Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.4213.495ON1651658851e-123
Smik_6.2293.495ON1651647291e-99
YGR133W (PEX4)3.495ON1831657111e-96
Skud_7.4443.495ON1621626986e-95
CAGL0I10450g3.495ON1621644225e-53
NDAI0G009103.495ON1631584095e-51
TPHA0D042603.495ON1581584001e-49
NCAS0E007803.495ON1711624011e-49
SAKL0F02706g3.495ON1611603973e-49
ZYRO0D09878g3.495ON1531563912e-48
KLTH0F14894g3.495ON1661613871e-47
Kwal_55.212463.495ON1601613801e-46
TDEL0D056303.495ON1501563731e-45
Kpol_480.133.495ON1571583731e-45
Ecym_12343.495ON1611583401e-40
TBLA0C045003.495ON1651593342e-39
KNAG0B007803.495ON1531563322e-39
AFR314W3.495ON1551613271e-38
KAFR0C019903.495ON1511603001e-34
KLLA0E04027g3.495ON1581602627e-29
KNAG0A048108.375ON2141632066e-20
NDAI0A011608.375ON2161362032e-19
TBLA0H031308.375ON2141362022e-19
ZYRO0D04466g7.54ON1591041983e-19
CAGL0E00671g8.375ON2131362013e-19
TDEL0H039707.54ON1561131974e-19
Suva_2.3438.375ON2151631996e-19
Smik_4.4258.375ON2151631996e-19
Skud_4.4418.375ON2151631997e-19
ZYRO0C03784g8.375ON2181361997e-19
TPHA0L008508.375ON2161631997e-19
YDR177W (UBC1)8.375ON2151631998e-19
Kpol_1030.108.375ON2151631971e-18
SAKL0A00396g8.375ON2151471953e-18
Ecym_60388.375ON2111631943e-18
NCAS0B031508.375ON2141631944e-18
NDAI0E038707.54ON1641131914e-18
Smik_15.5177.54ON1561011896e-18
Kpol_1065.127.54ON1591151897e-18
Smik_4.2973.308ON1481151871e-17
NDAI0D011401.436ON2451211921e-17
CAGL0M03399g1.436ON2141291901e-17
Suva_2.2183.308ON1481151862e-17
Skud_4.3143.308ON1481151862e-17
YDR059C (UBC5)3.308ON1481151862e-17
ADR169C8.375ON2111351902e-17
Suva_8.3897.54ON1561041862e-17
KLTH0A07546g8.375ON2151361892e-17
Skud_15.5047.54ON1561011843e-17
KAFR0B060608.375ON2131631865e-17
Kwal_23.64858.375ON2151361866e-17
Kpol_1030.181.436ON2231191858e-17
Kwal_14.18286.109ON152991819e-17
KLLA0C18656g8.375ON2281351851e-16
KAFR0C002703.308ON1471511782e-16
Suva_5.531.436ON2151261822e-16
NCAS0D032206.109ON171991792e-16
KLTH0H06732g6.109ON160991792e-16
TBLA0A012901.436ON2191191813e-16
Ecym_74313.308ON1471531773e-16
KLTH0E14300g3.308ON1471531773e-16
SAKL0B06512g3.308ON1471531773e-16
AER173C3.308ON1471531773e-16
KNAG0H018701.436ON2101181803e-16
TPHA0J017506.109ON169991784e-16
Kpol_461.86.109ON167991784e-16
ZYRO0C04950g6.109ON168991784e-16
TDEL0B056701.436ON2031191804e-16
TDEL0G036106.109ON169991784e-16
TDEL0F049908.375ON2171361804e-16
YGL058W (RAD6)6.109ON172991784e-16
Smik_7.2226.109ON171991784e-16
KNAG0F025706.109ON151991764e-16
AAR156C6.109ON170991774e-16
Suva_7.2136.109ON173991784e-16
KLLA0A11198g1.436ON2021211794e-16
Suva_4.3263.308ON1481151764e-16
SAKL0A07260g6.109ON169991774e-16
Smik_5.981.436ON2151181804e-16
Ecym_30776.109ON170991775e-16
YEL012W (UBC8)1.436ON2181181805e-16
CAGL0I00352g6.109ON167991775e-16
KLLA0C05632g6.109ON164991766e-16
TBLA0F024406.109ON1741411776e-16
AEL045W1.436ON2111281787e-16
KAFR0A047006.109ON153991757e-16
CAGL0E04752g3.308ON1471151748e-16
SAKL0D10560g1.436ON2071261788e-16
KNAG0J023403.308ON1611151759e-16
Skud_2.2073.308ON1481151749e-16
Smik_2.2193.308ON1481151749e-16
YBR082C (UBC4)3.308ON1481151749e-16
Ecym_13481.436ON2111171789e-16
NCAS0A108003.308ON1481151741e-15
YOR339C (UBC11)7.54ON1561041741e-15
NDAI0A054903.308ON1471151731e-15
TPHA0O009201.436ON2261191781e-15
TBLA0I021303.308ON1481531731e-15
NCAS0G031301.436ON2311181781e-15
Skud_5.871.436ON2101181771e-15
KAFR0H029601.436ON1871191751e-15
KLTH0H13816g1.436ON2331291781e-15
TDEL0F021003.308ON1471531721e-15
Kpol_1052.23.308ON1481531712e-15
TPHA0A038503.308ON1481531713e-15
ZYRO0G12870g3.308ON1471501703e-15
NDAI0I016506.109ON176991723e-15
ZYRO0E03806g1.436ON2091191733e-15
Kwal_34.161741.436ON2131211734e-15
Kwal_27.124013.308ON2361151744e-15
Skud_7.2226.109ON170991705e-15
KLLA0E12563g3.308ON1481531686e-15
SAKL0B10582g7.54ON1611131696e-15
TPHA0I024602.569ON1671521697e-15
TDEL0B065702.569ON1651461652e-14
AGR121C8.230ON1541321634e-14
KLTH0D01760g7.54ON1611131636e-14
ZYRO0B11682g8.230ON1511311617e-14
Kwal_56.234828.230ON1491011617e-14
SAKL0D13552g2.569ON1651451611e-13
KLLA0C17622g8.230ON1591311601e-13
KLTH0G14366g8.230ON1491011591e-13
ZYRO0E06358g2.569ON1651451601e-13
TDEL0A013408.230ON1571011601e-13
KLLA0E07745g2.569ON1651451602e-13
NCAS0A059404.49ON1931371612e-13
Kpol_1075.1b8.230ON1521391592e-13
Kpol_1056.52.569ON1651451592e-13
KAFR0A024208.230ON1471151582e-13
Suva_2.2538.230ON1431151572e-13
SAKL0H17930g8.230ON1531311582e-13
YDR092W (UBC13)8.230ON1531311573e-13
Ecym_55638.230ON1641311574e-13
KAFR0A021602.569ON1651491574e-13
Kwal_26.70097.54ON1611041564e-13
Kwal_26.82242.569ON1651491565e-13
KLTH0D07986g2.569ON1651451566e-13
Kpol_483.164.249ON122941536e-13
KNAG0M021502.569ON1701451567e-13
Skud_4.3528.230ON1431151538e-13
NDAI0B015202.569ON1651451558e-13
Smik_4.3358.230ON1431151538e-13
CAGL0G08063g8.230ON1491011549e-13
TBLA0H026102.569ON1651471549e-13
TPHA0B034108.230ON1521311521e-12
NCAS0B040108.230ON1531011512e-12
SAKL0H03058g4.249ON157941522e-12
NDAI0J015408.230ON1541311512e-12
CAGL0D00814g4.249ON1571001513e-12
Ecym_45782.569ON1651451513e-12
Kwal_23.42274.249ON122941474e-12
KNAG0H029808.230ON1521161494e-12
ABR059W2.569ON1651451495e-12
Smik_13.1862.569ON1651491496e-12
Suva_13.1892.569ON1651491496e-12
KAFR0H012303.308ON1101051456e-12
KLTH0D14344g4.249ON1571001487e-12
YMR022W (UBC7)2.569ON1651491487e-12
YGL087C (MMS2)6.187ON1371121477e-12
NCAS0A127402.569ON1651451487e-12
Skud_13.1762.569ON1651491488e-12
Suva_7.1826.187ON1371121451e-11
TBLA0F037908.230ON1511011452e-11
YDL064W (UBC9)4.249ON157941442e-11
KLLA0E05039g4.249ON1571031442e-11
CAGL0M07568g2.569ON1651491443e-11
Smik_12.3894.49ON1871301453e-11
Ecym_32704.249ON157941433e-11
Smik_4.1714.249ON157941433e-11
Suva_4.1864.249ON157941434e-11
TDEL0E012204.249ON1571001434e-11
TPHA0B007704.249ON1571331424e-11
ZYRO0B12386g4.249ON157941426e-11
KLLA0E19119g6.187ON1391071407e-11
Skud_4.1914.249ON157941401e-10
Skud_12.3894.49ON1871311401e-10
TBLA0I029604.249ON1571041363e-10
CAGL0D06468g4.49ON1871161383e-10
AER056C4.249ON157941364e-10
YLR306W (UBC12)4.49ON1881251357e-10
NDAI0D043804.249ON1571031331e-09
TBLA0E015704.49ON1941041331e-09
KNAG0D043904.249ON1571001312e-09
NCAS0A024904.249ON1571001312e-09
KNAG0I029404.49ON1971081323e-09
KAFR0G032404.249ON1571041293e-09
Suva_10.4014.49ON1871331313e-09
KLTH0H04796g6.187ON1381071259e-09
Smik_7.1966.187ON100671231e-08
TDEL0G015806.187ON1381131232e-08
KAFR0F030404.49ON1691191233e-08
SAKL0H24112g4.49ON1851071234e-08
CAGL0H03157g6.187ON1391421198e-08
Skud_7.1956.187ON100671169e-08
Ecym_22306.187ON1381071189e-08
Kpol_414.2singletonOFF1921141201e-07
Kpol_YGOB_414.24.49ON1931141201e-07
AFL064W6.187ON1381071162e-07
NCAS0D036606.187ON1381071152e-07
TPHA0J022506.187ON1371061153e-07
ZYRO0G08228g6.187ON1381131153e-07
Ecym_83714.49ON2671001183e-07
Kwal_27.111826.187ON101741123e-07
TPHA0F003904.49ON1931191164e-07
KLTH0H09504g4.49ON184911164e-07
TDEL0E055604.49ON1871071155e-07
KAFR0C021406.187ON1381071128e-07
ADL035C4.49ON200841148e-07
KNAG0F021306.187ON1381071101e-06
TBLA0A019006.187ON1391071074e-06
ZYRO0G19910g4.49ON179841075e-06
TPHA0M012803.301ON4351181096e-06
SAKL0A05192g6.187ON140721032e-05
KLLA0E20395g7.392ON2511241052e-05
Kpol_1065.453.301ON3231291062e-05
KLLA0C17248g4.49ON184781042e-05
NDAI0D029104.49ON189971042e-05
NDAI0A016507.392ON2511241016e-05
KAFR0H012703.301ON2871141017e-05
NCAS0A143907.392ON2401241008e-05
CAGL0E04598g3.301ON2951281009e-05
TBLA0G032703.301ON3301141001e-04
TBLA0D006007.392ON256124991e-04
KAFR0L017507.392ON25177991e-04
KNAG0B023607.392ON251115991e-04
Kpol_1045.397.392ON253124981e-04
NCAS0A107703.301ON273114991e-04
CAGL0I05478g7.392ON246124982e-04
KLLA0D09196g3.301ON29298982e-04
Skud_5.2257.392ON250124982e-04
YER100W (UBC6)7.392ON250124972e-04
Suva_5.2197.392ON249124972e-04
NDAI0A055303.301ON273128972e-04
ZYRO0B03344g7.392ON250124972e-04
Skud_4.3063.301ON297114972e-04
Smik_5.2467.392ON250124962e-04
KNAG0H010403.301ON296112973e-04
NDAI0I012306.187ON15772943e-04
AGR372W7.392ON242124963e-04
TDEL0D032603.301ON289114963e-04
Smik_4.2903.301ON297114963e-04
Kpol_1002.656.187ON10168923e-04
Ecym_46837.392ON243123953e-04
YDR054C (CDC34)3.301ON295114964e-04
TDEL0C015507.392ON248124954e-04
AGL203C3.301ON270114954e-04
Suva_2.2113.301ON29789946e-04
TPHA0K008207.392ON257124946e-04
SAKL0D02530g3.301ON272114946e-04
ZYRO0G12650g3.301ON285114947e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.421
         (165 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   345   e-123
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   285   1e-99
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   278   1e-96
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   273   6e-95
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   167   5e-53
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   162   5e-51
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   158   1e-49
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   159   1e-49
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   157   3e-49
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   155   2e-48
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   153   1e-47
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   150   1e-46
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   148   1e-45
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   148   1e-45
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   135   1e-40
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   133   2e-39
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   132   2e-39
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   130   1e-38
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   120   1e-34
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   105   7e-29
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    84   6e-20
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      83   2e-19
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    82   2e-19
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    81   3e-19
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    82   3e-19
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    80   4e-19
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    81   6e-19
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    81   6e-19
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    81   7e-19
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    81   7e-19
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    81   7e-19
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    81   8e-19
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    80   1e-18
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    80   3e-18
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    79   3e-18
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      79   4e-18
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    78   4e-18
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    77   6e-18
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    77   7e-18
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    77   1e-17
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    79   1e-17
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    78   1e-17
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    76   2e-17
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    76   2e-17
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    76   2e-17
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    78   2e-17
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    76   2e-17
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    77   2e-17
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    75   3e-17
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    76   5e-17
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    76   6e-17
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    76   8e-17
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    74   9e-17
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    76   1e-16
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    73   2e-16
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    75   2e-16
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      74   2e-16
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    74   2e-16
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    74   3e-16
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    73   3e-16
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    73   3e-16
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    73   3e-16
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    73   3e-16
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    74   3e-16
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    73   4e-16
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    73   4e-16
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    73   4e-16
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    74   4e-16
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    73   4e-16
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    74   4e-16
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    73   4e-16
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    73   4e-16
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    72   4e-16
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    73   4e-16
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    73   4e-16
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    74   4e-16
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    72   4e-16
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    73   4e-16
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    74   4e-16
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    73   5e-16
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    74   5e-16
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    73   5e-16
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    72   6e-16
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    73   6e-16
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    73   7e-16
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    72   7e-16
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    72   8e-16
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    73   8e-16
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    72   9e-16
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    72   9e-16
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    72   9e-16
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    72   9e-16
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    73   9e-16
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    72   1e-15
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    72   1e-15
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    71   1e-15
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    73   1e-15
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    71   1e-15
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                73   1e-15
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    73   1e-15
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    72   1e-15
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    73   1e-15
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    71   1e-15
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    70   2e-15
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    70   3e-15
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    70   3e-15
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      71   3e-15
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    71   3e-15
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    71   4e-15
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    72   4e-15
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    70   5e-15
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    69   6e-15
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    70   6e-15
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    70   7e-15
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    68   2e-14
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    67   4e-14
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    67   6e-14
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    67   7e-14
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    67   7e-14
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    67   1e-13
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    66   1e-13
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    66   1e-13
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    66   1e-13
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    66   1e-13
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    66   2e-13
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     67   2e-13
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    66   2e-13
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    66   2e-13
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    65   2e-13
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    65   2e-13
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    65   2e-13
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    65   3e-13
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    65   4e-13
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    65   4e-13
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    65   4e-13
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    65   5e-13
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    65   6e-13
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    64   6e-13
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    65   7e-13
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    64   8e-13
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    64   8e-13
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    64   8e-13
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    64   9e-13
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    64   9e-13
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    63   1e-12
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    63   2e-12
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    63   2e-12
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    63   2e-12
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    63   3e-12
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    63   3e-12
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    61   4e-12
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    62   4e-12
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    62   5e-12
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    62   6e-12
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    62   6e-12
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    60   6e-12
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    62   7e-12
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    62   7e-12
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    61   7e-12
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    62   7e-12
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    62   8e-12
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    60   1e-11
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    60   2e-11
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    60   2e-11
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    60   2e-11
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    60   3e-11
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    60   3e-11
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    60   3e-11
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    60   3e-11
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    60   4e-11
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    60   4e-11
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    59   4e-11
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    59   6e-11
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    59   7e-11
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    59   1e-10
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    59   1e-10
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    57   3e-10
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    58   3e-10
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    57   4e-10
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    57   7e-10
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    56   1e-09
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    56   1e-09
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    55   2e-09
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    55   2e-09
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    55   3e-09
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    54   3e-09
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    55   3e-09
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    53   9e-09
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    52   1e-08
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    52   2e-08
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    52   3e-08
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    52   4e-08
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    50   8e-08
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    49   9e-08
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    50   9e-08
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    51   1e-07
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    51   1e-07
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    49   2e-07
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    49   2e-07
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    49   3e-07
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    49   3e-07
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    50   3e-07
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    48   3e-07
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    49   4e-07
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    49   4e-07
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    49   5e-07
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    48   8e-07
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    49   8e-07
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    47   1e-06
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    46   4e-06
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    46   5e-06
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    47   6e-06
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    44   2e-05
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    45   2e-05
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    45   2e-05
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    45   2e-05
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       45   2e-05
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    44   6e-05
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                44   7e-05
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    43   8e-05
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    43   9e-05
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    43   1e-04
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    43   1e-04
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    43   1e-04
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    43   1e-04
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    42   1e-04
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    43   1e-04
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    42   2e-04
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    42   2e-04
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    42   2e-04
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    42   2e-04
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    42   2e-04
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    42   2e-04
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    42   2e-04
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    42   2e-04
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    42   2e-04
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                42   3e-04
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    41   3e-04
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    42   3e-04
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    42   3e-04
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    42   3e-04
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    40   3e-04
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    41   3e-04
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    42   4e-04
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    41   4e-04
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    41   4e-04
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    41   6e-04
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    41   6e-04
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    41   6e-04
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    41   7e-04
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    40   7e-04
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    40   8e-04
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    40   9e-04
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    40   0.001
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    40   0.001
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    39   0.003
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                38   0.005
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    38   0.005
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    37   0.009
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    37   0.009
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    36   0.023
Kpol_479.29 s479 (55952..57760) [1809 bp, 602 aa] {ON} (55952..5...    35   0.091
TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON} Anc_4...    32   1.0  
TBLA0C01460 Chr3 (337725..339455) [1731 bp, 576 aa] {ON} Anc_1.4...    30   2.8  
Kpol_1042.13 s1042 complement(25499..29014) [3516 bp, 1171 aa] {...    30   3.0  
KLLA0F14663g Chr6 complement(1358439..1360451) [2013 bp, 670 aa]...    29   4.9  
CAGL0F08481g Chr6 (846289..848394) [2106 bp, 701 aa] {ON} simila...    29   6.4  
KLTH0H00902g Chr8 complement(97752..99944) [2193 bp, 730 aa] {ON...    29   8.1  
Kpol_388.7 s388 complement(21113..22111,22115..23260) [2145 bp, ...    28   8.3  

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  345 bits (885), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 165/165 (100%), Positives = 165/165 (100%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
           RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW
Sbjct: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT 165
           RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT 165

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  285 bits (729), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 134/164 (81%), Positives = 146/164 (89%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MSRITKEYR+I KTLASDDP VNPYRGII SLNP DETDLS+WEA I GP HTPYE YQF
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
            +LIDVP SYPM PP+I FE++ ILHCN+ S+TGEICLDILK +DWTPVWDLLHCVHAVW
Sbjct: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNH 164
           RLLREPVCDSPLDVDMGNIIRC D+ AYQGIVKYFLAERER+ +
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSRY 164

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  278 bits (711), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 145/165 (87%), Gaps = 1/165 (0%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MSRI KEY++I KTLASDDP  NPYRGIIESLNP DETDLSKWEA I GP  TPYE +QF
Sbjct: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
           R+LI+VP SYPM PPKI F ++ ILHCN+ S+TGEICL+ILK ++WTPVWDLLHCVHAVW
Sbjct: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERER-NNH 164
           RLLREPVCDSPLDVD+GNIIRCGD  AYQGIVKYFLAERER NNH
Sbjct: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERINNH 183

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  273 bits (698), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 143/162 (88%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MSRI KEY  I+KTLAS+DP VNPY+G+IESLNP DETDLSKWEA I GP HTPYE Y+F
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
           R+LIDVP SYPMAPP I F+++ ILHCNI S TGEICLDILK +DWTPVWDLLHCVHA+W
Sbjct: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERN 162
           RLL+EPV DSPLDVDMGNIIRCGD  AYQGI++YFLAER+RN
Sbjct: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDRN 162

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  167 bits (422), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 106/164 (64%), Gaps = 12/164 (7%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           M+RI+KE   IRK L   D         +  L P D++DLS+W A I GP  TPY  Y+F
Sbjct: 1   MARISKELLKIRKALEHGD------SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEF 54

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAIL------HCNINSSTGEICLDILKLQDWTPVWDLLH 114
           ++ I+VP SYPM PP I F  DA        HCN++  TGEICLDILK + W+P+WD+LH
Sbjct: 55  KLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILH 114

Query: 115 CVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAE 158
            V A+  LL+EPV DSPLDVDM NI++  D  AY GI++YFL E
Sbjct: 115 VVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  162 bits (409), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 108/158 (68%), Gaps = 2/158 (1%)

Query: 1   MSRITKEYRLIRKTLASD-DPTVNPYRGIIESLNPTD-ETDLSKWEATICGPEHTPYERY 58
           MSRI KEY+ I+K L ++ +   + +  II SL P D + DL+KWEA I GP+ TPY  +
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60

Query: 59  QFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHA 118
            F + I +P  YP  PP   F+  ++ HCN+N +TGEICLDILK   WTPVW+L+  + A
Sbjct: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120

Query: 119 VWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           +W LL++PV +SPL+VD+ N++R GD  AY G++ Y+L
Sbjct: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYL 158

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  158 bits (400), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 106/158 (67%), Gaps = 7/158 (4%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + R+ KE RLI K L+        Y   IE L P    +  KW A + GP +TPY ++ F
Sbjct: 3   LKRLLKEKRLIEKELSG-------YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSF 55

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
           ++LI++P  YP+ PP I FE  ++ HCN+  STG+ICL+IL+ + W+PVW+L++ + A++
Sbjct: 56  KLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY 115

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAE 158
           +LL+EPV DSPL++D+ NI+R GD  AY G++ Y+L E
Sbjct: 116 QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  159 bits (401), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 109/162 (67%), Gaps = 5/162 (3%)

Query: 1   MSRITKEYRLIRKTLASDDPTVN-----PYRGIIESLNPTDETDLSKWEATICGPEHTPY 55
           MSR+ KEY+ I+ TL+ +    N      +  II  L+P   +DL+ W+A I GP+ TPY
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60

Query: 56  ERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHC 115
             ++F++ I+ P +YP+ PP I F+  ++ HCN+N  TG ICLDIL+ Q WTP W+L+  
Sbjct: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120

Query: 116 VHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLA 157
           + A+W LL++PV DSPL+VD+ NI+R  D+ AY G++ Y+L+
Sbjct: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  157 bits (397), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 108/160 (67%), Gaps = 8/160 (5%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + RITKE++ +RKTLA +DP+ N     I  L P D  ++  W A I GP  TPY    F
Sbjct: 3   LQRITKEFKSVRKTLA-EDPSYNH----ILKLEPKDTGNMYHWIADISGPPETPYASAVF 57

Query: 61  RMLIDVPDSYPMAPPKIMF---EKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVH 117
            + +++P  YP+ PP++ F    ++ I HCN++  TGEICLDIL  + W+PVWDL+H +H
Sbjct: 58  ALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIH 117

Query: 118 AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLA 157
           A+W LL EPV +SPL+VD+ N+++ GD  AY+G++KY++ 
Sbjct: 118 AIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  155 bits (391), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 99/156 (63%), Gaps = 5/156 (3%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MSR  KEY+ I K L   D     Y  +I  + P +  DL++WEA I GP  TPYE   F
Sbjct: 1   MSRAAKEYKTITKVLKEGDEV---YSQLIVGMEPKE--DLTRWEALIRGPSGTPYEGCNF 55

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
           R+ + +P  YPM+PP + FE  A+ H N++  TGEICLDIL  Q W+P WDLLH V A+ 
Sbjct: 56  RLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIG 115

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           +LL EPV  SPL+VD+ NI++  D  AY G+V Y++
Sbjct: 116 QLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  153 bits (387), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 98/161 (60%), Gaps = 5/161 (3%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+ KEYR + KTL  D     P    I SL P  E +L KWE+ I GP  TPY  ++F +
Sbjct: 4   RLAKEYRALSKTLGRD-----PEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTL 58

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+  ++YP+ PPK+ F+   + HCN++  +G ICL +L    WTP WDLLH VHA+W L
Sbjct: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLL 118

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNN 163
           L  P  DSPLDVD+  ++R GD+ A+  ++ Y+L    R +
Sbjct: 119 LASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRGH 159

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  150 bits (380), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 98/161 (60%), Gaps = 5/161 (3%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+ KEY+ + KTL  D     P    I  L P  + +L  WEA I GP  TPY+ ++F +
Sbjct: 4   RLAKEYKTLLKTLKED-----PAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSL 58

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
           LI +P +YP+ PPK+ F    + HCN++  +G IC+++L+   W+P WDLLH VHA+W L
Sbjct: 59  LITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLL 118

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNN 163
           L  P  DSPLDVD+  + R GD  A+ G+V Y+L    R +
Sbjct: 119 LANPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRGS 159

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  148 bits (373), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 100/156 (64%), Gaps = 8/156 (5%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           M+RI +EY+ I+ TL S+         ++ SL P D  DLS+W   I GP  TPYE + F
Sbjct: 1   MARIAREYKHIQATLGSES-------SLVVSLEPID-GDLSRWAGEIRGPTGTPYEGHTF 52

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
            + + + D YP  PP++ F + ++ HCN+N  TG ICL+IL  + W+P WDLLH + A+ 
Sbjct: 53  SLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAII 112

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           +LL +P  DSPLD+D+ NI+R  D+ AY G+V Y+L
Sbjct: 113 QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  148 bits (373), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 102/158 (64%), Gaps = 7/158 (4%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+ KEY++++K L +       ++ II SL P D  DL+ W ATI GP +TPY  + F +
Sbjct: 5   RLLKEYQVVKKELGN-------HKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDL 57

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I +   YP+ PP++ F    + HCNI   TG+ICL+IL   +W+PVW+LL  V A+++L
Sbjct: 58  RIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQL 117

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERE 160
           L +PV DSPL++D+ NI++  D  AY G+++Y+L  + 
Sbjct: 118 LSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  135 bits (340), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 71/158 (44%), Positives = 95/158 (60%), Gaps = 8/158 (5%)

Query: 2   SRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFR 61
           SR+  EY+ IR+ L S       +  I+      D   LSKWEA  CGPE+TPY  + F 
Sbjct: 10  SRMLAEYKQIREQLQS-------HESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFT 62

Query: 62  MLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWR 121
           + I++P+ YP  PP   F  + I H NI  STGE+CLD+LK + W+P+++LL  V A+  
Sbjct: 63  LSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRT 122

Query: 122 LLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAER 159
           LL EP  DSPLDVD+  +    DK+AYQG+V Y L  R
Sbjct: 123 LLAEPGVDSPLDVDLAKLYSV-DKQAYQGLVTYRLCSR 159

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  133 bits (334), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 68/159 (42%), Positives = 98/159 (61%), Gaps = 11/159 (6%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDE--TDLSKWEATICGPEHTPYERY 58
           MSRI KEY  IRK  A  D         + +L+P     +DLS W + I GP+ +PY   
Sbjct: 1   MSRIIKEYNHIRKLNALPDN--------MTTLHPVSNATSDLSNWHSIILGPKDSPYHNK 52

Query: 59  QFRMLIDVPDSYPMAPPKIMFEKDAIL-HCNINSSTGEICLDILKLQDWTPVWDLLHCVH 117
            F + I +P  YP  PP I F K++I  HCN+N +TGEICL+ILK ++W+PVW+LL+ V 
Sbjct: 53  SFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQ 112

Query: 118 AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           A+ +LL  P   SPL++D+  ++   D +AY  ++KY+L
Sbjct: 113 AIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  132 bits (332), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 96/156 (61%), Gaps = 12/156 (7%)

Query: 3   RITKEYR-LIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFR 61
           R+ +EYR L+    A+++           +L+PTD  DL+ WEAT+ GP+ TPYE + F 
Sbjct: 4   RVLREYRRLVAAGGAANE----------SNLHPTDPADLTHWEATLEGPQGTPYEGHSFP 53

Query: 62  MLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWR 121
           + + VPD YP  PP + F K  + H N+   TGE+CLD L    WTPV DL + V AV R
Sbjct: 54  LRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRR 112

Query: 122 LLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLA 157
           LL EP  +SPL++++  + R GD +AY GI+KY LA
Sbjct: 113 LLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLA 148

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  130 bits (327), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 98/161 (60%), Gaps = 11/161 (6%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDE--TDLSKWEATICGPEHTPYERY 58
           M RI +EY+ ++K LA     ++P    + SL P  E   DL +WEA   GPE+TPY  +
Sbjct: 1   MRRILREYKQLQKQLA-----LHP---AVLSLAPVGEENGDLHRWEAHFQGPENTPYAGF 52

Query: 59  QFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHA 118
            F + I+VP++YP  PPK  F    I H NI  STGE+CLD+LK + W+PV++LL  V A
Sbjct: 53  TFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEA 112

Query: 119 VWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAER 159
           +  LL EP  DSPLDVD+  +    D+ AY G+V Y L  R
Sbjct: 113 ISTLLAEPGVDSPLDVDLSRLYTT-DRAAYDGVVNYRLRTR 152

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  120 bits (300), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 93/160 (58%), Gaps = 11/160 (6%)

Query: 2   SRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFR 61
           SRI KEY+  R   +            I +L+P    DL+ WE TI GP H+P+  + F+
Sbjct: 3   SRILKEYKDSRSLQSQ----------YILALDPISTDDLTHWECTIKGPLHSPFANHTFK 52

Query: 62  MLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWR 121
           + ID+P +YP+  P   FE  A+ H N+N  TGEICLDIL   +W+PV+++ + V A+  
Sbjct: 53  LRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVW 111

Query: 122 LLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERER 161
           LL EP   SPL++D+ N++R  D +AY  ++ Y L    +
Sbjct: 112 LLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  105 bits (262), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 91/160 (56%), Gaps = 10/160 (6%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MSRI KEY  ++K L +      P    I  L P D+ DLS+W     GP  +P+E ++ 
Sbjct: 1   MSRIVKEYMGLQKRLQT------PEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFEL 54

Query: 61  RMLIDVP-DSYPMAP-PKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHA 118
            + I +  + YP++  P+++FE   + H N+   TGEICLD+LK   WTP++ LL  V A
Sbjct: 55  GLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGA 113

Query: 119 VWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAE 158
           +  LL +P  DSPLD+D+  I    D  AY  IV+Y L E
Sbjct: 114 IRDLLADPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLEE 152

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 84.0 bits (206), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 83/163 (50%), Gaps = 28/163 (17%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     DDP  +       +L   +E+D+   + T  GP  TPY+R QF +
Sbjct: 6   RIMKEMQAVK-----DDPEAHI------TLEFVNESDIHHLKGTFQGPPETPYDRGQFVV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H N++S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFDT-KVYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT 165
           L+ P  + P D +               + +++L +RE  N T
Sbjct: 113 LQSPEPNDPQDAE---------------VAQHYLKDRESFNKT 140

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 82.8 bits (203), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 72/136 (52%), Gaps = 13/136 (9%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     DDPT          L   +E+D+   + +  GP  TPYE  QF +
Sbjct: 6   RIMKELQAVK-----DDPTAKI------GLEFVNESDIHHLKGSFFGPPGTPYEGGQFII 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFDT-KVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 74/136 (54%), Gaps = 13/136 (9%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     DDP  N       +L+  +E+D+   + +  GP  TPYE  +F +
Sbjct: 6   RIMKEMQAVK-----DDPAANI------TLDFVNESDIHHLKGSFLGPPGTPYEGGRFMI 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFDT-KVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 80.9 bits (198), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 61/104 (58%), Gaps = 3/104 (2%)

Query: 31  SLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNIN 90
           S  P +E DL  W   I GPE TPYE  +F++ +  PDSYP  PPK+ F    + H N++
Sbjct: 33  SAFPNNEDDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKF-ISPMWHPNVD 91

Query: 91  SSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
            S G ICLDILK Q W+ V+++   + ++  L  EP   SPL+ 
Sbjct: 92  MS-GNICLDILKDQ-WSAVYNVQTILLSLQSLFEEPNNSSPLNA 133

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 82.0 bits (201), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 72/136 (52%), Gaps = 13/136 (9%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     DDP  N       SL    E+D+   + +  GP  TPYE  +F +
Sbjct: 6   RIMKELQAVK-----DDPEANI------SLEFVSESDIHHLKGSFLGPPGTPYEGGKFIV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFD-SKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 80.5 bits (197), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 22  VNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEK 81
           ++P  G+  S  P  E DL++W   I GPE TPYE  +FR+ +   D YP  PPK+ F  
Sbjct: 23  MSPTPGL--SAFPASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTF-V 79

Query: 82  DAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
             + H N++ S G ICLDILK Q W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 80  SPMWHPNVDMS-GNICLDILKDQ-WSAVYNVQTILLSLQALLEEPNNGSPLNA 130

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 81.3 bits (199), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 81/163 (49%), Gaps = 28/163 (17%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     DDP  +       +L    E+D+   + T  GP  TPYE  +F +
Sbjct: 6   RIMKEIQAVK-----DDPAAHI------TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT 165
           L+ P  + P D +               + +++L +RE  N T
Sbjct: 113 LQSPEPNDPQDAE---------------VAQHYLRDRESFNKT 140

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 81.3 bits (199), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 81/163 (49%), Gaps = 28/163 (17%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     DDP  +       +L    E+D+   + T  GP  TPYE  +F +
Sbjct: 6   RIMKEIQAVK-----DDPAAHI------TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT 165
           L+ P  + P D +               + +++L +RE  N T
Sbjct: 113 LQSPEPNDPQDAE---------------VAQHYLRDRESFNKT 140

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 81.3 bits (199), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 81/163 (49%), Gaps = 28/163 (17%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     DDP  +       +L    E+D+   + T  GP  TPYE  +F +
Sbjct: 6   RIMKEIQAVK-----DDPAAHI------TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT 165
           L+ P  + P D +               + +++L +RE  N T
Sbjct: 113 LQSPEPNDPQDAE---------------VAQHYLRDRESFNKT 140

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 81.3 bits (199), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 73/136 (53%), Gaps = 13/136 (9%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+ KE + +R     DDP  N       +L    E+D+ + + +  GP  TPY+  +F +
Sbjct: 6   RLMKELQAVR-----DDPAANI------TLEFISESDIHRLKGSFLGPPETPYQGGRFII 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 81.3 bits (199), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 78/163 (47%), Gaps = 28/163 (17%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE   +R     DDP  N        L    E D+   + +  GP  TPYE  +F +
Sbjct: 6   RIMKEMEAVR-----DDPEANI------DLEFVSEADIHHLKGSFLGPPETPYEGGKFIV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFDT-KVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT 165
           L+ P  + P D +               + +++L +RE  N T
Sbjct: 113 LQSPEPNDPQDAE---------------VAQHYLRDRESFNKT 140

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 81.3 bits (199), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 81/163 (49%), Gaps = 28/163 (17%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     DDP  +       +L    E+D+   + T  GP  TPYE  +F +
Sbjct: 6   RIMKEIQAVK-----DDPAAHI------TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT 165
           L+ P  + P D +               + +++L +RE  N T
Sbjct: 113 LQSPEPNDPQDAE---------------VAQHYLRDRESFNKT 140

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 81/163 (49%), Gaps = 28/163 (17%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     DDP  N       +L    E+D+   + +  GP  TPY+  +F +
Sbjct: 6   RIMKEMQAVK-----DDPAANI------NLEFVSESDIHHLKGSFLGPPETPYQGGRFIV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFDT-KVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT 165
           L+ P  + P D +               + +++L +RE  N T
Sbjct: 113 LQSPEPNDPQDAE---------------VAQHYLRDRESFNKT 140

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 79.7 bits (195), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 81/147 (55%), Gaps = 12/147 (8%)

Query: 4   ITKEYRLIRKTLAS-DDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           +++  R+I++  A+ DDP  N       +L+   E+D+   + +  GP  TPYE   F +
Sbjct: 1   MSRAKRIIKEIQAAKDDPEANI------TLSFVSESDIHHLKGSFYGPPGTPYEGGNFIV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIQVPLEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMG-NIIRCGDKRAY 148
           L+ P  + P D ++  + IR  DK ++
Sbjct: 113 LQSPEPNDPQDAEVAQHFIR--DKSSF 137

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 79.3 bits (194), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 80/163 (49%), Gaps = 28/163 (17%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+ KE + ++     DDP  N       SL+   E+D+   + T  GP  TPY   +F +
Sbjct: 6   RLMKEIQSVK-----DDPDANI------SLSFVSESDIHHLKGTFLGPPGTPYHGGKFVV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIQVPLEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILK-NSWSPVLTLKTSLISLQAL 112

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT 165
           L+ P  + P D +               + K++L++R   + T
Sbjct: 113 LQSPEPNDPQDAE---------------VAKHYLSDRSSFDKT 140

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 79.3 bits (194), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 82/163 (50%), Gaps = 28/163 (17%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     DDP     R  +E +N   E+D+   + +  GP  TPYE  QF +
Sbjct: 6   RIMKELQAVK-----DDPEA---RIELEFVN---ESDIHHLKGSFLGPPGTPYEGGQFIV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP + F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPMMKFDT-KVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT 165
           L+ P  + P D +               + +++L +RE  N T
Sbjct: 113 LQSPEPNDPQDAE---------------VAQHYLKDRESFNKT 140

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 78.2 bits (191), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 67/113 (59%), Gaps = 5/113 (4%)

Query: 22  VNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEK 81
           ++P  G+  S  P DE DL+ W A I GP+ TPY+  +F++     DSYP APP + F  
Sbjct: 30  MSPTPGL--SAFPNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKF-I 86

Query: 82  DAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
             + H N++ S G ICLDILK Q W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 87  SPMWHPNVDMS-GNICLDILKDQ-WSAVYNVETILLSLQALLEEPNNSSPLNA 137

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 77.4 bits (189), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 62/101 (61%), Gaps = 3/101 (2%)

Query: 34  PTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSST 93
           P D+ DL+ W   I GP+ TPY   +F++ ++ P++YP  PPKI F    + H N++ S 
Sbjct: 32  PVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKF-VSPMWHPNVDKS- 89

Query: 94  GEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
           G ICLDILK + W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNKSPLNA 129

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 77.4 bits (189), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 4/115 (3%)

Query: 34  PTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSST 93
           P  E +L+KW  TI GP+ +PY   +F++ +  PD YP  PPK+ F    + H N++ S 
Sbjct: 36  PDHEENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKF-VSPMWHPNVDLS- 93

Query: 94  GEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAY 148
           G ICLD+LK + W+ V+++   + ++  LL EP   SPL+  +   +  GDK  Y
Sbjct: 94  GNICLDVLK-EKWSAVYNVQTILLSLQALLGEPNNSSPLNA-IAAELWDGDKEEY 146

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 76.6 bits (187), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 61/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPK+ F    I H NINSS G ICL
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNINSS-GNICL 87

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   L   + +V  LL +   D PL  ++  I +  DK  Y+   K
Sbjct: 88  DILKDQ-WSPALTLSKVLLSVCSLLTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 78.6 bits (192), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 73/121 (60%), Gaps = 4/121 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           ++ ++    CGP+ TPYE   +R+ +++PD+YP   P I F  + I H NI+ ++G ICL
Sbjct: 46  NMQEFYIKFCGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 104

Query: 99  DILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLA 157
           D++    W+P++DLL+ V   +  LL+EP    PL+ +    +   DK+ Y+  +K ++A
Sbjct: 105 DVIN-STWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELKDKKLYEERIKEYIA 162

Query: 158 E 158
           +
Sbjct: 163 K 163

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 76/129 (58%), Gaps = 7/129 (5%)

Query: 37  ETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEI 96
           E  + ++     GP+ TPYE   +R+ +++PD+YP   P I F  + I H NI+ ++G I
Sbjct: 27  EDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 85

Query: 97  CLDILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYF 155
           CLD++    W+P++DLL+ V   +  LL+EP    PL+ +  N ++  DK+ Y+  V+ +
Sbjct: 86  CLDVIN-STWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAAN-LQLKDKKVYEEKVREY 143

Query: 156 L---AERER 161
           +   A +ER
Sbjct: 144 IDKYATKER 152

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 61/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPK+ F    I H NINSS G ICL
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNINSS-GNICL 87

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   L   + ++  LL +   D PL  ++  I +  DK  Y+   K
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 61/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPK+ F    I H NINSS G ICL
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNINSS-GNICL 87

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   L   + ++  LL +   D PL  ++  I +  DK  Y+   K
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 61/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPK+ F    I H NINSS G ICL
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNINSS-GNICL 87

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   L   + ++  LL +   D PL  ++  I +  DK  Y+   K
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 77.8 bits (190), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 69/135 (51%), Gaps = 13/135 (9%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+ KE + ++     DDP  N       SL    E+D+   + T  GP  TPY    F +
Sbjct: 6   RLMKEIQSVK-----DDPDANI------SLAFVSESDIHHLKGTFLGPPGTPYHGGTFIV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I VP  YP  PPK+ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIQVPLEYPFKPPKMQFDT-KVYHPNISSVTGAICLDILK-NSWSPVLTLKTSLISLQAL 112

Query: 123 LREPVCDSPLDVDMG 137
           L+ P  + P D ++ 
Sbjct: 113 LQSPEPNDPQDAEVA 127

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 63/104 (60%), Gaps = 3/104 (2%)

Query: 31  SLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNIN 90
           S  P D+ DL+ W   I GP+ TPY   +F++ ++ P+SYP  PPK+ F    + H N++
Sbjct: 29  SAFPEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKF-VSPMWHPNVD 87

Query: 91  SSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
            S G ICLDILK + W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 88  MS-GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA 129

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+ KE + I+     DDP           L   +E D+   + +  GP  TPYE  +F +
Sbjct: 6   RVMKELQAIK-----DDPEAK------VDLQLVNENDIHLLKGSFLGPPGTPYENGKFIV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H N++S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFDTK-VYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 75.5 bits (184), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 62/101 (61%), Gaps = 3/101 (2%)

Query: 34  PTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSST 93
           P D+ DL+ W   I GP+ TPY   +F++ ++ P++YP  PPK+ F    + H N++ S 
Sbjct: 32  PVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKF-VSPMWHPNVDKS- 89

Query: 94  GEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
           G ICLDILK + W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA 129

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 76.3 bits (186), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 79/163 (48%), Gaps = 28/163 (17%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     DDP          +L    E+D+   + +  GP  TPYE   F +
Sbjct: 6   RIMKELQAVK-----DDPEAKI------TLEFVIESDIHHLKGSFIGPPGTPYENGAFVV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H NI+S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPQMKFDT-KVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNHT 165
           L+ P  + P D +               + +++L +RE  N T
Sbjct: 113 LQSPEPNDPQDAE---------------VAQHYLRDRESFNKT 140

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 76.3 bits (186), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+ KE + I+     DDP           L   +E D+   + +  GP  TPYE  ++ +
Sbjct: 6   RVMKELQAIK-----DDPEAR------VDLQLVNENDIHLLKGSFLGPPGTPYENGKYIV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H N++S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFQTK-VYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 75.9 bits (185), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 71/119 (59%), Gaps = 4/119 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           ++ ++    CGP+ TPYE   +R+ +++PD+YP   P I F  + I H NI+ ++G ICL
Sbjct: 29  NMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 87

Query: 99  DILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           D++    W+P++DLL+ V   +  LL+EP    PL+ +    ++  DK  Y+  +K ++
Sbjct: 88  DVIN-STWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLYEQKIKEYI 144

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 74.3 bits (181), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 56/99 (56%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + I H N+  + GEICLDIL+
Sbjct: 21  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-IFHPNV-YANGEICLDILQ 78

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 79  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 75.9 bits (185), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 72/135 (53%), Gaps = 13/135 (9%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     +DP        IE L   +E+D+   + +  GP  TPYE  +F +
Sbjct: 6   RILKEIQAVK-----EDPEAQ-----IE-LKFVNESDIHHMKGSFIGPSGTPYEGGKFVV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I++P  YP  PP++ F+   + H N++S TG ICLDILK   WTPV  L   + ++  L
Sbjct: 55  DINIPVEYPYKPPQMKFDT-KVYHPNVSSVTGAICLDILK-NAWTPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMG 137
           L+ P  + P D  + 
Sbjct: 113 LQSPEPNDPQDAQVA 127

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 75/151 (49%), Gaps = 16/151 (10%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI+KE   +RK     DP  +   G +         DL  W+A+I GP  +PY    F +
Sbjct: 5   RISKELNDLRK-----DPITSFSAGPVGD-------DLFHWQASIMGPPDSPYAGGVFFL 52

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I  P  YP  PPKI F    I H NIN++ G ICLDILK Q W+P   L   + ++  L
Sbjct: 53  SIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICLDILKDQ-WSPALTLSKVLLSICSL 109

Query: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           L +   D PL  ++ +I +  D+  Y+   +
Sbjct: 110 LTDANPDDPLVPEIAHIYKT-DRSKYETTAR 139

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 74.7 bits (182), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 74/126 (58%), Gaps = 7/126 (5%)

Query: 40  LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLD 99
           + ++     GP+ TPYE   +R+ +++PD+YP   P I F  + I H NI+ ++G ICLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 87

Query: 100 ILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL-- 156
           ++    W+P++DL++ V   +  LL+EP    PL+ +    ++  DK+ Y+  +K ++  
Sbjct: 88  VIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYIDK 145

Query: 157 -AERER 161
            A RE+
Sbjct: 146 YATREK 151

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+ ++ GEICLDIL+
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNVYAN-GEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+ ++ GEICLDIL+
Sbjct: 32  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNVYAN-GEICLDILQ 89

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 90  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 74.3 bits (181), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 72/119 (60%), Gaps = 4/119 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           ++ ++     GP+ TPYE+  +R+ +++PD+YP   P I F  + I H NI+ ++G ICL
Sbjct: 28  NMQEFFIKFFGPDETPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 86

Query: 99  DILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           D++    W+P++DL++ V   +  LL+EP    PL+ +    ++  DK+ Y+  +K ++
Sbjct: 87  DVIN-STWSPLYDLINIVEWMIPGLLKEPNGTDPLNNEAAG-LQLRDKKLYEEKIKEYI 143

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + RITKE       L  D PT         S  P  + DL  W+A+I GP  +PY    F
Sbjct: 3   LKRITKELN----DLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
            + I  P  YP  PPKI F    I H NIN++ G ICLDILK Q W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICLDILKDQ-WSPALTISKVLLSIC 107

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
            LL +   D PL  ++ +I +  D+  Y+   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + RITKE       L  D PT         S  P  + DL  W+A+I GP  +PY    F
Sbjct: 3   LKRITKELN----DLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
            + I  P  YP  PPKI F    I H NIN++ G ICLDILK Q W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICLDILKDQ-WSPALTISKVLLSIC 107

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
            LL +   D PL  ++ +I +  D+  Y+   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + RITKE       L  D PT         S  P  + DL  W+A+I GP  +PY    F
Sbjct: 3   LKRITKELN----DLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
            + I  P  YP  PPKI F    I H NIN++ G ICLDILK Q W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICLDILKDQ-WSPALTISKVLLSIC 107

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
            LL +   D PL  ++ +I +  D+  Y+   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + RITKE       L  D PT         S  P  + DL  W+A+I GP  +PY    F
Sbjct: 3   LKRITKELN----DLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
            + I  P  YP  PPKI F    I H NIN++ G ICLDILK Q W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICLDILKDQ-WSPALTISKVLLSIC 107

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
            LL +   D PL  ++ +I +  D+  Y+   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 70/118 (59%), Gaps = 4/118 (3%)

Query: 40  LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLD 99
           + ++     GP+ TPYE   +R+ +++PD+YP   P I F  + I H NI+ ++G ICLD
Sbjct: 30  MQEFHIKFHGPKDTPYENGVWRLHVELPDNYPFKSPSIGF-VNKIYHPNIDIASGSICLD 88

Query: 100 ILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           ++    W+P++DLL+ V   +  LL+EP    PL+ +    ++  DK+ Y+  +K ++
Sbjct: 89  VIN-STWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKMYEEKIKEYI 144

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 73.2 bits (178), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 56/99 (56%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+  + GEICLDIL+
Sbjct: 36  WNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFISE-MFHPNV-YANGEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 73.2 bits (178), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+ ++ GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFVSE-MFHPNVYAN-GEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 73.2 bits (178), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 56/99 (56%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+  + GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV-YANGEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 73.9 bits (180), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 72/119 (60%), Gaps = 4/119 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           ++ ++     GP+ TPYE+  +R+ +++PD+YP   P I F  + ILH NI+ ++G ICL
Sbjct: 16  NMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKILHPNIDVASGSICL 74

Query: 99  DILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           D++    W+P++DL + V   +  LL+EP    PL+ +    ++  DK+ Y+  +K ++
Sbjct: 75  DVIN-STWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 131

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 73.2 bits (178), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+ ++ GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNVYAN-GEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 73.9 bits (180), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           RI KE + ++     DDP          +L    E+D+   + +  GP  TPY+   F +
Sbjct: 6   RIMKEMQAVK-----DDPAAKI------NLEFVTESDIHHLKGSFLGPPGTPYDGGLFIV 54

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PPK+ F+   + H N++S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFDT-KVYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 73.2 bits (178), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+ ++ GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNVYAN-GEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 73.2 bits (178), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 56/99 (56%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+  + GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV-YANGEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 72.4 bits (176), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 56/99 (56%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+  + GEICLDIL+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSE-MFHPNV-YANGEICLDILQ 78

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 79  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 72.8 bits (177), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+ ++ GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNVYAN-GEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 73.2 bits (178), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 56/99 (56%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+  + GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV-YANGEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 73.6 bits (179), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 71/121 (58%), Gaps = 4/121 (3%)

Query: 37  ETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEI 96
           E  + ++     GP+ TPYE+  +R+ +++PD+YP   P I F  + I H NI++++G I
Sbjct: 27  EDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 85

Query: 97  CLDILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYF 155
           CLD++    W+P++DLL+ V   +  LL+EP    PL+ +    ++  DK  Y+  +  +
Sbjct: 86  CLDVIN-STWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKDKDMYEQKIHEY 143

Query: 156 L 156
           +
Sbjct: 144 I 144

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 72.4 bits (176), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPKI F    I H NIN++ G ICL
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNICL 87

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   L   + ++  LL +   D PL  ++ +I +  D+  Y+   +
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKYEATAR 140

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 72.8 bits (177), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+ ++ GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNVYAN-GEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 73.9 bits (180), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 70/118 (59%), Gaps = 4/118 (3%)

Query: 40  LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLD 99
           + ++     GP+ TPYE   +R+ +++PD+YP   P I F  + I H NI+ ++G ICLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 87

Query: 100 ILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           ++    W+P++DL++ V   +  LL+EP    PL+ +    ++  DK+ Y+  +K ++
Sbjct: 88  VIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 72.8 bits (177), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+ ++ GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNVYAN-GEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 73.9 bits (180), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 70/118 (59%), Gaps = 4/118 (3%)

Query: 40  LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLD 99
           + ++     GP+ TPYE   +R+ +++PD+YP   P I F  + I H NI+ ++G ICLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 87

Query: 100 ILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           ++    W+P++DL++ V   +  LL+EP    PL+ +    ++  DK+ Y+  +K ++
Sbjct: 88  VIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 72.8 bits (177), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+ ++ GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSE-MFHPNVYAN-GEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 72.4 bits (176), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+ ++ GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNVYAN-GEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQ 131

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 72.8 bits (177), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 75/141 (53%), Gaps = 15/141 (10%)

Query: 9   RLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDV 66
           RL+R  K + SD P      GI  S  P +   +  W A I GP  TPYE   FR++++ 
Sbjct: 8   RLMRDFKRIKSDSPP-----GISASPLPDN---VMLWNAMIIGPSDTPYEDGTFRLVLEF 59

Query: 67  PDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREP 126
            + YP  PP + F  + + H N+ ++ GEICLDIL+   WTP +D+   + ++  L  +P
Sbjct: 60  DEEYPNKPPHVKFLSE-MFHPNVYAN-GEICLDILQ-NRWTPTYDVSSILTSIQSLFNDP 116

Query: 127 VCDSPLDVDMGNIIRCGDKRA 147
              SP +V+   + +  D RA
Sbjct: 117 NPASPANVEAATLFK--DHRA 135

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 73.2 bits (178), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 74/128 (57%), Gaps = 7/128 (5%)

Query: 37  ETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEI 96
           + ++ ++     GP+ TPYER  +R+ +++PD+YP   P I F  + I H NI++++G I
Sbjct: 26  DDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 84

Query: 97  CLDILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNII----RCGDKRAYQGI 151
           CLD++    W+P++DLL+ V   +  LL+EP    PL+ +   +     +  +++  + I
Sbjct: 85  CLDVIN-STWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKNPQMYEEKIQEYI 143

Query: 152 VKYFLAER 159
            KY   ER
Sbjct: 144 DKYATEER 151

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 72.0 bits (175), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 56/99 (56%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP  PP + F  + + H N+  + GEICLDIL+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSE-MFHPNV-YANGEICLDILQ 78

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 79  -NRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 71.6 bits (174), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPKI F    I H NIN++ G ICL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNICL 86

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   L   + ++  LL +   D PL  ++ +I +  D+  Y+   +
Sbjct: 87  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRAKYEATAR 139

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 73.2 bits (178), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 73/126 (57%), Gaps = 9/126 (7%)

Query: 40  LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLD 99
           + ++     GP+ TPYE+  +R+ +++PD+YP   P I F  + I H NI++++G ICLD
Sbjct: 17  MQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICLD 75

Query: 100 ILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQG-----IVK 153
           ++    W+P++DL++ V   +  LL+EP    PL+ +    ++  +K  Y+      I K
Sbjct: 76  VIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKNKELYEEKIQEYIDK 133

Query: 154 YFLAER 159
           Y  +ER
Sbjct: 134 YATSER 139

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 72.0 bits (175), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPKI F    I H NIN++ G ICL
Sbjct: 43  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNICL 100

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   L   + ++  LL +   D PL  ++ +I +  D+  Y+   +
Sbjct: 101 DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKYEATAR 153

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPKI F    I H NIN++ G ICL
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICL 87

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   L   + ++  LL +   D PL  ++ +I +  D+  Y+   +
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAR 140

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPKI F    I H NIN++ G ICL
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICL 87

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   L   + ++  LL +   D PL  ++ +I +  D+  Y+   +
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAR 140

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPKI F    I H NIN++ G ICL
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICL 87

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   L   + ++  LL +   D PL  ++ +I +  D+  Y+   +
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAR 140

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 73.2 bits (178), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 67/117 (57%), Gaps = 3/117 (2%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           ++ ++     GP  TPYER  +R+ +++PD+YP   P I F  + I H NI++++G ICL
Sbjct: 28  NMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICL 86

Query: 99  DILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKY 154
           D++    W+P++DL++ V   +  LL+EP    PL+ +   +     K   + I +Y
Sbjct: 87  DVIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKNPKMYEEKIQEY 142

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPKI F    I H NIN++ G ICL
Sbjct: 30  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICL 87

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   L   + ++  LL +   D PL  ++ +I +  D+  Y+   +
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAR 140

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 60/104 (57%), Gaps = 3/104 (2%)

Query: 31  SLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNIN 90
           S  P D+ DL+ W   I GP+ TPY   +F++ +  P +YP  PP I F    + H N++
Sbjct: 29  SAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKF-LSPMWHPNVD 87

Query: 91  SSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
            S G ICLDILK + W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 88  KS-GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA 129

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPKI F    I H NIN++ G ICL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICL 86

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   L   + ++  LL +   D PL  ++ +I +  D+  Y+   +
Sbjct: 87  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAR 139

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 73.2 bits (178), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 71/119 (59%), Gaps = 4/119 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           ++ ++     GP+ TPYE   +R+ +++PD+YP   P I F  + I H NI+ ++G ICL
Sbjct: 30  NMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 88

Query: 99  DILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           D++    W+P++DLL+ +   +  LL+EP    PL+ +    ++  DK+ Y+  +K ++
Sbjct: 89  DVIN-STWSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIYEEKIKEYI 145

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + RITKE       L  D PT         S  P  + D+  W+A+I GP  +PY    F
Sbjct: 4   LKRITKELN----DLGRDPPTSC-------SAGPVGD-DIYHWQASIMGPPDSPYAGGVF 51

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
            + I  P  YP  PPKI F    I H NIN++ G ICLDILK Q W+P   +   + ++ 
Sbjct: 52  FLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICLDILKDQ-WSPALTISKVLLSIC 108

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
            LL +   D PL  ++ +I +  D+  Y+   K
Sbjct: 109 SLLTDANPDDPLVPEIAHIYKT-DRPKYEATAK 140

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 73.2 bits (178), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 70/118 (59%), Gaps = 4/118 (3%)

Query: 40  LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLD 99
           + ++     GP+ TPYE+  +R+ +++PD+YP   P I F  + I H NI+ ++G ICLD
Sbjct: 52  MQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 110

Query: 100 ILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           ++    W+P++DLL+ V   +  LL+EP    PL+ +    +   DK+ Y+  ++ ++
Sbjct: 111 VIN-STWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LELRDKKLYEEKIREYI 166

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 70/118 (59%), Gaps = 4/118 (3%)

Query: 40  LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLD 99
           + ++     GP+ TPYE   +R+ +++PD+YP   P I F  + I H NI+ ++G ICLD
Sbjct: 28  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 86

Query: 100 ILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           ++    W+P++DL++ +   +  LL+EP    PL+ +    ++  DK+ Y+  +K ++
Sbjct: 87  VIN-STWSPLYDLINILEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 142

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 72.0 bits (175), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 70/119 (58%), Gaps = 4/119 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           ++ ++     GP+ TPYE   +R+ +++PD+YP   P I F  + I H NI+ ++G ICL
Sbjct: 28  NMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDVASGSICL 86

Query: 99  DILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           D++    W+P++DL++ V   +  LL+EP    PL+ +    ++  DK  Y+  +K ++
Sbjct: 87  DVIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKVLYEQKIKEYI 143

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 73.2 bits (178), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 75/129 (58%), Gaps = 7/129 (5%)

Query: 37  ETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEI 96
           + ++ ++     GP+ TPYE   +R+ +++PD+YP   P I F  + I H NI++++G I
Sbjct: 26  DDNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 84

Query: 97  CLDILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYF 155
           CLD++    W+P++DL++ V   +  LL+EP    PL+ +    ++  +K  Y+  ++ F
Sbjct: 85  CLDVIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKNKELYEQKIREF 142

Query: 156 L---AERER 161
           +   A  ER
Sbjct: 143 IDKYATEER 151

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 70.9 bits (172), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + RITKE       L  D PT         S  P  + D+  W+A+I GP  +PY    F
Sbjct: 3   LKRITKELN----DLGRDPPTSC-------SAGPVGD-DIYHWQASIMGPPDSPYAGGVF 50

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
            + I  P  YP  PPKI F    I H NIN++ G ICLDILK Q W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKIAFTTK-IYHPNINAN-GNICLDILKDQ-WSPALTISKVLLSIC 107

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
            LL +   D PL  ++ +I +  D+  Y+   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAR 139

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + RITKE       L  D PT         S  P  + D+  W+A+I GP  +PY    F
Sbjct: 4   LKRITKELN----DLGRDPPTSC-------SAGPVGD-DVYHWQASIMGPPDSPYAGGVF 51

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
            + I  P  YP  PPKI F    I H NIN++ G ICLDILK Q W+P   +   + ++ 
Sbjct: 52  FLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICLDILKDQ-WSPALTISKVLLSIC 108

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
            LL +   D PL  ++ ++ +  D+  Y+   K
Sbjct: 109 SLLTDANPDDPLVPEIAHLYKT-DRAKYEATAK 140

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + RITKE       L  D PT         S  P  + D+  W+A+I GP  +PY    F
Sbjct: 4   LKRITKELN----DLGRDPPTSC-------SAGPVGD-DIYHWQASIMGPPDSPYAGGVF 51

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
            + I  P  YP  PPKI F    I H NIN++ G ICLDILK Q W+P   +   + ++ 
Sbjct: 52  FLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICLDILKDQ-WSPALTISKVLLSIC 108

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
            LL +   D PL  ++ ++ +  D+  Y+   K
Sbjct: 109 SLLTDANPDDPLVPEIAHLYKT-DRPKYEATAK 140

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 74/150 (49%), Gaps = 16/150 (10%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + RITKE       L  D PT         S  P  + D+  W+A+I GP  +PY    F
Sbjct: 3   LKRITKELN----DLGRDPPTSC-------SAGPVGD-DVYHWQASIMGPPDSPYAGGVF 50

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
            + I  P  YP  PPKI F    I H NIN++ G ICLDILK Q W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKIAFTT-KIYHPNINAN-GNICLDILKDQ-WSPALTISKVLLSIC 107

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQG 150
            LL +   D PL  ++ +I +  D+  Y+ 
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEA 136

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 70.9 bits (172), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  TPYE   FR+L++  + YP+  P + F  + + H N+ ++ GEICLDIL+
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFLSE-MFHPNVYAN-GEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 71.2 bits (173), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 70/119 (58%), Gaps = 4/119 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           ++ ++     GP+ TPYE   +R+ +++PD+YP   P I F  + I H NI+ ++G ICL
Sbjct: 30  NMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 88

Query: 99  DILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156
           D++    W+P++DL + V   +  LL+EP    PL+ +    ++  DK+ Y+  +K ++
Sbjct: 89  DVIN-STWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 145

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 71.2 bits (173), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 70/121 (57%), Gaps = 4/121 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           ++ ++     GP  TPYE   +R+ +++PD+YP   P I F  + I H NI++++G ICL
Sbjct: 16  NMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICL 74

Query: 99  DILKLQDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLA 157
           D++    W+P++DLL+ +   +  LL+EP    PL+ +    ++   K  Y+  ++ F+ 
Sbjct: 75  DVINSA-WSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAA-TLQLKSKELYERKIREFID 132

Query: 158 E 158
           +
Sbjct: 133 Q 133

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 71.6 bits (174), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL  W+A+I GP  +PY    F + I  P  YP  PPKI F    I H NIN++ G ICL
Sbjct: 118 DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNICL 175

Query: 99  DILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
           DILK Q W+P   +   + ++  LL +   D PL  ++ +I +  D+  Y+   K
Sbjct: 176 DILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 228

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 70.1 bits (170), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 56/99 (56%), Gaps = 3/99 (3%)

Query: 43  WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK 102
           W A I GP  T YE   FR+L++  + YP  PP + F  + + H N+ ++ GEICLDIL+
Sbjct: 36  WNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNVYAN-GEICLDILQ 93

Query: 103 LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 69.3 bits (168), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + RITKE       L  D PT         S  P  + D+  W+A+I GP  +PY    F
Sbjct: 4   LKRITKELN----DLGRDPPTSC-------SAGPVGD-DVYHWQASIMGPPDSPYAGGVF 51

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120
            + I  P  YP  PPKI F    I H NIN++ G ICLDILK Q W+P   +   + ++ 
Sbjct: 52  FLSIHFPTDYPFKPPKISFTT-KIYHPNINAN-GNICLDILKDQ-WSPALTISKVLLSIC 108

Query: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
            LL +   D PL  ++ ++ +  D+  Y+   +
Sbjct: 109 SLLTDANPDDPLVPEIAHLYKT-DRAKYEATAR 140

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 69.7 bits (169), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 67/113 (59%), Gaps = 5/113 (4%)

Query: 22  VNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEK 81
           ++P  G+  S  P +E DL+KW   I GP+ TPYE  +F++ +  P SYP   P++ F  
Sbjct: 28  MSPSPGL--SAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTF-V 84

Query: 82  DAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
             + H N++ S G ICLDILK Q W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 85  SPMWHPNVDMS-GNICLDILKDQ-WSAVYNVQTILLSLQSLLEEPNNSSPLNA 135

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 69.7 bits (169), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 75/152 (49%), Gaps = 27/152 (17%)

Query: 3   RITKEYR-LIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFR 61
           R+ KEY+ LIR++            GI+    P+DE ++ +W+  I GP  TPYE   F 
Sbjct: 10  RLLKEYQQLIRESPP----------GIVAG--PSDENNMFEWDCLISGPPETPYENGVFN 57

Query: 62  MLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDWTPV 109
             +  P  YP++PPK+ F   ++LH NI    GE+C+ IL              + W+PV
Sbjct: 58  ATLLFPKDYPLSPPKLTF-TPSLLHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPV 115

Query: 110 WDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
             +   + +V  +L EP  +S  ++D   + R
Sbjct: 116 QSVEKILLSVMSMLSEPNIESGANIDASILYR 147

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 74/146 (50%), Gaps = 27/146 (18%)

Query: 3   RITKEYR-LIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFR 61
           R+ KEY+ LIR          +P  GI+ +  P  E++L  W+  I GP  TPYE   F 
Sbjct: 8   RLLKEYQQLIR----------DPPPGILAA--PKSESNLFLWDCLIQGPPDTPYEGGIFN 55

Query: 62  MLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDWTPV 109
             +D P  YP++PPK+ F   +ILH NI  + GE+C+ IL              + W+PV
Sbjct: 56  ARLDFPKDYPLSPPKLTFTP-SILHPNIYHN-GEVCISILHSPGDDPNMYELAEERWSPV 113

Query: 110 WDLLHCVHAVWRLLREPVCDSPLDVD 135
             +   + +V  +L EP  +S  +VD
Sbjct: 114 QSVEKILLSVMSMLSEPNIESGANVD 139

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 72/132 (54%), Gaps = 13/132 (9%)

Query: 9   RLIRKT--LASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDV 66
           R+I++T  L SD     P  GI  S  P  E +L  ++ +I GP+ +PYE   FR+ + +
Sbjct: 7   RIIKETERLVSD-----PVPGI--SAEP-HEDNLRYFDVSIEGPQQSPYEHGVFRLELFL 58

Query: 67  PDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREP 126
           PD YPM PPK+ F    I H NI+   G ICLD+LK  +W+P   +   + ++  LL  P
Sbjct: 59  PDEYPMEPPKVRF-LTKIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALLATP 115

Query: 127 VCDSPLDVDMGN 138
             + PL  D+  
Sbjct: 116 NPNDPLANDVAK 127

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 67.4 bits (163), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 67/113 (59%), Gaps = 5/113 (4%)

Query: 22  VNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEK 81
           ++P  G+  S  P DE DL+KW   I GP+ TPYE  +F++ ++   +YP   PK+ F  
Sbjct: 28  LSPSPGL--SAFPEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRF-V 84

Query: 82  DAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
             + H N++ S G ICLDILK Q W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 85  SPMWHPNVDMS-GNICLDILKDQ-WSAVYNVQTILLSLQSLLEEPNNSSPLNA 135

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 66.6 bits (161), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 70/131 (53%), Gaps = 13/131 (9%)

Query: 9   RLIRKT--LASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDV 66
           R+I++T  LASD     P  GI  S  P  E +L  +  TI GPE +PYE   F + + +
Sbjct: 7   RIIKETERLASD-----PVPGI--SAEP-HEDNLRYFAVTIEGPEESPYENGVFELELYL 58

Query: 67  PDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREP 126
           PD YPM  PK+ F    I H NI+   G ICLD+LK  +W+P   +   + ++  LL  P
Sbjct: 59  PDDYPMEAPKVRF-LTRIYHPNID-RLGRICLDVLK-NNWSPALQIRTVLLSIQALLASP 115

Query: 127 VCDSPLDVDMG 137
             + PL  D+ 
Sbjct: 116 NPNDPLANDVA 126

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 66.6 bits (161), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 57/101 (56%), Gaps = 3/101 (2%)

Query: 37  ETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEI 96
           E +L  ++ TI GP+ +PYE   F++ + +PD YPM  PK+ F    I H NI+   G I
Sbjct: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRI 86

Query: 97  CLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 66.6 bits (161), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 73/145 (50%), Gaps = 23/145 (15%)

Query: 5   TKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           T + RL++  + LA D P      GI+    P  E +L  W+  I GP  +PYE   F  
Sbjct: 4   TAQKRLLKELQQLARDSP-----EGIVA--GPKSEDNLFLWDCLITGPPDSPYEGGVFNA 56

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDWTPVW 110
           +++ P  YP++PP++ F   +ILH NI  + GE+C+ IL              + W+PV 
Sbjct: 57  MLEFPKDYPLSPPRLTF-TPSILHPNIYPN-GEVCISILHSPGEDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVTSMLSEPNVESGANID 139

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 70/131 (53%), Gaps = 13/131 (9%)

Query: 9   RLIRKT--LASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDV 66
           R+I++T  L SD     P  GI    +   E +L  ++ TI GP+ +PYE   F++ + +
Sbjct: 7   RIIKETERLVSD-----PVPGITAEPH---EDNLRYFQVTIEGPQQSPYENGVFQLELFL 58

Query: 67  PDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREP 126
           PD YPM  PK+ F    I H NI+   G ICLD+LK  +W+P   +   + +V  LL  P
Sbjct: 59  PDDYPMEAPKVRF-LTKIYHPNID-RLGRICLDVLK-NNWSPALQIRTVLLSVQALLASP 115

Query: 127 VCDSPLDVDMG 137
             + PL  D+ 
Sbjct: 116 NPNDPLANDVA 126

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 65.9 bits (159), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 57/101 (56%), Gaps = 3/101 (2%)

Query: 37  ETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEI 96
           E +L  ++ TI GP+ +PYE   F++ + +PD YPM  PK+ F    I H NI+   G I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRI 86

Query: 97  CLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 71/145 (48%), Gaps = 23/145 (15%)

Query: 5   TKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           T + RL++  + L  D  T     GI+    P  E DL  W+  I GP  TPYE   F  
Sbjct: 4   TAQKRLLKELQQLMKDSST-----GIVA--GPRSENDLFVWDCLIQGPPDTPYEGGIFNA 56

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDWTPVW 110
            ++ P  YP++PPK+ F   +ILH NI  + GE+C+ IL              + W+PV 
Sbjct: 57  KLEFPKDYPLSPPKLTF-TPSILHPNIYHN-GEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  +VD
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANVD 139

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 37  ETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEI 96
           E +L  ++ TI GP+ +PYE   F + + +PD YPM  PK+ F    I H NI+   G I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRF-LTKIYHPNID-KLGRI 86

Query: 97  CLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 66.2 bits (160), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 74/145 (51%), Gaps = 23/145 (15%)

Query: 5   TKEYRLIRK--TLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           T + RL+++   L  D P      GI+ S  P D+++L +W+  I GP  + YE   F  
Sbjct: 4   TAQKRLLKELEKLTKDSP-----EGILAS--PIDDSNLFQWDCLIMGPPDSCYEGGVFNA 56

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDIL------------KLQDWTPVW 110
            +D P  YP+ PPK+ F+  +ILH NI    GE+C+ IL            + + W+PV 
Sbjct: 57  RLDFPKDYPLNPPKLTFQP-SILHPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEMILLSVMSILSEPNIESGANID 139

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 69/137 (50%), Gaps = 5/137 (3%)

Query: 18  DDPTVNPYRGIIESLNPTDETDLSK-WEATICGPEHTPYERYQFRMLIDVPDSYPMAPPK 76
           DD  + P   +   ++PTD + L       I  P+   Y+   FR  ++  D+YPM PPK
Sbjct: 44  DDLELPPTVSLTICISPTDPSSLDNPLLDVIISPDEGYYKNGHFRFSLEFNDNYPMEPPK 103

Query: 77  IMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDM 136
           ++  ++ I H NI+   G++CL+IL+ +DW+P  DL   +  +  L  EP    PL+ D 
Sbjct: 104 VVC-RNRIYHPNIDVQ-GKVCLNILR-EDWSPALDLQSIIVGLLFLFLEPNAKDPLNTDA 160

Query: 137 GNIIRCGDKRAYQGIVK 153
             +    D  A+   V+
Sbjct: 161 AAVF-SKDSNAFAKFVR 176

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 65.9 bits (159), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 75/139 (53%), Gaps = 15/139 (10%)

Query: 1   MSRITKEYRLIRKT--LASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERY 58
           MS + K  R+I++T  L SD     P  GI  +  P D+ +L  +E TI GP+ +PYE  
Sbjct: 1   MSSLPK--RIIKETERLVSD-----PVPGI--TAEPHDD-NLRYFEVTIEGPQQSPYENG 50

Query: 59  QFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHA 118
            F + + +PD YPM  PK+ F    I H NI+   G ICLD+LK  +W+P   +   + +
Sbjct: 51  VFDLELFLPDDYPMEAPKVRFLT-KIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLS 107

Query: 119 VWRLLREPVCDSPLDVDMG 137
           +  LL  P  + PL  D+ 
Sbjct: 108 IQALLASPNPNDPLANDVA 126

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 65.9 bits (159), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 68/145 (46%), Gaps = 25/145 (17%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+ KEY    + L  D P      GI+    P +E DL  W+  I GP  TPYE   F  
Sbjct: 8   RLFKEY----QQLIRDSPP-----GIVAG--PANENDLFLWDCLIQGPPDTPYEHGVFNA 56

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDWTPVW 110
            +  P  YP++PP + F   AILH NI    GE+C+ IL              + W+PV 
Sbjct: 57  QLRFPRDYPLSPPTLTF-TPAILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANID 139

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 65/115 (56%), Gaps = 6/115 (5%)

Query: 23  NPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKD 82
           +P  GI  +  P D+ +L  ++ +I GPE +PYE+  F++ + +PD YPM  PK+ F   
Sbjct: 14  DPVPGI--TAEPHDD-NLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRF-LT 69

Query: 83  AILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            I H NI+   G ICLDILK  +W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 70  KIYHPNID-RLGRICLDILK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 65.1 bits (157), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 64/115 (55%), Gaps = 6/115 (5%)

Query: 23  NPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKD 82
           +P  GI  +  P D+ +L  ++ TI GPE +PYE   F++ + +PD YPM  PK+ F   
Sbjct: 8   DPVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRF-LT 63

Query: 83  AILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            I H NI+   G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 64  KIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 71/131 (54%), Gaps = 13/131 (9%)

Query: 9   RLIRKT--LASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDV 66
           R+I++T  L SD     P  GI  S  P D+ +L  ++ TI GP+ +PYE   F + + +
Sbjct: 7   RIIKETERLVSD-----PVPGI--SAEPHDD-NLRYFQVTIEGPQQSPYENGVFELELFL 58

Query: 67  PDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREP 126
           P+ YPM  PK+ F    I H NI+   G ICLD+LK  +W+P   +   + ++  LL  P
Sbjct: 59  PEDYPMEAPKVRF-LTKIYHPNID-RLGRICLDVLK-NNWSPALQIRTVLLSIQALLASP 115

Query: 127 VCDSPLDVDMG 137
             + PL  D+ 
Sbjct: 116 NPNDPLANDVA 126

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 65.1 bits (157), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 71/131 (54%), Gaps = 13/131 (9%)

Query: 9   RLIRKT--LASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDV 66
           R+I++T  L SD     P  GI  +  P D+ +L  ++ TI GPE +PYE   F + + +
Sbjct: 7   RIIKETEKLVSD-----PVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGIFELELYL 58

Query: 67  PDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREP 126
           PD YPM  PK+ F    I H NI+   G ICLD+LK  +W+P   +   + ++  LL  P
Sbjct: 59  PDDYPMEAPKVRF-LTKIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASP 115

Query: 127 VCDSPLDVDMG 137
             + PL  D+ 
Sbjct: 116 NPNDPLANDVA 126

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 65.1 bits (157), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 71/131 (54%), Gaps = 13/131 (9%)

Query: 9   RLIRKT--LASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDV 66
           R+I++T  L SD     P  GI  S  P  E +L  ++ +I GP+ + YE   FR+ + +
Sbjct: 7   RIIKETERLVSD-----PVPGI--SAEP-HEDNLRYFDVSIEGPQQSAYENGVFRLELFL 58

Query: 67  PDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREP 126
           PD YPM PPK+ F    I H NI+   G ICLD+LK  +W+P   +   + ++  LL  P
Sbjct: 59  PDEYPMEPPKVRF-LTKIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALLATP 115

Query: 127 VCDSPLDVDMG 137
             + PL  D+ 
Sbjct: 116 NPNDPLANDVA 126

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 65.1 bits (157), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 74/149 (49%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERY 58
           MS+ T + RL++  + L  D P      GI+    P  E ++ +W+  + GP  +PYE  
Sbjct: 1   MSK-TAQKRLLKELQQLMKDSPP-----GIVAG--PKTEDNIFQWDCLVQGPPDSPYEGG 52

Query: 59  QFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDW 106
            F   +D P  YP++PPK+ F   +ILH NI    GE+C+ IL              + W
Sbjct: 53  VFNAQLDFPKDYPLSPPKLTF-TPSILHPNI-YPNGEVCISILHSPGEDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNIESGANID 139

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 64.7 bits (156), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 61/104 (58%), Gaps = 3/104 (2%)

Query: 31  SLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNIN 90
           S  P  E DL+KW   I GP+ TPYE  +F++ ++   +YP   PK+ F    + H N++
Sbjct: 35  SAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRF-VSPMWHPNVD 93

Query: 91  SSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
            S G ICLDILK Q W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 94  MS-GNICLDILKDQ-WSAVYNVQTILLSLQSLLEEPNNSSPLNA 135

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 64.7 bits (156), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 73/149 (48%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERY 58
           MS+ T + RL +  + L  D P      GI+    P  E +L  W+  I GP  +PY+  
Sbjct: 1   MSK-TAQKRLFKELQQLLKDSP-----EGIVA--GPKSEDNLFVWDCLISGPPDSPYQGG 52

Query: 59  QFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDW 106
            F   ++ P  YP++PPK++F   +ILH NI    GE+C+ IL              + W
Sbjct: 53  VFNATLEFPKDYPLSPPKLLF-TPSILHPNI-YPNGEVCISILHSPGDDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNVESGANID 139

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 64.7 bits (156), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 71/145 (48%), Gaps = 23/145 (15%)

Query: 5   TKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           T + RL +  + L  D P      GI+    P  E +L  W+  I GP  +PY+   F  
Sbjct: 4   TAQKRLFKELQQLLKDSP-----EGIVA--GPRSEDNLFLWDCLISGPPDSPYQGGVFNA 56

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDWTPVW 110
            ++ P  YP++PPK++F   +ILH NI  + GE+C+ IL              + W+PV 
Sbjct: 57  TLEFPKDYPLSPPKLLF-TPSILHPNIYPN-GEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANID 139

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 63.5 bits (153), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL +WEA I G   T +    + + I+ PD YP  PPK+MF K    H N+  S G ICL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMFPK-GFYHPNVYPS-GTICL 59

Query: 99  DIL-KLQDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL + QDW P   L   V  V  LL  P  +SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 64.7 bits (156), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 71/145 (48%), Gaps = 23/145 (15%)

Query: 5   TKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           T + RL++  + L  D P      GI+    P DE+DL  W+  + GP  +PYE   F  
Sbjct: 4   TAQRRLLKELQQLMRDPPP-----GIVA--GPQDESDLFLWDCLVQGPPDSPYEGGVFEA 56

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDWTPVW 110
            +  P  YP++PPK+ F   ++LH N+    GE+C+ IL              + W+PV 
Sbjct: 57  QLRFPRDYPLSPPKLTF-VPSVLHPNV-YPNGEVCISILHAPGEDPNQYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVVSMLSEPNVESGANID 139

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 63.5 bits (153), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 63/115 (54%), Gaps = 6/115 (5%)

Query: 23  NPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKD 82
           +P  GI  +  P D+ +L  ++ TI GPE +PYE   F + + +PD YPM  PK+ F   
Sbjct: 8   DPVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRF-LT 63

Query: 83  AILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            I H NI+   G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 64  RIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 64.3 bits (155), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 70/145 (48%), Gaps = 23/145 (15%)

Query: 5   TKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           T + RL++  + L  D P      GI+    P +E +L  W+  + GP  T YE   F  
Sbjct: 4   TAQRRLLKELQQLNKDSPP-----GIVAG--PANENNLFVWDCLVQGPPDTAYEGGIFNA 56

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDWTPVW 110
            +D P  YP++PPK+ F   +ILH NI    GE+C+ IL              + W+PV 
Sbjct: 57  RLDFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVMSMLSEPNIESGANID 139

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 63.5 bits (153), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 63/115 (54%), Gaps = 6/115 (5%)

Query: 23  NPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKD 82
           +P  GI  +  P D+ +L  ++ TI GPE +PYE   F + + +PD YPM  PK+ F   
Sbjct: 8   DPVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRF-LT 63

Query: 83  AILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            I H NI+   G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 64  KIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 63.9 bits (154), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 57/101 (56%), Gaps = 3/101 (2%)

Query: 37  ETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEI 96
           E +L  ++ TI GP  +PYE+  F++ + +P+ YPM  PK+ F    I H NI+   G I
Sbjct: 29  EDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRF-LTKIYHPNID-RLGRI 86

Query: 97  CLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 63.9 bits (154), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 73/147 (49%), Gaps = 20/147 (13%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MSR T + RL+++       T +P  GII +  P  E+DL  W+  + GP  TPY    F
Sbjct: 1   MSR-TAQKRLLKEL---QQLTRDPPPGIIAA--PKTESDLFTWDCLVAGPPDTPYAGGLF 54

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDWTP 108
              +  P  YP++PP + F   +ILH N+  + GE+C+ IL              + W+P
Sbjct: 55  NCQLQFPTDYPLSPPTLTFTP-SILHPNVYPN-GEVCISILHAPGSDPNMYELPEERWSP 112

Query: 109 VWDLLHCVHAVWRLLREPVCDSPLDVD 135
           V  +   + +V  +L EP  +S  ++D
Sbjct: 113 VQSVEKILLSVVSMLSEPNVESGANID 139

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 63.2 bits (152), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 70/131 (53%), Gaps = 13/131 (9%)

Query: 9   RLIRKT--LASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDV 66
           R+I++T  L SD     P  GI  +  P D+ +L  +  TI GPE +PYE   F + + +
Sbjct: 7   RIIKETERLVSD-----PVPGI--TAEPHDD-NLRYFSVTIEGPEGSPYEHGIFDLELFL 58

Query: 67  PDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREP 126
           PD YPM  PK+ F    I H NI+   G ICLD+LK  +W+P   +   + ++  LL  P
Sbjct: 59  PDDYPMESPKVRF-LTKIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASP 115

Query: 127 VCDSPLDVDMG 137
             + PL  D+ 
Sbjct: 116 NPNDPLANDVA 126

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 37  ETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEI 96
           E +L  +  T+ GP  +PYE   F++ + +PD YPM  PK+ F    I H NI+   G I
Sbjct: 29  EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRI 86

Query: 97  CLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 63.2 bits (152), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           +L KWEA I G E T ++   + + I+ PD YP  PPK+ F      H NI  S G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKFPA-GFYHPNIYPS-GTVCL 94

Query: 99  DILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL   QDW P   L   V  V  LL  P  DSP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSP 128

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 70/131 (53%), Gaps = 13/131 (9%)

Query: 9   RLIRKT--LASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDV 66
           R+I++T  L SD     P  GI  +  P D+ +L  +  T+ GP  +PYE   F++ + +
Sbjct: 7   RIIKETERLISD-----PVPGI--TAEPHDD-NLRYFNVTVEGPTQSPYENGIFKLELYL 58

Query: 67  PDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREP 126
           PD YPM  PK+ F    I H NI+   G ICLD+LK  +W+P   +   + ++  LL  P
Sbjct: 59  PDDYPMEAPKVRFLT-KIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASP 115

Query: 127 VCDSPLDVDMG 137
             + PL  D+ 
Sbjct: 116 NPNDPLANDVA 126

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 62.8 bits (151), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 49/100 (49%), Gaps = 3/100 (3%)

Query: 33  NPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSS 92
            P    +L KWEA I G E T ++   F + ++ PD YP  PPK+ F      H NI  S
Sbjct: 31  GPDGTLNLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKFPA-GFYHPNIYPS 89

Query: 93  TGEICLDILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            G +CL IL   QDW P   L   V  V  LL  P  +SP
Sbjct: 90  -GTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 62.8 bits (151), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 70/145 (48%), Gaps = 23/145 (15%)

Query: 5   TKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           T + RL++  + L  D P      GI+    P +E ++  W+  I GP  +PYE   F  
Sbjct: 4   TAQKRLMKEMQQLLKDCP-----EGIVAG--PVNEENMFLWDCLIAGPPDSPYEGGIFNA 56

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDWTPVW 110
            +  P  YP++PPK+ F   +ILH N+    GE+C+ IL              + W+PV 
Sbjct: 57  RLQFPTDYPLSPPKLTF-TPSILHPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANID 139

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 61.2 bits (147), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           +L KWEA I G E T ++   F + I+ PD YP  PPK+ F      H NI  S G +CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPA-GFYHPNIYPS-GTVCL 59

Query: 99  DILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL   QDW P   L      V  LL  P  +SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 62.0 bits (149), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 63/116 (54%), Gaps = 6/116 (5%)

Query: 22  VNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEK 81
            +P  GI  +  P D+ +L  +E T+ GP  +PYE   F++ + +PD YPM  PK+ F  
Sbjct: 17  TDPVPGI--TAEPHDD-NLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRF-L 72

Query: 82  DAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
             I H NI+   G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 73  TKIYHPNID-RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 62.0 bits (149), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 69/145 (47%), Gaps = 23/145 (15%)

Query: 5   TKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           T + RL++  + L  D P      GI+    P  E +L  W+  I GP  +PYE   F  
Sbjct: 4   TAQKRLMKELQQLLRDSPD-----GIVA--GPVSEDNLFLWDCLIEGPADSPYEGGVFNA 56

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDWTPVW 110
            +  P  YP++PPK+ F   +ILH N+    GE+C+ IL              + W+PV 
Sbjct: 57  RLQFPRDYPLSPPKLTFTP-SILHPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANID 139

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 62.0 bits (149), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 72/149 (48%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERY 58
           MS+ T + RL++  + L  D P      GI+    P  E ++  W+  I GP  TPY   
Sbjct: 1   MSK-TAQKRLLKELQQLIKDSPP-----GIVAG--PKSENNIFVWDCLIQGPPDTPYADG 52

Query: 59  QFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDW 106
            F   ++ P  YP++PPK+ F   +ILH NI    GE+C+ IL              + W
Sbjct: 53  VFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNIESGANID 139

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 62.0 bits (149), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 72/149 (48%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERY 58
           MS+ T + RL++  + L  D P      GI+    P  E ++  W+  I GP  TPY   
Sbjct: 1   MSK-TAQKRLLKELQQLIKDSPP-----GIVAG--PKSENNIFVWDCLIQGPPDTPYADG 52

Query: 59  QFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDW 106
            F   ++ P  YP++PPK+ F   +ILH NI    GE+C+ IL              + W
Sbjct: 53  VFNTKLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNIESGANID 139

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 60.5 bits (145), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 55/105 (52%), Gaps = 4/105 (3%)

Query: 49  GPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTP 108
           GP  +PY    F + I  P  YP  PPKI F    I H NIN++ G ICLDILK Q W+P
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNICLDILKDQ-WSP 58

Query: 109 VWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
              L   + ++  LL +   D PL  ++ +I +  D+  Y+   +
Sbjct: 59  ALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAR 102

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 61.6 bits (148), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 48/100 (48%), Gaps = 3/100 (3%)

Query: 33  NPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSS 92
            P    +L KWEA I G E T ++   F + I+ PD YP  PPK+ F      H NI  S
Sbjct: 31  KPDGSMNLQKWEAGIPGKEGTIWKDGVFPITIEYPDDYPSKPPKVKFPA-GFYHPNIYPS 89

Query: 93  TGEICLDILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            G +CL IL   QDW P   L      V  LL  P  +SP
Sbjct: 90  -GTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 61.6 bits (148), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 72/149 (48%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERY 58
           MS+ T + RL++  + L  D P      GI+    P  E ++  W+  I GP  TPY   
Sbjct: 1   MSK-TAQKRLLKELQQLIKDSPP-----GIVAG--PKSENNIFIWDCLIQGPPDTPYADG 52

Query: 59  QFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDW 106
            F   ++ P  YP++PPK+ F   +ILH NI    GE+C+ IL              + W
Sbjct: 53  VFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNIESGANID 139

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 61.2 bits (147), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MS++ + +RL+ + L   +    P       L  +D+  ++KW  TI GP H+ +E   +
Sbjct: 1   MSKVPRNFRLLEE-LEKGEKGFGP-ESCSYGLADSDDITMTKWNGTILGPPHSNHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDL 112
            + ID   +YP +PPK+ F     L C +N +TGE+  D   L+DW   + +
Sbjct: 59  SLSIDCGPNYPDSPPKVTFISKINLPC-VNPTTGEVQTDFHTLRDWKRAYTM 109

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 61.6 bits (148), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 70/145 (48%), Gaps = 23/145 (15%)

Query: 5   TKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           T + RL++  + L  D P      GI+    P +E +L  W+  + GP  T YE   F  
Sbjct: 4   TAQRRLLKELQQLTKDSPP-----GIVAC--PKNENNLFIWDCLVQGPPDTAYEGGIFNA 56

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDWTPVW 110
            ++ P  YP++PPK+ F   +ILH NI    GE+C+ IL              + W+PV 
Sbjct: 57  RLEFPKDYPLSPPKLTF-TPSILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SIEKILLSVMSMLSEPNIESGANID 139

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 61.6 bits (148), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 72/149 (48%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERY 58
           MS+ T + RL++  + L  D P      GI+    P  E ++  W+  I GP  TPY   
Sbjct: 1   MSK-TAQKRLLKELQQLIKDSPP-----GIVAG--PKSENNIFVWDCLIQGPPDTPYADG 52

Query: 59  QFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDW 106
            F   ++ P  YP++PPK+ F   +ILH NI    GE+C+ IL              + W
Sbjct: 53  IFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNIESGANID 139

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MS++ + +RL+ + L   +    P       L  +D+  ++KW  TI GP H+ +E   +
Sbjct: 1   MSKVPRNFRLLEE-LEKGEKGFGP-ESCSYGLADSDDITMTKWNGTILGPPHSNHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDL 112
            + I+   +YP +PPK+ F     L C +N +TGEI  D   L+DW   + +
Sbjct: 59  SLSIECGPNYPDSPPKVTFISKINLPC-VNQTTGEIQTDFHTLRDWKRAYTM 109

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 37  ETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEI 96
           E +L  +  TI GP+ + YE   F + + +PD YPM  PK+ F    I H NI+   G I
Sbjct: 29  EDNLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRF-LTKIYHPNID-RLGRI 86

Query: 97  CLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL KWEA I G E T +    + + ++ P+ YP  PPK+ F      H N+  S G ICL
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKFPA-GFYHPNVYPS-GTICL 94

Query: 99  DILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL   QDW P   L   V  V  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 52/103 (50%), Gaps = 7/103 (6%)

Query: 34  PTDETD----LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNI 89
           PT +TD    L KWEA I G + T ++   + + I+ PD YP  PPK+ F      H N+
Sbjct: 28  PTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKFPA-GFYHPNV 86

Query: 90  NSSTGEICLDILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
             S G ICL IL   QDW P   L   +  V  LL  P  +SP
Sbjct: 87  YPS-GTICLSILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSP 128

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 71/149 (47%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRLIR--KTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERY 58
           MS+ T + RL +  + L  D P      GI+    P  + +L  W+  I GP  TPY   
Sbjct: 1   MSK-TAQKRLYKELQQLIKDSPP-----GIVA--GPKSDDNLFVWDCLIQGPPDTPYAGG 52

Query: 59  QFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------------QDW 106
            F   ++ P  YP++PPK+ F   +ILH NI    GE+C+ IL              + W
Sbjct: 53  VFNAQLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYESAEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNIESGANID 139

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 60.5 bits (145), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 66/130 (50%), Gaps = 5/130 (3%)

Query: 28  IIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHC 87
           +I S + T+ T   K E T+  P+   Y        +D  + YP+ PPK+   K  I H 
Sbjct: 48  VITSPDSTNRTHSPKLEITV-NPDEGYYTHGSINFSLDFNEVYPIEPPKVACLK-RIFHP 105

Query: 88  NINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRA 147
           NI+   G +CL+IL+ +DW+P  DL   V  +  L  EP  + PL+ D   ++ C D++ 
Sbjct: 106 NIDFK-GNVCLNILR-EDWSPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLL-CQDEKE 162

Query: 148 YQGIVKYFLA 157
           +   V+  ++
Sbjct: 163 FAEAVRSTMS 172

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 59.7 bits (143), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           +L KWEA I G E T ++   + + I+ PD YP  PPK+ F      H NI  S G +CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKFPA-GFYHPNIYPS-GTVCL 94

Query: 99  DILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL   QDW P   +   +  V  LL  P  DSP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPDSP 128

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 59.7 bits (143), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL KWEA I G E T +    + + ++ P+ YP  PPK+ F      H N+  S G ICL
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKFPA-GFYHPNVYPS-GTICL 94

Query: 99  DILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL   QDW P   L   V  V  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 59.7 bits (143), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL KWEA I G E T +    + + ++ P+ YP  PPK+ F      H N+  S G ICL
Sbjct: 37  DLQKWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKFPA-GFYHPNVYPS-GTICL 94

Query: 99  DILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL   QDW P   L   V  V  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 59.7 bits (143), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 49/100 (49%), Gaps = 3/100 (3%)

Query: 33  NPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSS 92
           N     +L KWEA I G E T ++   + + I+ PD YP  PPK+ F      H NI  S
Sbjct: 31  NADGTMNLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRFPA-GFYHPNIYPS 89

Query: 93  TGEICLDILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            G +CL IL   QDW P   L   V  V  LL  P  +SP
Sbjct: 90  -GTVCLSILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 59.3 bits (142), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 60/133 (45%), Gaps = 12/133 (9%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDET-DLSKWEATICGPEHTPYERYQ 59
           + R+ +E +  RK         +P+    + L   D T DL  WEA I G   T +    
Sbjct: 6   LQRLQEERKKWRKD--------HPFSFFAKPLKKADGTMDLQHWEAGIPGKAGTLWADAV 57

Query: 60  FRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL-QDWTPVWDLLHCVHA 118
           + + I+ PD YP  PPK+ F      H NI  S G +CL IL   QDW P   L   V  
Sbjct: 58  YPISIEYPDEYPSKPPKVKFPA-GFYHPNIYPS-GTVCLSILNEDQDWRPAITLKQIVLG 115

Query: 119 VWRLLREPVCDSP 131
           V  LL  P  +SP
Sbjct: 116 VQDLLDSPNPNSP 128

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 59.3 bits (142), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           +L KWEA I G E T ++   + + I+ PD YP  PPK+ F      H NI  S G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKFPA-GFYHPNIYPS-GTVCL 94

Query: 99  DILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL   QDW P   L      V  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 58.5 bits (140), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 59/107 (55%), Gaps = 4/107 (3%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MS++ + +RL+ + L   +  + P       L+ +D+  ++KW  TI GP H+ +E   +
Sbjct: 1   MSKVPRSFRLLEE-LEKGEKGLGP-ESCSYGLSDSDDITMTKWNGTILGPPHSNHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDIL-KLQDW 106
            +LI+   SYP  PPK+ F     L C +NS+TGE+  +    L++W
Sbjct: 59  SVLIECGPSYPDEPPKVKFVSKINLPC-VNSTTGEVVKEKFHTLKEW 104

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           DL KWEA I G + T +    + + ++ P+ YP  PPK+ F      H N+  S G ICL
Sbjct: 37  DLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKFPA-GFYHPNVYPS-GTICL 94

Query: 99  DILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL   QDW P   L   V  V  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 64/131 (48%), Gaps = 5/131 (3%)

Query: 27  GIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILH 86
            +I   + TD     K E T+  P+   Y        +D  + YP+ PPK+   K  I H
Sbjct: 47  NVITPPDSTDRMQSPKLEVTVS-PDEGYYNHGSINFGLDFNEVYPIEPPKVACLK-KIFH 104

Query: 87  CNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKR 146
            NI+   G +CL+IL+ +DW+P  DL   +  +  L  EP  + PL+ D   +  C +++
Sbjct: 105 PNIDLK-GNVCLNILR-EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLF-CQNEK 161

Query: 147 AYQGIVKYFLA 157
            +  IV+  ++
Sbjct: 162 KFAEIVRSTMS 172

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 49/104 (47%), Gaps = 7/104 (6%)

Query: 33  NPTDETD----LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCN 88
            PT + D    L  WEA I G E T +    + + I+ PD YP  PPK+ F      H N
Sbjct: 27  KPTKKVDGSMNLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKFPA-GFYHPN 85

Query: 89  INSSTGEICLDILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
           I  S G +CL IL   QDW P   L   V  V  LL  P  +SP
Sbjct: 86  IYPS-GTVCLSILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 57.8 bits (138), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 59/116 (50%), Gaps = 14/116 (12%)

Query: 50  PEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPV 109
           P+   Y+  +FR      ++YP+ PPK++   + I H NI+   G+ICL+IL+ +DW+P 
Sbjct: 71  PDEGFYKGGKFRFTATFLETYPIDPPKVIC-NNKIFHPNIDPH-GKICLNILR-EDWSPA 127

Query: 110 WDLLHCVHAVWRLLREPVCDSPLD-----------VDMGNIIRCGDKRAYQGIVKY 154
            DL   V  +  L +EP  + PL+           ++ GN++R     A  G   Y
Sbjct: 128 LDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDKLEFGNLVRLAMSGAMVGSTYY 183

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICL 98
           +L KWEA I G E T ++   + + I+ PD YP  PP++ F      H NI  S G +CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKFPA-GFYHPNIYPS-GTVCL 94

Query: 99  DILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL   QDW P   +   +  V  LL  P  +SP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPNSP 128

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 56.6 bits (135), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 61/125 (48%), Gaps = 4/125 (3%)

Query: 27  GIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILH 86
            +I S +  D +   K E  I  P+   Y        +D  + YP+ PPK++  K  I H
Sbjct: 48  NVITSPDSADRSQSPKLE-VIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLK-KIFH 105

Query: 87  CNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKR 146
            NI+   G +CL+IL+ +DW+P  DL   +  +  L  EP  + PL+ D   ++  G+K 
Sbjct: 106 PNIDLK-GNVCLNILR-EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEKE 163

Query: 147 AYQGI 151
             + +
Sbjct: 164 FAEAV 168

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 50/103 (48%), Gaps = 7/103 (6%)

Query: 34  PTDETD----LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNI 89
           PT +TD    L KWEA I G E T +    + + I+ P+ YP  PPK+        H N+
Sbjct: 28  PTKKTDGTMNLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKLPA-GFYHPNV 86

Query: 90  NSSTGEICLDIL-KLQDWTPVWDLLHCVHAVWRLLREPVCDSP 131
             S G ICL IL + QDW P   L      +  LL  P  +SP
Sbjct: 87  YPS-GTICLSILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 50  PEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPV 109
           P+   Y+   F   +   DSYP+ PP + F K  I H NI+ + G+ICL+IL+ +DW+PV
Sbjct: 75  PDEGIYKDGYFPFSMVFKDSYPIEPPVVKFLK-KIYHPNIDLN-GKICLNILR-EDWSPV 131

Query: 110 WDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVK 153
            DL   +  +  L  EP    PL++  G +++  +K+ +  IV+
Sbjct: 132 LDLQSIIIGLMFLFLEPNPRDPLNLKAGELLK-ENKQEFIDIVR 174

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 47/100 (47%), Gaps = 3/100 (3%)

Query: 33  NPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSS 92
            P    DL +WEA I G + T +    + + I+ PD YP  PPK+    +   H N+  S
Sbjct: 31  KPDGTMDLQRWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKLPAN-FYHPNVYPS 89

Query: 93  TGEICLDILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            G ICL IL   QDW P   L      +  LL  P  +SP
Sbjct: 90  -GTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 48/100 (48%), Gaps = 3/100 (3%)

Query: 33  NPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSS 92
           +P    +L KWEA I G E T +    + + I+ P+ YP  PPK+    +   H N+  S
Sbjct: 31  HPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKLPAN-FYHPNVYPS 89

Query: 93  TGEICLDILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            G ICL IL   QDW P   L      +  LL  P  +SP
Sbjct: 90  -GTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 55.5 bits (132), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (50%), Gaps = 4/108 (3%)

Query: 55  YERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLH 114
           Y    FR    + ++YP+ PPK++     I H NIN  TGEICL+IL+ +DW+P  DL  
Sbjct: 86  YNLGHFRFQFTINENYPIEPPKVVC-LTKIYHPNIN-RTGEICLNILR-EDWSPALDLQS 142

Query: 115 CVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERN 162
            +  +  L  EP    PL+    + +   D   ++ IV+  +A    N
Sbjct: 143 VIIGLLFLFIEPNPKDPLNKQAADTL-LHDPAVFKHIVQKSMAGESIN 189

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 48/104 (46%), Gaps = 7/104 (6%)

Query: 33  NPTDETD----LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCN 88
            PT + D    L +WEA I G E T +    + + I+ PD YP  PPK+        H N
Sbjct: 27  KPTKKQDGSLNLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKLPA-GFYHPN 85

Query: 89  INSSTGEICLDILKL-QDWTPVWDLLHCVHAVWRLLREPVCDSP 131
           +  S G ICL IL   QDW P   L      +  LL  P  +SP
Sbjct: 86  VYPS-GTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 62/133 (46%), Gaps = 7/133 (5%)

Query: 20  PTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMF 79
           PTV     I  S   TD     K E  +  P+   Y        +D  + YP+ PPK+  
Sbjct: 42  PTVT--LSIKASPQSTDRMQPPKLE-VVVSPDEGYYNHGSISFSLDFNEVYPIEPPKVTC 98

Query: 80  EKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNI 139
            K  I H NI+ + G +CL+IL+ +DW+P  DL   +  +  L  EP  + PL+ D   +
Sbjct: 99  LK-KIFHPNIDLN-GNVCLNILR-EDWSPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKL 155

Query: 140 IRCGDKRAYQGIV 152
             C D++ +   V
Sbjct: 156 F-CQDQKKFAETV 167

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 138

 Score = 52.8 bits (125), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 56/107 (52%), Gaps = 4/107 (3%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MSR+ + +RL+ + L   +  + P       L  +D+  ++ W  TI GP H+ +E   +
Sbjct: 1   MSRVPRSFRLLEE-LEKGEKGMGP-ESCSYGLAHSDDITMTHWNGTILGPPHSNHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK-LQDW 106
            + I+  ++YP  PPKI F     L C ++ +TGE+  +    L+DW
Sbjct: 59  SVAIECGEAYPDQPPKIRFLSKVNLPC-VDQNTGEVKKEQFSTLRDW 104

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 52.0 bits (123), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 40  LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLD 99
           ++KW  TI GP H+ +E   + + I+   +YP +PPK+ F     L C +N +TGE+  D
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPC-VNPTTGEVQTD 59

Query: 100 ILKLQDW 106
              L+ W
Sbjct: 60  FHTLRGW 66

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 58/113 (51%), Gaps = 4/113 (3%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MS++ + +RL+ + L   +  + P       L  +D+  ++ W  TI GP H+ +E   +
Sbjct: 1   MSKVPRNFRLLEE-LEKGEKGLGP-ESCSYGLADSDDITMTNWNGTILGPPHSNHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDIL-KLQDWTPVWDL 112
            + I+   +YP  PPKI F     + C ++S+TGE+   +   L+DW   + +
Sbjct: 59  SVSIECGPNYPDEPPKIKFVSKVNVPC-VDSTTGEVKSSVFHTLRDWKRAYTM 110

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 61/119 (51%), Gaps = 4/119 (3%)

Query: 22  VNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEK 81
           V P   +   + P D +     + TIC P+   Y   +F+  +   +SYP+ PP ++  +
Sbjct: 26  VPPTVSLTTLVPPEDTSRSPLLQITIC-PDEGFYNGGRFKFNLTTSESYPIDPPSVVCLQ 84

Query: 82  DAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNII 140
             I H NI+ + G+ICL+IL+ +DW+P  D+   +  +  L  EP    PL+ D  + +
Sbjct: 85  -KIYHPNIDLN-GKICLNILR-EDWSPALDIQSVIVGLLFLFLEPNPRDPLNKDAASTL 140

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 54/107 (50%), Gaps = 8/107 (7%)

Query: 32  LNPTDETDLSKWEAT-----ICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILH 86
           L PT   D S  E++        P+   Y+   FR  +   D+YP+ PP +    + I H
Sbjct: 45  LPPTVSADTSGLESSSTLFFTIHPDEGYYKPGYFRFSLFFKDTYPIEPPAVKC-VNKIYH 103

Query: 87  CNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLD 133
            NI++  G +CL+IL+ +DW+PV DL   V  +  L  EP    PL+
Sbjct: 104 PNIDTQ-GNVCLNILR-EDWSPVLDLQSVVIGLLFLFLEPNDKDPLN 148

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 50.4 bits (119), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 67/142 (47%), Gaps = 4/142 (2%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MS++ + +RL+ + L   +  + P       L   D+  +++W  TI GP H+ +E   +
Sbjct: 1   MSKVPRSFRLLEE-LEKGEKGLGP-ESCSYGLADADDITMTRWNGTILGPPHSNHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILK-LQDWTPVWDLLHCVHAV 119
            + I+    YP  PP I F     L C ++ STGE+  +    L+DW  ++++   +  +
Sbjct: 59  SVSIECGPKYPDEPPTITFISKINLPC-VDQSTGEVNKEKFNTLKDWKRLYNMETILLDL 117

Query: 120 WRLLREPVCDSPLDVDMGNIIR 141
            + +  P     +  + G+  +
Sbjct: 118 RKEMASPANKKLVQPEEGSTFK 139

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 49.3 bits (116), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 40  LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLD 99
           ++KW  TI GP H+ +E   + + I+   +YP +PP + F     L C ++ +TGE+  +
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTFISKINLPC-VSQTTGEVQTN 59

Query: 100 ILKLQDW 106
              L+DW
Sbjct: 60  FHTLRDW 66

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 50.1 bits (118), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 4/107 (3%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MSR+ + +RL+ + L   +  + P        N  D T ++ W  TI GP H+ +E   +
Sbjct: 1   MSRVPRSFRLLEE-LEKGEKGLGPESCSYGLANGEDIT-MTTWNGTILGPPHSNHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDIL-KLQDW 106
            ++I   D YP  PP + F     L C ++ +TGE+  ++   L+DW
Sbjct: 59  SVVIKCGDEYPDKPPTVKFISKINLPC-VDQATGEVETNMFHTLRDW 104

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 4/114 (3%)

Query: 47  ICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDW 106
           +  P+   Y+  +F+  +   ++YP+ PP I+   + I H NI+   G+ICL+IL+ +DW
Sbjct: 73  LISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNIDLD-GKICLNILR-EDW 129

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERE 160
           +P  DL   +  +  L  E     PL+ +  NI+   D+  ++  V+  +A ++
Sbjct: 130 SPALDLNSIIIGLLYLFLECNAKDPLNKEAANILH-SDEDMFRKYVRDSMAGKK 182

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 4/114 (3%)

Query: 47  ICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDW 106
           +  P+   Y+  +F+  +   ++YP+ PP I+   + I H NI+   G+ICL+IL+ +DW
Sbjct: 74  LISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNIDLD-GKICLNILR-EDW 130

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERE 160
           +P  DL   +  +  L  E     PL+ +  NI+   D+  ++  V+  +A ++
Sbjct: 131 SPALDLNSIIIGLLYLFLECNAKDPLNKEAANILH-SDEDMFRKYVRDSMAGKK 183

>AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL087C
           (MMS2); 1-intron
          Length = 138

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 4/107 (3%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MS++ + +RL+ + L   +  + P       L   D+  ++ W  TI GP H+ +E   +
Sbjct: 1   MSKVPRSFRLLEE-LEKGEKGMGP-ESCSYGLADGDDISMTHWNGTILGPPHSSHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDIL-KLQDW 106
            ++I+    YP  PPK+ F     L C ++ STGE+  +    L+DW
Sbjct: 59  SVVIECGAEYPDRPPKVRFISRINLPC-VDPSTGEVRPEAFHALRDW 104

>NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 bp,
           138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 52/107 (48%), Gaps = 4/107 (3%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MS++ + +RL+ + L   +  + P       L  +D+  ++KW  TI GP H+ +E   +
Sbjct: 1   MSKVPRNFRLLEE-LEKGEKGLGP-ESCSYGLADSDDITMTKWNGTILGPPHSNHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEI-CLDILKLQDW 106
            + I     YP APP I F     L C ++  TGE+       L+DW
Sbjct: 59  SVAIHCGPHYPDAPPTIKFVSKINLPC-VDEKTGEVKQASFHTLRDW 104

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 54/106 (50%), Gaps = 3/106 (2%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MS++ + +RL+ + L   +  + P       L  +D+  ++ W  TI GP H+ +    +
Sbjct: 1   MSKVPRSFRLLEE-LEKGEKGMGP-ESCSYGLADSDDISMTNWNGTILGPPHSNHSNRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDW 106
            + I+   SYP  PP + F     L+C ++S+TG +  D   +++W
Sbjct: 59  SLSIECGPSYPDEPPTLKFISKINLNC-VDSATGVVKPDFNPIKNW 103

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 56/113 (49%), Gaps = 4/113 (3%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MS++ + +RL+ + L   +  + P       L  +D+  ++ W  TI GP H+ +E   +
Sbjct: 1   MSKVPRSFRLLEE-LEKGEKGLGP-ESCSYGLADSDDISMTTWNGTILGPPHSNHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDIL-KLQDWTPVWDL 112
            + I+   +YP  PP I F     L C ++S TG++       L+DW   +++
Sbjct: 59  SLSIECGPNYPDHPPTIKFISKINLPC-VDSKTGQVTPSTFHTLRDWKRAYNM 110

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 6/100 (6%)

Query: 37  ETDLSKWEATI---CGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSST 93
           ET+    EAT+     P+   Y+   F   +   DSYP+ PP I+     I H NI+ + 
Sbjct: 134 ETNSITSEATLYLRISPDEGFYKHGHFGFSVSFKDSYPIDPP-IVKCLTTIYHPNIDYN- 191

Query: 94  GEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLD 133
           G ICL++L+ +DWTPV DL   V  +  L  EP    PL+
Sbjct: 192 GNICLNVLR-EDWTPVLDLQTIVIGLLFLFLEPNPKDPLN 230

>Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {ON}
           YGL087C (MMS2) - Similar to ubiquitin conjugating
           protein family [contig 30] FULL
          Length = 101

 Score = 47.8 bits (112), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 40  LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLD 99
           ++ W  TI GP H+ +E   + + ++  ++YP  PPKI F     L C +N +TGE+  D
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISKINLPC-VNQTTGEVKRD 59

Query: 100 ILK-LQDWTPVWDL 112
               L+DW   +++
Sbjct: 60  QFSTLRDWKRSYNM 73

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 58/119 (48%), Gaps = 5/119 (4%)

Query: 46  TIC-GPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQ 104
           T+C  P   PY    F+  +   + YP+ PP  +   + I H NI+ + G+ICL+IL+ +
Sbjct: 72  TLCISPREGPYLGGAFKFNLKFNEMYPIEPPSAIC-LNKIFHPNIDLN-GKICLNILR-E 128

Query: 105 DWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNN 163
           DW+P  DL   V  +  L  +     PL+     ++   D+  +  +V+  +   E NN
Sbjct: 129 DWSPALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVL-ANDRNRFCELVQRAMLGSEINN 186

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 3/91 (3%)

Query: 50  PEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPV 109
           P+   Y+   F+      D+YP+ PPK+      I H NI+   G +CL+IL+ +DW+PV
Sbjct: 68  PDEGYYKCGHFKFCATFKDTYPIEPPKVTL-LSKIFHPNIDLQ-GNVCLNILR-EDWSPV 124

Query: 110 WDLLHCVHAVWRLLREPVCDSPLDVDMGNII 140
            D+   +  +  L  EP    PL+    +++
Sbjct: 125 LDVQSILIGLLMLFLEPNATDPLNKVAADVL 155

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 52/107 (48%), Gaps = 3/107 (2%)

Query: 34  PTDETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSST 93
           PTD++        I  P+   Y +  F   +   + YP+ PP++    + I H NI+   
Sbjct: 54  PTDQSRDPPLLRLIVSPDEGFYRKGHFTFEMTFTEKYPIEPPQVRC-MNQIFHPNIDLQ- 111

Query: 94  GEICLDILKLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNII 140
           G+ICL+IL+ +DW+P  DL   +  +  L  E     PL+    +++
Sbjct: 112 GKICLNILR-EDWSPALDLQSVIIGILFLFLEVSGRDPLNKQAASLL 157

>KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 bp,
           138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 47.8 bits (112), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 52/107 (48%), Gaps = 4/107 (3%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MS+I + +RL+ + L   +    P       L  +D+  ++ W  TI GP H+ +E   +
Sbjct: 1   MSKIPRSFRLLEE-LEKGEKGFGP-ESCSYGLADSDDITMTNWNGTILGPPHSNHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEIC-LDILKLQDW 106
            + I    +YP  PPK+ F     L C I+  TGEI   +   L+DW
Sbjct: 59  SLEIVCGPNYPDEPPKVKFVSKVNLPC-IDDKTGEIKEKEFHTLRDW 104

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 48.5 bits (114), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 50  PEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPV 109
           PE   Y    FR  +   D+YP+ PP +    + I H NI+ S G ICL++L+ +DW+PV
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKC-LNTIYHPNIDYS-GNICLNVLR-EDWSPV 139

Query: 110 WDLLHCVHAVWRLLREPVCDSPLD 133
            DL   V  +  L  EP    PL+
Sbjct: 140 MDLQTVVLGLLFLFLEPNGSDPLN 163

>KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.187
           YGL087C
          Length = 138

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 52/107 (48%), Gaps = 4/107 (3%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MS++ + +RL+ + L   +    P       L  +D+  ++KW  TI GP H+ +E   +
Sbjct: 1   MSKVPRSFRLLEE-LEKGEKGFGP-ESCSYGLADSDDITMTKWNGTILGPPHSNHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDIL-KLQDW 106
            + I   D YP  PP + F     L C ++ +TG +  +    L+DW
Sbjct: 59  SLEIVCGDRYPDEPPLVKFISKVNLPC-VDQTTGVVSAEKFHTLRDW 104

>TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 bp,
           139 aa] {ON} Anc_6.187 YGL087C
          Length = 139

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 54/107 (50%), Gaps = 4/107 (3%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           MS++ + +RL+ + L   +  + P       L   D+  +++W  TI GP H+ +E   +
Sbjct: 1   MSKVPRSFRLLEE-LEKGEKGMGP-ESCSYGLADGDDITMTRWNGTILGPPHSNHENRIY 58

Query: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEIC-LDILKLQDW 106
            + I+   +YP APP + F     L C ++  TG++   +   L+DW
Sbjct: 59  SLSIECGPNYPDAPPVLFFISKINLPC-VSPKTGQVMPSEFHLLRDW 104

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 50  PEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPV 109
           P+   Y+   F   +   + YPM PPK+    + I H NI++  G +CL+IL+ QDWTP 
Sbjct: 61  PDEGYYKGGNFTFELLFNEQYPMEPPKVKC-LNRIYHPNIDTD-GRVCLNILR-QDWTPA 117

Query: 110 WDLLHCVHAVWRLLREPVCDSPLD 133
            DL   +  +  L  E     PL+
Sbjct: 118 LDLQSVIIGLLFLFLEISGVDPLN 141

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 53/118 (44%), Gaps = 14/118 (11%)

Query: 32  LNPTDETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNIN 90
           +N  D++++  W    +   E + Y    F+  +  PD +P +PP+  F   AI H N+ 
Sbjct: 31  INLEDDSNIFVWNIGVMVLNEESIYHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV- 88

Query: 91  SSTGEICLDILK-----------LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
              G +C+ IL             + W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 89  YRDGRLCISILHQSGDPMTDELDAETWSPVQSVESVLISIVSLLEDPNISSPANVDAA 146

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 140

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 36  DETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGE 95
           D+  ++ W  TI GP H+ +E   + + I+   +YP  PP I F     L C ++ +TGE
Sbjct: 36  DDITMTNWNGTILGPPHSNHENRIYSVAIECGANYPDEPPLIKFVSKINLPC-VDQTTGE 94

Query: 96  ICLDIL-KLQDW 106
           +  D    L+DW
Sbjct: 95  VKHDQFHTLRDW 106

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 52/124 (41%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+TKEY+ I           NP   II + +   E ++ +W   I GP  TPYE  Q+  
Sbjct: 9   RLTKEYKNI---------VNNPPPFIIAAPH---EDNILEWHYVITGPPSTPYENGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKL--QDWTPVWDLLHCVHAV 119
            +  P  YP  PP I M   +     N       +CL +     + W P W ++  ++ +
Sbjct: 57  TLTFPSDYPFNPPAIRMITPNGRFKENT-----RLCLSMSDYHPEAWNPAWSVVTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 15/129 (11%)

Query: 22  VNPYRGIIE-SLNPTDETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMF 79
            NP + I    +N  D++++  W    +   E + Y    F+  +  PD +P +PP+  F
Sbjct: 20  TNPKKAIPSFHINLEDDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRF 79

Query: 80  EKDAILHCNINSSTGEICLDILK-----------LQDWTPVWDLLHCVHAVWRLLREPVC 128
              AI H N+    G +C+ IL             + W+PV  +   + ++  LL +P  
Sbjct: 80  TP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDAETWSPVQTVESVLISIVSLLEDPNI 137

Query: 129 DSPLDVDMG 137
            SP +VD  
Sbjct: 138 SSPANVDAA 146

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 58  YQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVH 117
           Y F + I   D+YPM PP +      I H NI+   G +CL++L+ +DWTP  D+   + 
Sbjct: 77  YYFNVFIK--DTYPMEPPVVKCMH-RIYHPNIDID-GNVCLNLLR-EDWTPALDIQSIII 131

Query: 118 AVWRLLREPVCDSPLDVD 135
            +  L  EP    PL+ D
Sbjct: 132 GILFLFHEPNGRDPLNKD 149

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 50  PEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPV 109
           P+   Y+   F   ++  D+YP+ PP ++     + H NI+   G++CL+IL+ +DW+P 
Sbjct: 73  PDEGFYKGGHFTFKLEFNDAYPIEPPTVIC-TSKLYHPNIDID-GKVCLNILR-EDWSPA 129

Query: 110 WDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCGDKR 146
            D+   +  +  LL EP    PL+ D   ++     R
Sbjct: 130 LDVQSIIIGLLFLLLEPNAKDPLNKDAAMMLSTDTAR 166

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 52/124 (41%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+TKEY+L+   + S  P +         L   +E ++ +W   I GP  TPY+  Q+  
Sbjct: 9   RLTKEYKLL---VESSPPFI---------LARPNEDNILEWHYIITGPPDTPYDGGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAV 119
            +  P+ YP  PP I M   +     N       +CL +       W P W +   ++ +
Sbjct: 57  TLTFPNDYPYKPPAIRMITPNGRFKENT-----RLCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           D++++  W    +   E + Y    F+  +  PD +P +PP+  F   AI H N+    G
Sbjct: 35  DDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDG 92

Query: 95  EICLDIL-----------KLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            +C+ IL             + W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 52/124 (41%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R++KEY+LI      ++PT  PY      L   +E ++ +W   I GP  TPY   Q+  
Sbjct: 9   RLSKEYKLI-----IENPT--PY-----ILARPNENNILEWHYIITGPPDTPYVGGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQD--WTPVWDLLHCVHAV 119
            +  P  YP  PP I M   +     N       +CL +       W P W +   ++ +
Sbjct: 57  TLTFPSDYPFKPPAIRMITPNGRFKENT-----RLCLSMSDYHPDLWNPGWSVATILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 14/128 (10%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           D++++  W    +   E + Y    F+  +  PD +P +PP+  F   AI H N+    G
Sbjct: 35  DDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDG 92

Query: 95  EICLDILK-----------LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCG 143
            +C+ IL             + W+PV  +   + ++  LL +P   SP +VD     R  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFRKN 152

Query: 144 DKRAYQGI 151
            ++  Q +
Sbjct: 153 PEQYKQRV 160

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           DE++L  W    +   E + Y    F+  +  P+ +P +PP+  F   AI H N+    G
Sbjct: 35  DESNLFIWNIGVMVLNEDSIYHGGYFKSQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDG 92

Query: 95  EICLDIL-----------KLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            +C+ IL             + W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 93  RLCISILHQSGDPTTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+TKEY+++ +T         PY  I    N   E+++ +W   I GP+ TPY+  Q+  
Sbjct: 9   RLTKEYKMMVETPP-------PY--ITARPN---ESNILEWHYIIIGPQDTPYDGGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAV 119
            +  P  YP  PP I M   +     N       +CL +       W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMITPNGRFKENT-----RLCLSMSDYHPDTWNPGWSVATILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON}
          Anc_7.392 YER100W
          Length = 251

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 12/77 (15%)

Query: 1  MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
          + R+TKEY+LI +         NP   I+   N   E ++ +W   I GP  TPY   Q+
Sbjct: 7  LKRLTKEYKLIVE---------NPPPYIVARPN---EDNILEWHYVITGPSDTPYSSGQY 54

Query: 61 RMLIDVPDSYPMAPPKI 77
             +  P  YP  PP I
Sbjct: 55 HGTLTFPSDYPYKPPAI 71

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 20/115 (17%)

Query: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60
           + R+TKEY+LI +         NP   +    N   E ++ +W   I GP  TPYE  Q+
Sbjct: 7   LKRLTKEYKLIVE---------NPPPYVTARPN---EDNILEWHYVITGPPETPYEGGQY 54

Query: 61  RMLIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQD--WTPVWDL 112
              +  P  YP  PP I M   +     N       +CL +       W P W +
Sbjct: 55  HGTLTFPSDYPYKPPAIRMVTPNGRFKENT-----RLCLSMSDYHPDLWNPGWSV 104

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+TKEY+++      ++PT  PY  II   N   E+++ +W   I GP  +PY   Q+  
Sbjct: 9   RLTKEYKMMM-----ENPT--PY--IIARPN---ESNILEWHYVITGPPDSPYHDGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAV 119
            +  P  YP  PP I M   +     N       +CL +       W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRFKENT-----RLCLSMSDYHPDTWNPGWSVATILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           D+++L  W    +   E + Y    F+  +  P+ +P +PP+  F   AI H N+    G
Sbjct: 35  DDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNVYRD-G 92

Query: 95  EICLDIL-----------KLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            +C+ IL             + W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 93  RLCISILHQGGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+TKEY+++ +         NP   II   N   E ++ +W   I GP  TPY+  Q+  
Sbjct: 9   RLTKEYKMMVE---------NPPPFIIARPN---EENILEWHYVISGPPDTPYDGGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAV 119
            +  P  YP  PP I M   +     N       +CL +       W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMITPNGRFKENT-----RLCLSMSDYHPDTWNPGWSVATILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 13/98 (13%)

Query: 51  EHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKL------- 103
           E + Y    F+  +  PD +P +PP   F   AI H N+    G +C+ IL         
Sbjct: 50  EESIYHGGYFKAQMKFPDDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHQSGNPTSD 107

Query: 104 ----QDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
               + W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 108 EPDEETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 145

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+TKEY+L+ +         NP   I+   N   E ++ +W   I GP  TPY+  Q+  
Sbjct: 9   RLTKEYKLMVE---------NPPPYILARPN---EDNILEWHYIITGPAETPYKGGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAV 119
            +  P  YP  PP I M   +     N       +CL +       W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRFKPNT-----RLCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+TKEY+L+ +         NP   I+   N   E ++ +W   I GP  TPY+  Q+  
Sbjct: 9   RLTKEYKLMVE---------NPPPYILARPN---EDNILEWHYIITGPADTPYKGGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAV 119
            +  P  YP  PP I M   +     N       +CL +       W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMITPNGRFKPNT-----RLCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+TKEY+L+ +         NP   I+   N   E ++ +W   I GP  TPY+  Q+  
Sbjct: 9   RLTKEYKLMVE---------NPPPYILARPN---EDNILEWHYIITGPADTPYKAGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAV 119
            +  P  YP  PP I M   +     N       +CL +       W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMITPNGRFKPNT-----RLCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 14/128 (10%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           D+++L  W    +   E + Y    F+  +  P+ +P +PP+  F   AI H N+    G
Sbjct: 35  DDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNVYRD-G 92

Query: 95  EICLDIL-----------KLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCG 143
            +C+ IL             + W+PV  +   + ++  LL +P   SP +VD     R  
Sbjct: 93  RLCISILHQGGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

Query: 144 DKRAYQGI 151
            ++  Q +
Sbjct: 153 QEQYKQRV 160

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 49/124 (39%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+ KE+    K +  D P   PY  I+   N   E+++  W   I GP  TPYE  Q+  
Sbjct: 9   RLAKEF----KAMTEDPP---PY--IMARPN---ESNILDWHYIITGPPGTPYENGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAV 119
            +  P  YP  PP I M         N       +CL +       W P W +   ++ +
Sbjct: 57  TLTFPSDYPFQPPAIRMVTPSGRFQENT-----RLCLSMSDYHPTTWNPGWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           D++++  W    +   E + Y    F+  +  P+ +P +PP+  F   AI H N+    G
Sbjct: 35  DDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDG 92

Query: 95  EICLDIL-----------KLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            +C+ IL             + W+PV  +   + ++  LL +P  +SP +VD  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+TKEY+L+ +         NP   I+   N   E ++ +W   I GP  TPY+  Q+  
Sbjct: 9   RLTKEYKLMVE---------NPPPYILARPN---EDNILEWHYIITGPADTPYKGGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAV 119
            +  P  YP  PP I M   +     N       +CL +       W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRFKPNT-----RLCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 51/112 (45%), Gaps = 14/112 (12%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           D++++  W    +   E + Y    F+  +  P+ +P +PP+  F   AI H N+    G
Sbjct: 35  DDSNIFVWNVGVMVLNEDSLYHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNVYRD-G 92

Query: 95  EICLDILK-----------LQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
            +C+ IL             + W+PV  +   + ++  LL +P   SP +VD
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVD 144

>NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa]
           {ON} Anc_6.187 YGL087C
          Length = 157

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 36  DETDLSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGE 95
           D+  ++ W  TI GP H+ +E   + + I    +YP  PP I F     L C ++  TGE
Sbjct: 53  DDITMTNWNGTILGPPHSNHENRIYSVAITCGPNYPDVPPTIKFISKINLPC-VDDVTGE 111

Query: 96  I-CLDILKLQDW 106
           +       L+DW
Sbjct: 112 VKASSFHTLRDW 123

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 50/124 (40%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R++KEY+++         T NP   I+ +     E ++  W   I GP  TPYE  Q+  
Sbjct: 9   RLSKEYKMM---------TENPPPYIVAA---PKEDNILVWHYVITGPPETPYEDGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAV 119
            +  P+ YP  PP I M   +     N       +CL +       W P W +   +  +
Sbjct: 57  TLVFPNDYPFNPPAIRMLTPNGRFRENT-----RLCLSMSDYHPDTWNPSWSVATILTGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           D++++  W    +   E + Y    F+  +  P+ +P +PP+  F   AI H N+    G
Sbjct: 35  DDSNIFVWNIGVMVLNEESIYHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDG 92

Query: 95  EICLDIL-----------KLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            +C+ IL             + W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           D++++  W    +   E + Y    F+  +  P+ +P +PP+  F   AI H N+    G
Sbjct: 35  DDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDG 92

Query: 95  EICLDIL-----------KLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            +C+ IL             + W+PV  +   + ++  LL +P  +SP +VD  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON}
           (176569..176874) [306 nt, 102 aa]
          Length = 101

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 40  LSKWEATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEI-CL 98
           ++ W  TI GP H+ +    + + I+   +YP  PPKI F     L C ++ +TGE+   
Sbjct: 1   MTYWNGTILGPPHSNHANRIYSLSIECGPNYPDEPPKIKFISRVNLPC-VDVNTGEVKPT 59

Query: 99  DILKLQDW 106
           +   L+DW
Sbjct: 60  EFHTLRDW 67

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 50/123 (40%), Gaps = 18/123 (14%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R++KEY++I +          PY   +    P DE  L +W   I GP  TPYE  Q+  
Sbjct: 9   RLSKEYKMIMENTP-------PYIIAV----PNDENIL-EWHYVITGPPDTPYEGGQYHG 56

Query: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAVW 120
            +  P  YP  PP I     +  +      T  +CL +       W P W +   ++ + 
Sbjct: 57  TLHFPPEYPFKPPAIRI---STPNGRFKQHT-RLCLSMSDYHPDTWNPSWSVATILNGLL 112

Query: 121 RLL 123
             +
Sbjct: 113 SFM 115

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           D++++  W    +   E + Y    F+  +  P+ +P +PP+  F   AI H N+    G
Sbjct: 35  DDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDG 92

Query: 95  EICLDIL-----------KLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            +C+ IL             + W+PV  +   + ++  LL +P  +SP +VD  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 50/124 (40%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+TKEY+L+ +         NP   I+   N   E ++ +W   I GP  TPY   Q+  
Sbjct: 9   RLTKEYKLMVE---------NPPPYILARPN---ENNILEWHYIITGPADTPYFEGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAV 119
            +  P  YP  PP I M   +     N       +CL +       W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRFRENT-----RLCLSMSDYHPNTWNPSWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 50/114 (43%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           D++++  W    +   E + Y    F+  +  P+ +P +PP   F   AI H N+    G
Sbjct: 35  DDSNIFSWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDG 92

Query: 95  EICLDILKL-----------QDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            +C+ IL             + W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 93  RLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 13/89 (14%)

Query: 60  FRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDIL-----------KLQDWTP 108
           F+  +  P+ +P +PP+  F   AI H N+    G +C+ IL             + W+P
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSP 117

Query: 109 VWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           V  +   + ++  LL +P  +SP +VD  
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAA 146

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 50/124 (40%), Gaps = 20/124 (16%)

Query: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62
           R+TKEY+++ +         NP   I+   N   E ++ +W   I GP  +PY   Q+  
Sbjct: 9   RLTKEYKMMNE---------NPTPFIMARPN---EANILEWHYIINGPPDSPYFEGQYHG 56

Query: 63  LIDVPDSYPMAPPKI-MFEKDAILHCNINSSTGEICLDILKLQ--DWTPVWDLLHCVHAV 119
            +  P  YP  PP I M   +     N       +CL +       W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMITPNGRFKENT-----RLCLSMSDYHPDTWNPGWSVATILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 50/114 (43%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           D++++  W    +   E + Y    F+  +  P+ +P +PP   F   AI H N+    G
Sbjct: 35  DDSNIFLWNIGVMVLNEDSIYHGGYFKAQMKFPEDFPFSPPNFRFTP-AIYHPNV-YRDG 92

Query: 95  EICLDILKL-----------QDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            +C+ IL             + W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 93  RLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 36  DETDLSKWE-ATICGPEHTPYERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTG 94
           D++++  W    +   E + Y    F+  +  P+ +P +PP+  F   AI H N+    G
Sbjct: 35  DDSNIFVWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDG 92

Query: 95  EICLDIL-----------KLQDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            +C+ IL             + W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,412,463
Number of extensions: 806932
Number of successful extensions: 1931
Number of sequences better than 10.0: 271
Number of HSP's gapped: 1704
Number of HSP's successfully gapped: 271
Length of query: 165
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 64
Effective length of database: 41,900,133
Effective search space: 2681608512
Effective search space used: 2681608512
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)