+  E V S E+ K       Y 
Sbjct: 573  TNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDELEDVESRERIK---EMRAYY 629

Query: 637  RRCNCIFNDDKLVAEDGANASTNNDSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRS 696
            +RC+C F+DD+L+ ED  +     D+    +  D    +N  ++N +       P ++RS
Sbjct: 630  KRCHCQFDDDELLPEDEEDGRP--DASPYRVTRDAPPDNNVKLSNTS------KPMALRS 681

Query: 697  -RSTFEFDYSGEDWRDVPKDFNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLL 755
             + + EFD++G DWR +P+  N Y++ +Y F +        +L    A +KL  EE   L
Sbjct: 682  QKDSVEFDFNGRDWRGIPRGLNFYFNENYEFEKHLSSGQAHSLMCNAAEKKLPLEEGTQL 741

Query: 756  VRSVASCVKNEQDQMILADLGSNFTSIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIW 815
            +R +A+CV  EQ+  +L     +   +GE  E  +    S    D +L   T D +YE W
Sbjct: 742  LRVIATCVAKEQELTVL----RSALLLGETPESEN---HSTLVADGDL---TTDFVYEKW 791

Query: 816  SEESAFERMLYVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRG 875
             E S FE++L+ N  + WR+MDEMLMC+GYRR+LIWF+THLE+ +S+I Y++ L++G RG
Sbjct: 792  CENSMFEKILFHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSNSMIEYIYTLVLGNRG 851

Query: 876  NPFSGEASDQDRKDDMIYEILKKKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAA 935
                  ASD D                   + +PFSRQG IVLSDIE KMLLQEFF NAA
Sbjct: 852  E---KAASDGD------------------YAKVPFSRQGAIVLSDIEIKMLLQEFFTNAA 890

Query: 936  IFLSSKNTEE-----------EGEDADKVSLYSLGLVKLICYMVQTLIANDKFFFTKSEC 984
            IF S +  E            + E    +S + +GL+KL+CYMV++L+  + F F   + 
Sbjct: 891  IFFSKQLRESLGDGEDDEDQGDDEKGSGISPHVVGLMKLVCYMVKSLMQKEMFDFKDPDY 950

Query: 985  TFELQTLLMTWIGILPEAKDLFFQIKS-------RLAMEEDGITDNTVQHKDKTDLDLDS 1037
             FELQTLLM+WI ILPEA+DLFF ++S        + +E + I  +  +   +++  L  
Sbjct: 951  IFELQTLLMSWICILPEARDLFFALRSLVDEQSQNIKLESESIA-SACEPDSQSEPQLPQ 1009

Query: 1038 GKKPN-----TKSISKLNMKILSLFPSNPTENDDNSAISTLRSFITDYSFDTQVVAPGRR 1092
            G         T ++S  N K++SL P  P    +NSAI+ LRSFI+ +S  T+    GRR
Sbjct: 1010 GTHAELEPEATHAVSIYNKKLMSLLP--PAAGTENSAITALRSFISKHSLTTKTALFGRR 1067

Query: 1093 VVFHDDKILPLPKADKPIPLHEYITLAELDMGD 1125
            V+  DD I+P+  +D+ +   +++    +D  D
Sbjct: 1068 VISQDDTIMPMYMSDREMDNRQFLAEFGIDYND 1100

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/896 (44%), Positives = 576/896 (64%), Gaps = 78/896 (8%)

Query: 276  DTIIHRT---VNDQEQIYSFELNQDGTLQIP-NVMEHSLLRHELLFKILNLTPV-LTPLL 330
            D  +HR     + +E++YSF+LN DG++ +P N+M ++  RH++L K+LN      +PLL
Sbjct: 381  DDYLHRIDDLKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLL 440

Query: 331  EQQFSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICF 390
            E QF  + GLVDPL+QP PNDKHIIS+D LYQLF+ ++YP+ +  Q +N  ++WK ++CF
Sbjct: 441  ELQFKLMLGLVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQ-NNLGFNWKTHVCF 499

Query: 391  NMQKIIDATMLRLNCFGFEKLNSI------NNTDDTV-------------------HWRT 425
             M KII+  M +LNC   +KL  +      NN ++ +                   +WR+
Sbjct: 500  QMVKIINNCMEKLNCNDLQKLYDLTGFQGENNKEELLQQQQQQQQQQQQTDRFVDGNWRS 559

Query: 426  QLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILL 485
             L  WLPHGLNTQDLELLYM+ ILA YT+ KL  EIPIQLNPFL +L++LWK L+ +++L
Sbjct: 560  TLEQWLPHGLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVL 619

Query: 486  ALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSP 545
             L+IDR EE   TY+TPL+V+ATIRGA+ALRSV+A +LN  ++ NDHDFKHE+LNTFMSP
Sbjct: 620  GLDIDRSEEAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSP 679

Query: 546  YGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYN 605
            +GRKLC+GALY D++   ASL ALG  + ++ +L + L+ GDRFDEDI YMF+YE +DYN
Sbjct: 680  HGRKLCNGALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYN 739

Query: 606  ESFSDCGDEELGEGVNSGEKTK-----TSIHNGFYQRRCNCIFNDDKLVAEDGANASTNN 660
             +  +   E+LG+ + S +          +    YQRRCNCIF   +       +   N 
Sbjct: 740  AALKE-NHEDLGKTLKSNDDNSDIYVLNEVKLDRYQRRCNCIF---EDDKILQDDDDGNG 795

Query: 661  DSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYY 720
            D  + E         N A         +++ Y+VRS++TFEFDYSG+DWRD+P+ FNIYY
Sbjct: 796  DEQQGEQEEQEGTPKNVASFQDPLGKRNLD-YAVRSKTTFEFDYSGKDWRDIPRGFNIYY 854

Query: 721  SPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFT 780
            S SYSFI +  LD + NLT + +T+KL+ ++S+ L++ +AS +K EQ+ MI+ DL     
Sbjct: 855  STSYSFIDDSSLDTMINLTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKGKD 914

Query: 781  SIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEML 840
             +  N    +  + S +  +      TPDDI++ W ++  F  ML+ N +++WRLMDEML
Sbjct: 915  QLHSNI--INPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEML 972

Query: 841  MCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQ 900
            MC GYRR+LIW++TH++L HSLI Y+FEL+MGLRG+PF   A++ + K+++++E++  K+
Sbjct: 973  MCNGYRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPF---ANNNECKNELLHELMLGKK 1029

Query: 901  KNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIF--------------------LSS 940
              +N +  PFSRQGP++LSDIETKMLLQEFF NAAI+                    +S 
Sbjct: 1030 IVDNHT-YPFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTEDISI 1088

Query: 941  KNTEEEGEDADKVSLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILP 1000
             + E E  +   VS+YS+GL+KLIC MV +LI N KF FTKS+C FELQTLLM WIGIL 
Sbjct: 1089 NSDEIENNENHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGILK 1148

Query: 1001 EAKDLFFQIKSRL---AMEEDGITDNTVQHKDKTDLDLDSGKKPNTKSISKLN------M 1051
            EAK+LFF++KS +   +   DG  D+  +  D       +GK   ++ I K+N      +
Sbjct: 1149 EAKELFFKLKSDIEETSESTDGGDDDDFESIDSRKSSESNGKWEGSR-IGKMNDFNKRLL 1207

Query: 1052 KILSLFPSNPTENDDNSAISTLRSFITDYSFDTQV-VAPGRRVVFHDDKILPLPKA 1106
            ++L+   S  T+ + ++  +  R  + +YSF ++     GR+VV+ DD+ILPLPK 
Sbjct: 1208 RLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPKV 1263

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 100/194 (51%), Gaps = 21/194 (10%)

Query: 45  YTPSVENLEKLLYDETI-LNDQEIR----FPLLFEALSVTLFTTKSGKSILQTMKASTSK 99
           Y P++ENL+  L DE   L  ++I+    F ++ E L +  FTTKSG+SIL  +  +  K
Sbjct: 85  YKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILNYLFDTKRK 144

Query: 100 ERKAWEKSFENHDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLS 159
                 K             ++W+ ++ L   F+ F++ NK   + ID++N P+ KL + 
Sbjct: 145 PPTVQNKILR----------KTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIK 194

Query: 160 FLI----VSKVNLPSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQY 215
           FL+    +S +  PSIIL+  YNML DYL A S  +  LI    T       F  T+ +Y
Sbjct: 195 FLLTFHPLSNIETPSIILDSNYNMLTDYLDATSNWLILLI--KMTILNVGPFFYNTIIRY 252

Query: 216 DRMIEFRNFYFWYS 229
           +R+ +F   + WY+
Sbjct: 253 NRIPQFNGHFQWYT 266

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/1122 (37%), Positives = 634/1122 (56%), Gaps = 102/1122 (9%)

Query: 50   ENLEKLLYDE--TILNDQEIRFP--LLFEALSVTLFTTKSGKSILQTMKASTSKERKAWE 105
            E LEK+  DE  +  +    RF     +E L++ LFTTK G  IL   K +        +
Sbjct: 90   EYLEKIYRDEDLSTTSYSRPRFEDNFFYELLTIALFTTKPGNKILHFFKNT------GLD 143

Query: 106  KSFENHDSN--------YASIIRSWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLP 157
             + E++DS+        Y  +   WK +D  L   L+FIL N+   + +  Y    YK P
Sbjct: 144  SAIEHNDSDDTLFHSPAYEHLKMLWKWEDEYLHNLLQFILKNRNVDIDLGNYCKTSYKRP 203

Query: 158  LSFLIVSKVN--LPSIILNEGYNMLKDYLYAISGRMEG--LIWCNSTFDQSARIFKGTLQ 213
            L+FL+    N      +L+E +N+L++YLYA    ++    I   ST  +    F  TL 
Sbjct: 204  LTFLLTCPNNNIKHRFLLSEEFNILEEYLYAAQSNIKSKIAIAIQSTIGKHMNFFTMTLH 263

Query: 214  QYDRMIEFRNFYFWYSFSAEKNATPKLNHNINLLMDSYE------------------DNL 255
             YDR+ E+   Y  Y  + ++NA  + + ++  ++  +E                  + +
Sbjct: 264  LYDRVTEYNQSYLRYEITDDENALCQFDESLLDVLLEFERYVTTDDIEAILLQSGRINKV 323

Query: 256  DGVSSVDDAGKSDNHQKQPKDTII--HRTVNDQEQIYSFELNQDGTLQIPNVMEHSLLRH 313
              +SS  + G     Q   +      H+  N++E I SF++N++G  ++PN+M+ S+LRH
Sbjct: 324  KDISSAIERGDYKWEQGTLRSLTPNNHKADNEEEVILSFDINENGLQEVPNIMKDSMLRH 383

Query: 314  ELLFKILNLTP--VLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLGLMYPS 371
             +LF+ L L+    L P LE QF TL GLVDPLTQPTPND HIISID L+ L+ GL++P+
Sbjct: 384  SILFEFLGLSQRNTLAPYLEMQFKTLAGLVDPLTQPTPNDTHIISIDLLHGLYTGLVHPA 443

Query: 372  IKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDTVHWRTQLHIWL 431
            +  S +  N YDWK+   FN+ KI+  ++ +L+C  ++ LN+I N ++   WR  L  W+
Sbjct: 444  LIKSGKARN-YDWKYLCGFNLIKIVWKSLKKLHCSSYDTLNNIGNFEEGNDWRQTLEYWI 502

Query: 432  PHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILLALEIDR 491
            P  LNTQDLELLYMIDIL+VY IYKLYE+ PIQ NPFLF L S+WK ++ +I L L++DR
Sbjct: 503  PKNLNTQDLELLYMIDILSVYAIYKLYEDQPIQNNPFLFELFSVWKYITKIIFLGLQVDR 562

Query: 492  IEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSPYGRKLC 551
            IEE+  + ETPLM+RAT+RGA+A R+ +  +LN  +++N+HDFKHE +NTFMSP+GRKLC
Sbjct: 563  IEEQNDSEETPLMIRATVRGASAFRAALTTILNRQIENNEHDFKHEPINTFMSPHGRKLC 622

Query: 552  HGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNESFSDC 611
             G+LYAD+R  T   +  G  ++D+T+L  DLQ GDRFDED+ YMFDYE EDYN   SD 
Sbjct: 623  SGSLYADMRVSTKIFVENGVELDDITNLLTDLQPGDRFDEDVEYMFDYEYEDYN-LVSDS 681

Query: 612  GD-EELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANASTNNDSIKNEIRSD 670
             D +E  +  + G +           RRCNC+F DDK++ E    ++ ++ S+  ++  +
Sbjct: 682  EDMDEKADNESDGVRPAPIF------RRCNCVFEDDKIMDE----STIDHQSLITDMELE 731

Query: 671  GNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYYSPSYSFIQEP 730
             NA S     +     S   P++VR RS F+F+Y G+DWRD+P+  N+YY+  + F+QE 
Sbjct: 732  NNAISTKDENDKIKIISQPEPFTVRMRSFFDFNYGGKDWRDIPRGENLYYNGEFVFVQEC 791

Query: 731  KLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFTSIGENFEGGD 790
                  +   +     L   ES  L++ VASC++ EQD+M++    S           GD
Sbjct: 792  SSSEFASYFSKAVNSVLDISESNRLIQLVASCIREEQDRMVIYHGMSQLP-----LANGD 846

Query: 791  TGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEMLMCTGYRRILI 850
               +          + T D+IY+  S  + F +MLY + ++A  LMDE+LM  GYRR+LI
Sbjct: 847  VNKS----------KLTVDEIYDQISSSNNFAKMLYQDTELACGLMDELLMIVGYRRVLI 896

Query: 851  WFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQKNENTSGLPF 910
            WFLTH+ +   LI+Y+FEL+MG R     G+A+  +              K  +T    F
Sbjct: 897  WFLTHINITFPLIHYIFELVMGYRVGFSDGDANGDN-------------NKKSSTGKCGF 943

Query: 911  SRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEG-----------EDADKVSLYSLG 959
            SR G + LS IE +MLLQEFF+NA + LS+K+ E  G           ED + +S Y++G
Sbjct: 944  SRLGTVALSSIEKQMLLQEFFLNATVSLSAKSFESNGTEIDNYDDNADEDNEYISSYAVG 1003

Query: 960  LVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKSRLAMEEDG 1019
            +V LIC MV+TL+   +   +KSE T ELQTLL+ WI ++PEAK+LFF +K   A E D 
Sbjct: 1004 IVTLICNMVKTLVRAGQMDVSKSEYTVELQTLLVNWISLIPEAKELFFFLKQE-AHEFD- 1061

Query: 1020 ITDNTVQHKDKTDLDLDSG-KKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLRSFIT 1078
               ++++  ++++L       +P       L+  I +   S+   ++   A+ST    + 
Sbjct: 1062 -IQDSLEPINESELQTSGNINEPAATDSIPLDDTINTSLTSSTKNSNATDALSTFLETVE 1120

Query: 1079 DYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAE 1120
            + S   Q    GR+V++   KILPLP+ ++PIP H     AE
Sbjct: 1121 ETS--VQPPQIGRKVIYKGTKILPLPEQERPIPFHLLFERAE 1160

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/1153 (36%), Positives = 636/1153 (55%), Gaps = 141/1153 (12%)

Query: 34   ISLQELLKDRHYTPSVENLEKLLYDETI----LNDQEIRFPLLFEALSVTLFTTKSGKSI 89
            ++L+++L    Y PSV NL+ LL +  +    L D   R  L  E + +TL  +KSG S+
Sbjct: 3    VTLKDILP--KYRPSVYNLKNLLRNNELVLDMLADVNERNVLASEVVMMTLLCSKSGSSM 60

Query: 90   LQTMKAS--TSKERKAWEKSFENHDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQID 147
            L+   ++  T  + K  E S   +  N A  +R W+ +DVLL+KFL  +L+N+ T ++  
Sbjct: 61   LEYYMSNIDTIDDYKTSENSI--YKKNTALALR-WENNDVLLIKFLTILLSNRKTLIKFT 117

Query: 148  RY---NLPK---YKLPLSFLIVSKVN----LPS-IILNEGYNMLKDYLYAISGRMEGLIW 196
                  L K   +   L FL     +    LP+ I+ +E ++ L+ Y   I  +++ ++ 
Sbjct: 118  TGKDDTLSKNMAFAQDLRFLFNKHYDETSYLPAAIVKSEQFDYLEAYCSIIWPKIKNILL 177

Query: 197  CNSTFDQSAR-----IFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKLNHNINLLMDSY 251
             +   D+  +      F   ++ Y R          Y  SAE      +N   N ++ SY
Sbjct: 178  ESLNIDKQFQDVTNSFFHKIIKLYKRE---------YLVSAE--FLTLINVLTNSVLFSY 226

Query: 252  EDNLDGVSSVDDAGKSDNHQ----KQPKDTIIHRTVNDQEQIYSFE----LNQDGTLQIP 303
                  +  + +   S N+     K P    + +  N       F+    L  D    I 
Sbjct: 227  ------IVMLSEGYISSNYDGLLYKSPPTYNVKQRENMMNSFGEFQSSAMLTNDENNSI- 279

Query: 304  NVMEHSLLRHELLFKIL------NLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISI 357
            ++M+ +  R  +L+K+L       + P    L+   F+ +C LVDPLTQP PND+H+IS+
Sbjct: 280  DLMKLTERRQNILYKVLIFSKLKQIEPESFQLMSLLFNRICALVDPLTQPIPNDEHVISL 339

Query: 358  DFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNT 417
            D LY++FL +M P ++   E  + YDW++ I  N+QKI+    L LNC+  EKLN +   
Sbjct: 340  DLLYKIFLAMMLPHVQVLIERESSYDWRYEISNNLQKILFYAFLNLNCYDMEKLNKV--- 396

Query: 418  DDTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWK 477
            D+T HW+ QLH+WLPHGLN Q+LELLYMI I  VY I+KLYE+ P+  NPFL +LLS WK
Sbjct: 397  DETKHWKEQLHLWLPHGLNPQNLELLYMICIFCVYAIFKLYEDKPLHFNPFLPTLLSTWK 456

Query: 478  NLSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHE 537
             L+ V+L  L++DR EEE  ++ TP+MVRATIRGA+ALRSV+A++LN  +    HDF+HE
Sbjct: 457  KLTYVMLYGLQVDRFEEENESFNTPIMVRATIRGASALRSVVASILNNQMDGKKHDFQHE 516

Query: 538  SLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMF 597
             LNTFMSP+GRKLC GALYADL+S+TAS+LA G   +D+T+L + LQ GD FDED++YMF
Sbjct: 517  PLNTFMSPHGRKLCTGALYADLKSYTASMLACGMEFKDITELLSYLQPGDCFDEDVKYMF 576

Query: 598  DYECEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANAS 657
            +YE +DYNE   D  DE+     NS E  K +    F +RRC C+F+DD ++     N  
Sbjct: 577  EYEYDDYNEPEEDESDEDGERN-NSEENIKFN----FNRRRCRCVFSDDDVLEHGDFN-- 629

Query: 658  TNNDSIKNEIRSDGNAGSNTAITNANHATSSINPYSV--RSRSTFEFDYSGEDWRDVPKD 715
                        D N+  + +  N+N   + + P     + ++  EFD+ G+DWR VP+ 
Sbjct: 630  ------------DANSEYSNSEENSNDVDNFVLPNDGIDKPKNGVEFDFDGKDWRAVPRH 677

Query: 716  FNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADL 775
             N++YS  Y FI+ P   +I +L    +   LS+++S LL+R++AS +K  QD  I   L
Sbjct: 678  LNMFYSFDYIFIENPLEVLIRSLISEASASALSKKKSHLLLRNIASVIKINQDSRI---L 734

Query: 776  GSNFTSIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRL 835
            GS  +  G +      G+++              D+ ++ +    FE +L  N ++   L
Sbjct: 735  GSKRSPNGTDSSKSQNGLST-------------GDLIKLITAGDTFENILKFNRELGCFL 781

Query: 836  MDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEI 895
            MDE+LM  GYRR+L+WFLTHL L H++IYY+FEL+M  R     G+ SD +R+       
Sbjct: 782  MDELLMILGYRRVLLWFLTHLTLSHTIIYYIFELLMHHR-----GQVSDTERE------- 829

Query: 896  LKKKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSK-------------- 941
                   ++     FSRQG + LSD+E +MLLQEFF NA +F SSK              
Sbjct: 830  -------QSELSYTFSRQGELRLSDLEREMLLQEFFTNATMFFSSKSVLFASDTGDNNEI 882

Query: 942  NTEEEGEDADKVSLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPE 1001
            NT+ +GE+    SLY++GL+++ C M+ +L  N  F  + SE  FELQTLLM WI I+PE
Sbjct: 883  NTDVDGEEG-LYSLYAVGLMRVTCIMIISLFDNADFDLSSSESIFELQTLLMGWINIIPE 941

Query: 1002 AKDLFFQIKSRLAMEEDGITDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNP 1061
            AK LFF++K  +    +GI +  ++  +++                + N K+L  FP + 
Sbjct: 942  AKLLFFKLKESVK-SFNGIDNPELKSIEESSTTTKKTTIDENSEQYRFNKKLLKTFPKSF 1000

Query: 1062 TENDDNSAISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAEL 1121
            + +D +  + T + F+ +YSFD++    GR+V++  D+IL L   +KPI LH++++  +L
Sbjct: 1001 SGDDGDILLKTFKDFLRNYSFDSEPPYIGRKVIYESDEILQLTDIEKPISLHKFLSGEQL 1060

Query: 1122 -------DMGDSE 1127
                   D GD E
Sbjct: 1061 YDVDIQFDYGDKE 1073

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  423 bits (1087), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 331/1146 (28%), Positives = 540/1146 (47%), Gaps = 152/1146 (13%)

Query: 53   EKLLYDETILNDQEIRFPLLFEALSVTLFTTKSGKSILQTM--KASTSKERKAWEKSFEN 110
            EK       L D ++   +L E L + LFTT  G++++  +   A  + +    E     
Sbjct: 4    EKSSVQRLFLADSDVDESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRM 63

Query: 111  HDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPS 170
            +D  + ++  +W  D  +L  FL ++L N+T  + ++RY+   +K+ + FL+ ++    +
Sbjct: 64   NDPYWVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFT 123

Query: 171  IILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWY-- 228
              L +  N+L DYL+     +E ++      D S   F   L +Y+R+ EF   Y W+  
Sbjct: 124  APLWDTSNILLDYLHNAKPLIESVL---KKLDGSQ--FLQCLMKYNRLYEFNGSYQWFTP 178

Query: 229  --SFSAEKNATPKLNHN---INLLMDSYEDNLDGVS----------SVDDAGKSDNHQKQ 273
              S S  ++ T  L  N   ++ L +   D +  +S          S++  GK+  H   
Sbjct: 179  PQSTSHAESPTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNP 238

Query: 274  PKDTIIHRTVNDQEQIYSFELNQDGTLQIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQ 333
            P        ++ Q+      LN                R  L FK L L     PLL +Q
Sbjct: 239  P--------LSKQDDHNPLNLNGKSD------------RFNLFFK-LGLHKEPHPLLAEQ 277

Query: 334  FSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQ 393
            F++LC   DP+TQP PND HIIS+D L+ L+LG +   I      N    WK ++  N++
Sbjct: 278  FNSLCLFADPMTQPPPNDSHIISLDLLHDLYLGSLTAYI-VKLIPNYQKVWKIHLSANLE 336

Query: 394  KIIDATMLRLNCFGFEKLNSINNTDDTV--HWRTQLHIWLPHGLNTQDLELLYMIDILAV 451
             I  A +  L  + +  L+++ +        +   +  W+P+ L+  ++E+LYMI  L+ 
Sbjct: 337  TITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSF 396

Query: 452  YTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRG 511
            Y+++K++ + P +LNPFL  +L  W+ LS  ++L L+IDR EE +  Y TP++V A IRG
Sbjct: 397  YSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRG 456

Query: 512  AAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGA 571
            A+ALRS+IA +LNG V    HDFKH+    FMSP+GRKLC+GALY     + A+LL  G 
Sbjct: 457  ASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGM 516

Query: 572  SIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNES-FSDCGDEELGEGVNSGE---KTK 627
              +++ +L  D+Q GDR DED+RYMFDYE  DYN++  S   D +L       E   K +
Sbjct: 517  DYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNR 576

Query: 628  TSIHNGFYQRRCNCIF------------------NDDKLVAEDGANASTNNDSIKNEIRS 669
              +  G Y +RC C F                  N +K V     N   N          
Sbjct: 577  FRMLRGLY-KRCLCKFSDEDDNDDDDDDDDDDDYNGEKSVVGLDENGQINEAETPQTFSE 635

Query: 670  DGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYYSPSYSFIQE 729
              NA + T++     + +        S  T  +D +G+DWRD+P+  N+YY   Y F+ +
Sbjct: 636  SSNAVAFTSLMTHRDSQNDF-----VSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSK 690

Query: 730  PKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFTSIGENFEGG 789
                 +F L  R     ++  ++  ++RS+A+CVK EQ+Q++L  + +            
Sbjct: 691  LDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLITA------------ 738

Query: 790  DTGITSDKTNDEELRRTTPDDIYEIWSEESAFERML---YVNHDVAWRLMDEMLMCTGYR 846
                TS + + + L  +T + I  I++++    +       N  + W++ DE++M  G+R
Sbjct: 739  ----TSAEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHR 794

Query: 847  RILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQKNENTS 906
            R+LI+ LTH     S I+YV+EL+ GLRGNP      +  +   +         + E  +
Sbjct: 795  RLLIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVA 854

Query: 907  GLPFSRQGPIVLSDIETKMLLQEFFM----------NAAIF--LSSKN-----TEEEGED 949
             + FSRQG I LS IE KMLLQEFF+          N A F   S KN      ++ GE+
Sbjct: 855  AIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEE 914

Query: 950  ---ADKVSLYSLGLVKLICYMVQTLIANDKFFFTKSE-CTFELQTLLMTWIGILPEAKDL 1005
               A        G VK++C++++ ++ + +F F   E   +EL+  LM W     EA  +
Sbjct: 915  FFSATSRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSM 974

Query: 1006 FFQIKSR-----LAMEEDGITDNTVQHKD----------------------KTDLDLDSG 1038
            +  +KS+     L +  +G+ D      D                      +TD  +++G
Sbjct: 975  YALLKSKALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETDTSIENG 1034

Query: 1039 KKPNTKSISKLNMKILSLFPSNPTENDDNSAI-STLRSFITDYSFDTQVVAPGRRVVFHD 1097
             K  T  +S+   ++L      P ++ D   +    R  +  Y         GR  + + 
Sbjct: 1035 DK--TSIMSERFSRML------PVQSLDGQPVDKVFRHLLQKYPLTEGTPIHGRITLEYH 1086

Query: 1098 DKILPL 1103
            D ILPL
Sbjct: 1087 DHILPL 1092

>Ecym_4206 Chr4 (426316..431949) [5634 bp, 1877 aa] {ON} similar to
           Ashbya gossypii AGL147C
          Length = 1877

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 261 VDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTLQIPNVME 307
           + D   S +HQK+   +II R  ND   +  F LN D    +PNVME
Sbjct: 542 ISDLKTSTSHQKRYFLSIIQRLCNDPRTLIEFYLNYDCASNMPNVME 588

>KLLA0D17358g Chr4 complement(1477523..1483069) [5547 bp, 1848 aa]
           {ON} similar to uniprot|P11075 Saccharomyces cerevisiae
           YDR170C SEC7 Guanine nucleotide exchange factor (GEF)
           for ADP ribosylation factors involved in proliferation
           of the Golgi intra-Golgi transport and ER-to-Golgi
           transport found in the cytoplasm and on Golgi-associated
           coated vesicles
          Length = 1848

 Score = 36.2 bits (82), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 261 VDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTLQIPNVME 307
           + D   S NHQK+   +II R  ND   +  F LN D    +PNV+E
Sbjct: 486 IADLKSSTNHQKRYFLSIIQRVCNDPRTLIEFYLNYDCDSHMPNVVE 532

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 66/154 (42%), Gaps = 10/154 (6%)

Query: 620 VNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANASTNNDSIKNEIRSDGNAGSNTAI 679
           +N+G K   S+   F+  R + +FN+D     D  +++   +   + +R+  +  +NT  
Sbjct: 558 INNGRKN--SVVTQFFNNRQHAVFNEDCHFMNDSLHSAEGANMFNSNLRTKQDPMNNTNN 615

Query: 680 TNANHATSSINPYSVRSRS-TFEFDYSGEDWRDVPKDFNIYYSPSYSFIQEPKLDI---- 734
                 T  I  Y + S S + E   + E+     K F I +   + FI    ++I    
Sbjct: 616 IKYPEFTEEIRTYIISSNSLSGELFPTVEELNSYTKLFIIKFHSLFQFIHIRSIEIKPDN 675

Query: 735 ---IFNLTLRGATEKLSREESVLLVRSVASCVKN 765
              I +LT+ GA        ++LL R   + +KN
Sbjct: 676 YTFILSLTVIGALHSFHSTHAMLLSRICWTQIKN 709

>TPHA0C00870 Chr3 (181654..186714) [5061 bp, 1686 aa] {ON} Anc_8.313
           YDR141C
          Length = 1686

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 739 TLRGATEKLSREESVLLVRSVASCVKNEQDQMI 771
           TL   TE L +EE  LL+R+  SC+K E D +I
Sbjct: 261 TLLPGTEDLVKEEPGLLIRAFVSCMKQENDILI 293

>Smik_12.60 Chr12 (130182..133022) [2841 bp, 946 aa] {ON} YLL003W
           (REAL)
          Length = 946

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 145 QIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNMLKD-YLYAISGRMEGLIWCNSTFDQ 203
           QI+ + L  +KL  SFL++ K N  SI++ EG+N L D Y   +   ++G+   NS  ++
Sbjct: 119 QIEAF-LVHFKLSRSFLLIFK-NYVSILIQEGFNPLHDEYFRILEDELKGIFTFNSVIEE 176

Query: 204 SARIF 208
              IF
Sbjct: 177 ILEIF 181

>Kwal_14.1186 s14 complement(233250..235595) [2346 bp, 781 aa] {ON}
           YLR057W - Hypothetical ORF [contig 244] FULL
          Length = 781

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 10/104 (9%)

Query: 21  NDSLGNVHRYA-QFISLQELLKDRHYTPSVENLEKLLYDETILNDQEIRFPLLFEALSVT 79
           + SLG +   + +F+ L +L KD  YT + E++ K  +D   L D +   P + +A    
Sbjct: 321 DSSLGQLGSVSLEFLRLSQLTKDEKYTRAAEHIYKTAFDSIGLFDIDYLLPTVIDA---- 376

Query: 80  LFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIRSWK 123
                SG  +L   +  + K  + +E     HD  Y   +++ K
Sbjct: 377 -----SGCVLLPKEQVHSGKHAQGYEVMKTIHDKKYVHCLQTNK 415

>ZYRO0F14432g Chr6 complement(1185443..1191235) [5793 bp, 1930 aa]
           {ON} similar to uniprot|P11075 Saccharomyces cerevisiae
           YDR170C SEC7 Guanine nucleotide exchange factor (GEF)
           for ADP ribosylation factors involved in proliferation
           of the Golgi intra-Golgi transport and ER-to-Golgi
           transport found in the cytoplasm and on Golgi-associated
           coated vesicles
          Length = 1930

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 261 VDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTLQIPNVME 307
           + D   S  HQK+   ++I R  ND   +  F LN D    +PN+ME
Sbjct: 521 ISDLKTSTPHQKRYFLSVIQRLCNDPRTLIEFYLNYDCNQGMPNIME 567

>SAKL0H14520g Chr8 (1256509..1262025) [5517 bp, 1838 aa] {ON}
           similar to uniprot|P11075 Saccharomyces cerevisiae
           YDR170C SEC7 Guanine nucleotide exchange factor (GEF)
           for ADP ribosylation factors involved in proliferation
           of the Golgi intra-Golgi transport and ER-to-Golgi
           transport found in the cytoplasm and on Golgi-associated
           coated vesicles
          Length = 1838

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 261 VDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTLQIPNVME 307
           + D   S  HQK+   +I+ R  ND   +  F LN D   ++PNV+E
Sbjct: 493 ISDLKTSTAHQKRYFLSIVQRLCNDPRTLIEFYLNYDCDSRMPNVVE 539

>Kwal_23.3401 s23 (272950..278337) [5388 bp, 1795 aa] {ON} YDR170C
           (SEC7) - Guanine nucleotide exchange protein for ARF
           [contig 252] FULL
          Length = 1795

 Score = 32.7 bits (73), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%)

Query: 261 VDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTLQIPNVME 307
           + D   S  HQK+   +++ R  ND   +  F LN D    +PNV+E
Sbjct: 461 ITDLKSSTAHQKRYFLSVMQRVCNDPRTLIEFYLNYDCDTHLPNVVE 507

>TPHA0C00530 Chr3 (94676..100456) [5781 bp, 1926 aa] {ON} Anc_8.368
           YDR170C
          Length = 1926

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 267 SDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTLQIPNVME 307
           S NHQK+    ++ R  ND   +  F LN D    +PN+ME
Sbjct: 575 STNHQKRYFLYVVQRICNDPRTLIEFYLNYDCNQGMPNLME 615

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 131,496,364
Number of extensions: 6356272
Number of successful extensions: 23316
Number of sequences better than 10.0: 74
Number of HSP's gapped: 23846
Number of HSP's successfully gapped: 79
Length of query: 1127
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1007
Effective length of database: 39,721,479
Effective search space: 39999529353
Effective search space used: 39999529353
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)