Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.4203.494ON28728715010.0
Smik_6.2283.494ON28728714640.0
YGR132C (PHB1)3.494ON28728713910.0
Skud_7.4433.494ON28728713760.0
CAGL0I10472g3.494ON28828313080.0
NCAS0E007903.494ON32728812980.0
NDAI0G009203.494ON29628412841e-180
TPHA0D032903.494ON28528312601e-176
SAKL0F02728g3.494ON28228312581e-176
KLTH0F14872g3.494ON28028312531e-175
Kpol_1017.53.494ON28328312251e-171
KAFR0C019803.494ON28328312221e-171
TDEL0D056203.494ON27928112181e-170
Kwal_55.212403.494ON28326511981e-167
TBLA0D029503.494ON28227711881e-165
KNAG0B007903.494ON28428311761e-164
ZYRO0D09900g3.494ON28328311731e-163
Ecym_12353.494ON28328311201e-155
AFR313C3.494ON28328610611e-146
KLLA0D16302g3.494ON2262139541e-131
KAFR0B042505.98ON3102417501e-98
YGR231C (PHB2)5.98ON3102387465e-98
Suva_7.5235.98ON3102387441e-97
CAGL0L06490g5.98ON3132507431e-97
Skud_7.5655.98ON3102387431e-97
Smik_16.755.98ON3102387422e-97
SAKL0G15510g5.98ON3082387394e-97
Kwal_27.127475.98ON3072387388e-97
TBLA0H022205.98ON3072387371e-96
TPHA0A050905.98ON3102387352e-96
NDAI0D025305.98ON3162417343e-96
ADL141W5.98ON3072417325e-96
Kpol_1050.615.98ON3102387301e-95
KLTH0C01672g5.98ON3072387301e-95
KNAG0A015805.98ON2882387272e-95
NCAS0F006005.98ON3132387274e-95
TDEL0G012105.98ON3092417222e-94
ZYRO0B15136g5.98ON3102387152e-93
KLLA0E15731g5.98ON3082387135e-93
KLTH0F18546g7.518ON277784740.88
KNAG0A074703.410ON18517648.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.420
         (287 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   582   0.0  
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   568   0.0  
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   540   0.0  
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   534   0.0  
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   508   0.0  
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     504   0.0  
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     499   e-180
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   489   e-176
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   489   e-176
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   487   e-175
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   476   e-171
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   475   e-171
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   473   e-170
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   466   e-167
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   462   e-165
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   457   e-164
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   456   e-163
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   436   e-155
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   413   e-146
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   372   e-131
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   293   1e-98
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   291   5e-98
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   291   1e-97
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   290   1e-97
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   290   1e-97
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   290   2e-97
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   289   4e-97
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   288   8e-97
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   288   1e-96
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   287   2e-96
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   287   3e-96
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   286   5e-96
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   285   1e-95
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   285   1e-95
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   284   2e-95
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   284   4e-95
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   282   2e-94
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   280   2e-93
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   279   5e-93
KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON} sim...    33   0.88 
KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3....    29   8.9  

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/287 (100%), Positives = 287/287 (100%)

Query: 1   MSNPSRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60
           MSNPSRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV
Sbjct: 1   MSNPSRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60

Query: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV 120
           PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV
Sbjct: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV 120

Query: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180
           LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE
Sbjct: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180

Query: 181 FTKAVEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLI 240
           FTKAVEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLI
Sbjct: 181 FTKAVEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLI 240

Query: 241 RRLEASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           RRLEASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR
Sbjct: 241 RRLEASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/287 (96%), Positives = 285/287 (99%)

Query: 1   MSNPSRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60
           MSNPSR IDIITKVALPIG+VASG+QYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV
Sbjct: 1   MSNPSRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60

Query: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV 120
           PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLP+IYQNLGLDYDERV
Sbjct: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERV 120

Query: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180
           LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE
Sbjct: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180

Query: 181 FTKAVEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLI 240
           FTKAVEQKQIAQQDAERAKF+VEKAEQERQASVIRAEGEAESAE+ISKALAKVGDGLLLI
Sbjct: 181 FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI 240

Query: 241 RRLEASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           RRLEASKDIAQTLANSSNV+YLPSQH+G+GNSE SGSPNSLLLNIGR
Sbjct: 241 RRLEASKDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/287 (94%), Positives = 283/287 (98%)

Query: 1   MSNPSRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60
           MSN ++ ID+ITKVALPIG++ASG+QYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV
Sbjct: 1   MSNSAKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60

Query: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV 120
           PWLQKAIIYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRPEVLQLP+IYQNLGLDYDERV
Sbjct: 61  PWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERV 120

Query: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180
           LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE
Sbjct: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180

Query: 181 FTKAVEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLI 240
           FTKAVEQKQIAQQDAERAKF+VEKAEQERQASVIRAEGEAESAE+ISKALAKVGDGLLLI
Sbjct: 181 FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI 240

Query: 241 RRLEASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           RRLEASKDIAQTLANSSNV+YLPSQH+G GNSE SGSPNSLLLNIGR
Sbjct: 241 RRLEASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/287 (94%), Positives = 283/287 (98%)

Query: 1   MSNPSRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60
           MSN SR ID+ITKVALPIG++A+G+QY+MYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV
Sbjct: 1   MSNASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLV 60

Query: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV 120
           PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV
Sbjct: 61  PWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERV 120

Query: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180
           LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE
Sbjct: 121 LPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPE 180

Query: 181 FTKAVEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLI 240
           FTKAVEQKQIAQQDAERAKF+VEKAEQERQASVIRAEGEAESAE+ISKALAKVGDGLLLI
Sbjct: 181 FTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLI 240

Query: 241 RRLEASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           RRLEASKDIAQTLANSSNV+YLPSQH+G+G+ + SGSPNSLLLNIGR
Sbjct: 241 RRLEASKDIAQTLANSSNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 268/283 (94%), Gaps = 1/283 (0%)

Query: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           + F+ +ITKVA+P+G+  SGLQYSMYDV+GGSRGVIFDR+ GVK  VVGEGTHFLVPWLQ
Sbjct: 6   NNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQ 65

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KAIIYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDERVLPSI
Sbjct: 66  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSI 125

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLKSIVAQFDAAELITQREI+SQKIR+ELS RANEFGI+LEDVSITHMTFGPEFTKA
Sbjct: 126 GNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKA 185

Query: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERA+F+VEKAEQERQASVIRAEGEAESAEYISKAL+KVGDGLLLIRRLE
Sbjct: 186 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLE 245

Query: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           ASK+IAQTLANS+N+ YLPS HAG G+ +  GSPN+LLLN+GR
Sbjct: 246 ASKEIAQTLANSNNITYLPSNHAG-GDKDDKGSPNTLLLNLGR 287

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  504 bits (1298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/288 (84%), Positives = 271/288 (94%), Gaps = 5/288 (1%)

Query: 3   NP---SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFL 59
           NP   ++ +++IT+VALP+G++A+GL+YSMYDVKGGSRGVIFDR++GV+++V+GEGTHFL
Sbjct: 42  NPQQGTKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFL 101

Query: 60  VPWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDER 119
           VPWLQKA+IYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP + +LP IYQNLGLDYDE+
Sbjct: 102 VPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEK 161

Query: 120 VLPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGP 179
           VLPSIGNEVLKSIVAQFDAAELITQREI+SQ+I+ ELSTRA+EFGI+LEDVSITHMTFGP
Sbjct: 162 VLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGP 221

Query: 180 EFTKAVEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLL 239
           EFTKAVEQKQIAQQDAERAKF+VEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLL
Sbjct: 222 EFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLL 281

Query: 240 IRRLEASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           IRRLEASKDIAQTLANS N+ YLP Q  G GN   SGSPNSLLLNIGR
Sbjct: 282 IRRLEASKDIAQTLANSPNITYLPGQQGGRGND--SGSPNSLLLNIGR 327

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  499 bits (1284), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 242/284 (85%), Positives = 264/284 (92%), Gaps = 2/284 (0%)

Query: 6   RFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQK 65
           +F +++TKVALPIGL+ +G+ YSMYDVKGGSRGVIFDR++GVK  VVGEGTHFLVPWLQK
Sbjct: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72

Query: 66  AIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIG 125
           A+IYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132

Query: 126 NEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAV 185
           NEVLKSIVAQFDAAELITQREI+SQ+I+ ELS RANEFG++LEDVSITHMTFGPEFTKAV
Sbjct: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192

Query: 186 EQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEA 245
           EQKQIAQQDAERAKF+VEKAEQERQASVIRAEGEAESAE+ISKALAKVGDGLLLIRRLEA
Sbjct: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252

Query: 246 SKDIAQTLANSSNVIYLPSQ--HAGSGNSEYSGSPNSLLLNIGR 287
           SKDIAQTLANS NV YLP Q  H+GSG    + SPNSLLLNIGR
Sbjct: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  489 bits (1260), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 231/283 (81%), Positives = 265/283 (93%)

Query: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           ++ +D + K+A+P+G+  SG+QY+MYDVKGGSR VIFDR++GVKQQV+GEGTHFL PWLQ
Sbjct: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KAI++DVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V QLP+IYQNLGLDYDERVLPSI
Sbjct: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLK+IVAQFDAAELITQREI+S KIR+ELS R+NEFGIKLEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182

Query: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERAKF+VE+AEQERQA+VIRAEGEAESAEYISKALAK GDGLLLIRRLE
Sbjct: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLE 242

Query: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           ASK+IA+TL+ SSNV YLPS  + +GN+E +G+PNSLLLN+GR
Sbjct: 243 ASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  489 bits (1258), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 235/283 (83%), Positives = 262/283 (92%), Gaps = 2/283 (0%)

Query: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           S+  D + ++ALPIG+  S LQYSMYDVKGG+R VIFDR++GV+QQV+GEGTHFLVPWLQ
Sbjct: 2   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           +AI+YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRPEVLQLP IYQNLGLDYDERVLPSI
Sbjct: 62  RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLK+IVAQFDAAELITQREI+SQ+IRKELS RA EF I+LEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 181

Query: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERAKF+VE+AEQERQA+VIRAEGEAESA+YISKAL+K GDGLLLIRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 241

Query: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           ASK+IAQTLANSSNV YLPS   G+G +E  GSPNSLLLN+GR
Sbjct: 242 ASKEIAQTLANSSNVTYLPSN--GAGGAEQQGSPNSLLLNLGR 282

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  487 bits (1253), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 233/283 (82%), Positives = 261/283 (92%), Gaps = 4/283 (1%)

Query: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           SR  D + K+ALP+GL AS LQYSMYDVKGGSR VIFDR++GV+QQVVGEGTHFLVPWLQ
Sbjct: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KA++YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V++LP+IYQNLGLDYDERVLPSI
Sbjct: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLK+IVAQFDAAELITQRE +SQ+IR+ELS RA+EF I+LEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181

Query: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERA+++VE AEQERQASVIRAEGEAESAEYISKALAK GDGLLLIRR+E
Sbjct: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           ASK+IA+TLANSSNV YLPS H+ S      GSPNSLLLN+GR
Sbjct: 242 ASKEIAKTLANSSNVTYLPSSHSASEQ----GSPNSLLLNLGR 280

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  476 bits (1225), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/283 (80%), Positives = 257/283 (90%), Gaps = 1/283 (0%)

Query: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           S+ ID + KVALPIG+V SG+Q+SMYDVKGGSR VIFDRI+GVKQ ++GEGTHFL+PWLQ
Sbjct: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KAIIYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V+QLP+IYQNLGLDYDERVLPSI
Sbjct: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
            NEVLK+IVAQFDAAELITQRE++S +IR EL  R+NEFGI+LEDVSITHMTFG EFTKA
Sbjct: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181

Query: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244
           VE KQIAQQDAERAKF+VEKAEQERQA+VIRAEGEAESAEYISKAL K GDGLLLIRRLE
Sbjct: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241

Query: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           ASK+IA TL+ SSNV YLP+ H G+      G+PN+LLLN+GR
Sbjct: 242 ASKEIAATLSQSSNVTYLPNGH-GNARGGSDGTPNTLLLNLGR 283

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  475 bits (1222), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/283 (81%), Positives = 259/283 (91%), Gaps = 2/283 (0%)

Query: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           +R I+++TK+A+P GL+ + + YSMYDVKGGSRGVIFDRI+GVK+ V+GEGTHFLVPWLQ
Sbjct: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KAIIYDVRTKPKSI+TNTGT+DLQMVSLTLR+LHRP V++LP IYQNLGLDYDERVLPSI
Sbjct: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLKSIVAQFDAAELITQREI+SQ+IRKE+S RANEFGIKLEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182

Query: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERA+F+VEKAEQERQASVIRAEGEAESAE ISKAL++VGDGLLLIRRLE
Sbjct: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242

Query: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           ASKDIA+TL+ SSN+ YLP      G+ +    PNSLLLNIGR
Sbjct: 243 ASKDIARTLSKSSNITYLPGGKGREGDEKT--PPNSLLLNIGR 283

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  473 bits (1218), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/281 (81%), Positives = 260/281 (92%), Gaps = 4/281 (1%)

Query: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           SR ++ + +VA+P+G+V SG+QYSMYDV+GGSR VIFDR++GV++QVVGEGTHFLVPWLQ
Sbjct: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KAI+YD+RTKPK IATNTGT+D+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPSI
Sbjct: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLK+IVAQFDAAELITQRE++SQ+IR ELS RA+EFGI+LEDVSITHMTFGPEFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181

Query: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERAKF+VEKAEQ R+ASVIRAEGEAESAEYISKALA+ GDGLLLIRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241

Query: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNI 285
           ASK+IAQTLA SSN+ YLP +    GN+E  GS NSLLLNI
Sbjct: 242 ASKEIAQTLAASSNITYLPGK--AHGNTE--GSQNSLLLNI 278

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  466 bits (1198), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 221/265 (83%), Positives = 248/265 (93%)

Query: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           SRF D + K+ALP+GL AS LQYSMYDVKGGSR VIFDR++GV+QQVVGEGTHFL+PWLQ
Sbjct: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KA+++DVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPSI
Sbjct: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLKSIVAQFDAAELITQRE +SQ+IR+ELS RA+EF I+LEDVSITHMTFG +FTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181

Query: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERA+F+VE AEQERQASVIRAEGEAESAEYISKALAK GDGLLLIRR+E
Sbjct: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 245 ASKDIAQTLANSSNVIYLPSQHAGS 269
           ASK+IA+TLANSSNV YLPS   G+
Sbjct: 242 ASKEIAKTLANSSNVTYLPSNQQGA 266

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  462 bits (1188), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/277 (80%), Positives = 248/277 (89%), Gaps = 4/277 (1%)

Query: 11  ITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYD 70
           + K+A+P+G+  S + YSMYDVKGGSR VIFDRI GVKQ VVGEGTHFLVPWLQK++I+D
Sbjct: 10  LAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFD 69

Query: 71  VRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLK 130
           +RTKPK+I TNTGTRDLQMVSLTLR+LHRP+++QLP IYQNLGLDYDERVLPSIGNEVLK
Sbjct: 70  IRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLK 129

Query: 131 SIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQI 190
           SIVAQFDAAELITQREI+SQ+IRKEL+ RANEFGI+LEDVSITHMTFGPEFTKAVEQKQI
Sbjct: 130 SIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 189

Query: 191 AQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIA 250
           AQQDAERAKF+VEKAEQERQASVIRAEGEAESAE IS+AL K GDGLLLIRRLE SK+IA
Sbjct: 190 AQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIA 249

Query: 251 QTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           +TLA S +V YLP    G GN     S NSLLLN+GR
Sbjct: 250 ETLAGSPHVTYLP----GGGNQAEDASKNSLLLNLGR 282

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  457 bits (1176), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 231/283 (81%), Positives = 260/283 (91%)

Query: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           S+ I++++K+A+P GL+     Y+MYDVKGGSRGVIFDR++GV+Q+VVGEGTHFLVPWLQ
Sbjct: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KAIIYDVR+KPKSIATNTGT+DLQMVSLTLRVLHRPEV++LP IYQ+LGLDYDERVLPSI
Sbjct: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLKSIVAQFDAAELITQRE++SQ+IR+ELSTRA EFGI+LEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181

Query: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244
           VEQKQIAQQDAERAKF+VEKAEQ RQASVIRAEGEAESAE ISKALAKVGDGLLLIRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRLE 241

Query: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           ASK+IA+TL+ SSNV YLPS  AG  +    GS N+LLLNIGR
Sbjct: 242 ASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  456 bits (1173), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 229/283 (80%), Positives = 257/283 (90%), Gaps = 3/283 (1%)

Query: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           SR  + + KVA+P+G+VASG+QYSMYDV+GGSR VIFDR++GV+Q+VVGEGTHFLVPWLQ
Sbjct: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KA+IYDVRTKPKSIATNTGT+D+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPSI
Sbjct: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLK+IVA++DAAELITQRE++S  IR ELS RA+EF I+LEDVSITHMTFGPEFTKA
Sbjct: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182

Query: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244
           VE KQIAQQDAERAKF+VEKAEQ R+ SVIRAEGEAE+AE ISKALAK GDGLLLIRRLE
Sbjct: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLE 242

Query: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           ASKDIAQTLANSSNV YLPSQ +G G     G+  SLLLN+GR
Sbjct: 243 ASKDIAQTLANSSNVTYLPSQQSGGGQ---EGTSQSLLLNLGR 282

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  436 bits (1120), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 206/283 (72%), Positives = 250/283 (88%), Gaps = 1/283 (0%)

Query: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           SRF++ I  +A+PIG+     Q  +YDV+GG+R VIFDR++GV+Q+VVGEGTHFL+PWLQ
Sbjct: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           KA+IYDVRTKPK+IATNTGT+DLQ+V+LTLRVLHRP+V+ LP IYQ LGLDYDERVLPSI
Sbjct: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLK+IVAQFDAAELITQRE++SQKIR+EL+ RA+ F IKLEDV+ITHM FG EFTK+
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181

Query: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244
           VE+KQIAQQ++ERAK++V+ AEQER A+VIRAEG+AE+AEYISKAL K GDGLL+IRRLE
Sbjct: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241

Query: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           ASK IAQTLA SSN+ YLPS   G G+ +  G+P+SLLLN+GR
Sbjct: 242 ASKKIAQTLAGSSNITYLPSSSKG-GSHDACGTPSSLLLNLGR 283

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  413 bits (1061), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 209/286 (73%), Positives = 250/286 (87%), Gaps = 7/286 (2%)

Query: 5   SRFIDIITKVALP---IGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVP 61
           SR  D + ++ LP   I L  S +Q+SMYDV+GG+R +IFDRI+GVK  VVGEGTHFL+P
Sbjct: 2   SRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIP 61

Query: 62  WLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVL 121
           WLQKAII+DVRTKP++IATNTGT+DLQMVSLTLRVLHRP+V+ L  IY+ LG DYDERVL
Sbjct: 62  WLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVL 121

Query: 122 PSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEF 181
           PSIGNEVLK+IVAQF+A+ELITQRE++SQ+IR EL+ RA+EF I+LEDVSITHMTFG EF
Sbjct: 122 PSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEF 181

Query: 182 TKAVEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIR 241
           TKAVEQKQIAQQ+++RAKF+VE+AEQER+A+VIRAEGEAE+AE+ISKAL K GDGLL+IR
Sbjct: 182 TKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIR 241

Query: 242 RLEASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287
           RLEASK IA+TLANS NV YLPS+    G +  SG+PNSLLLN+GR
Sbjct: 242 RLEASKGIAETLANSPNVTYLPSK----GQAADSGAPNSLLLNLGR 283

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  372 bits (954), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 198/213 (92%)

Query: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64
           SR  D++ ++A+P+GL  S +QYSMYDV+GG R VIFDR+ GV+Q V+GEGTHFLVPWLQ
Sbjct: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61

Query: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124
           K+I++DVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V+QLP IYQNLG+DYDERVLPSI
Sbjct: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121

Query: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184
           GNEVLK+IVAQFDAAELITQREI+SQ+IR ELS RA+EF IKLEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181

Query: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAE 217
           VEQKQIAQQDAERA+F+VEKAEQER+A+VIRAE
Sbjct: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  293 bits (750), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 192/241 (79%), Gaps = 1/241 (0%)

Query: 25  LQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 84
           LQ S+++V GG R +++ RINGV  ++  EGTHF++PWL+  I+YDVR KP+++A+ TGT
Sbjct: 53  LQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGT 112

Query: 85  RDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 144
           +DLQMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 113 KDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 172

Query: 145 REIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEK 204
           RE +S+ IR+ L  RA++F I L+DVSIT MTF PEFT+AVE KQIAQQDA+RA FIV+K
Sbjct: 173 REKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDK 232

Query: 205 AEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPS 264
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA+ LANS N + L +
Sbjct: 233 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTAREIARILANSPNRVVLDN 291

Query: 265 Q 265
           +
Sbjct: 292 E 292

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  291 bits (746), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 138/238 (57%), Positives = 191/238 (80%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ RI+GV  ++  EGTHF+ PWL   IIYDVR KP+++A+ TGT+DL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP+V+QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V+RA+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LA+S N + L ++
Sbjct: 237 EKQGMVVRAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPNRVILDNE 293

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  291 bits (744), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 137/238 (57%), Positives = 189/238 (79%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ R+NGV  ++  EGTHF+ PW+   IIYDVR KP+++A+ TGT+DL
Sbjct: 57  ALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP+V QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LANS N + L ++
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTARDIAKILANSPNRVVLDNE 293

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  290 bits (743), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 192/250 (76%), Gaps = 1/250 (0%)

Query: 16  LPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKP 75
           L +G  A     ++++V GG R +++ RI GV Q++  EGTH ++PW++  I+YDVR KP
Sbjct: 47  LVLGAGALFFNNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKP 106

Query: 76  KSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQ 135
           +++A+ TGT+DLQMV++T RVL RP V QLP+IY+ LG DYDERVLPSI NEVLK++VAQ
Sbjct: 107 RNVASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQ 166

Query: 136 FDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDA 195
           F+A++LITQRE +S+ IR  L  RA+ F I L+DVSIT+MTF PEFT+AVE KQIAQQDA
Sbjct: 167 FNASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDA 226

Query: 196 ERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLAN 255
           +RA FIV+KA QE+Q  V++A+GEA+SAE I  A+ K  D + L +RL+ +KDIA+ LAN
Sbjct: 227 QRAAFIVDKARQEKQGMVVKAQGEAKSAELIGDAIKKSRDYVEL-KRLDTAKDIAKILAN 285

Query: 256 SSNVIYLPSQ 265
           S N + L ++
Sbjct: 286 SPNRVVLDNE 295

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  290 bits (743), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 187/238 (78%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ RI+GV  ++  EGTHF+ PWL   IIYDVR KP+++A+ TGT+DL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  RA  F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LANS N + L ++
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILANSPNRVILDNE 293

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  290 bits (742), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 191/238 (80%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ RI+GV  ++  EGTHF+ PWL   I+YDVR KP+++A+ TGT+DL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGTKDL 116

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP+V+QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LA+S N + L ++
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPNRVILDNE 293

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  289 bits (739), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 135/238 (56%), Positives = 191/238 (80%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ R+ G++Q++  EGTHF VPWL+  I+YDVR KP+++A+ TGT+DL
Sbjct: 58  ALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGTKDL 117

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RPEV QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA+ L+ S N + L ++
Sbjct: 238 EKQGMVVKAQGEAQSAELIGEAIKKSKDYVEL-KRLDTAREIAEILSKSPNRVILDNE 294

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  288 bits (738), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 133/238 (55%), Positives = 191/238 (80%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           S+++V GG R +++ R+NGV+ ++  EGTHF +PWL+  I+YDVR KP+++A+ TGT+DL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP+V QLP++++ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  RA++F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  L++S N + L ++
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSSSPNKVILDNE 293

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  288 bits (737), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 137/238 (57%), Positives = 188/238 (78%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           S+++V GG R +++ R++GV  ++  EGTHF++PWLQ  IIYDVR KP+++A+ TGT+DL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP++  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  RA +F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ SKDIA+ LA SSN + L ++
Sbjct: 235 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDISKDIAKILATSSNRLVLDNE 291

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  287 bits (735), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 135/238 (56%), Positives = 186/238 (78%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ RI GV  ++  EGTHF++PW++  +IYDVR KP+++A+ TGT+DL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP V QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR  L  RA +F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +KDIA  LA S N + L ++
Sbjct: 238 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAKDIADILAKSPNRVVLDNE 294

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  287 bits (734), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 187/241 (77%), Gaps = 1/241 (0%)

Query: 25  LQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 84
           L  ++++V GG R +++ RI+GV  ++  EGTHF +PW++  IIYDVR KP+++A+ TGT
Sbjct: 59  LNSALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTGT 118

Query: 85  RDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 144
           +DLQMV++T RVL RP V QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 119 KDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 178

Query: 145 REIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEK 204
           RE +S+ IR+ L  RAN F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 179 REKVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 238

Query: 205 AEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPS 264
           A QE+Q  V+RA+GEA+SAE I  A+ K  D + L +RL+ +++IA+ LA S N + L +
Sbjct: 239 ARQEKQGMVVRAQGEAKSAELIGDAIKKSKDYVEL-KRLDTAREIARILAKSPNRVVLDN 297

Query: 265 Q 265
           +
Sbjct: 298 E 298

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  286 bits (732), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 190/241 (78%), Gaps = 1/241 (0%)

Query: 25  LQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 84
           L  S+++V GG R +++ R++GV+Q V GEGTHF++PWL+  ++YDVR+KP+++++ TGT
Sbjct: 54  LNASLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGT 113

Query: 85  RDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 144
            DLQMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 NDLQMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 145 REIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEK 204
           RE +S+ IR  L  RA+ F I L+DVSIT+MTF PEFT AVE KQ+AQQDA+RA F VEK
Sbjct: 174 RESVSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEK 233

Query: 205 AEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPS 264
           A+QE+Q+ +++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  LA S N + L +
Sbjct: 234 AKQEKQSMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAGILAASPNRVILDN 292

Query: 265 Q 265
           +
Sbjct: 293 E 293

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  285 bits (730), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 133/238 (55%), Positives = 188/238 (78%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ RI GV  ++  EGTHF++PWL+  ++YDVR KP+++A+ TGT+DL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP+V QLP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  RA  F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  LA S N + L ++
Sbjct: 240 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIADILAKSPNRVVLDNE 296

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  285 bits (730), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 188/238 (78%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           S+++V GG R +I+ R+NGV+ ++  EGTHF +PW +  I+YDVR KP+++A+ TGT+DL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP V QLP++++ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  L+ S N + L ++
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSQSPNRVILDNE 293

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  284 bits (727), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 187/238 (78%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ RI GV  ++  EGTHF++PWL+  I+YDVR KP+++A+ TGT+DL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP+V QLP++Y+ LG DYD+RVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA FIV+KA Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V++A GEA+SAE I +A+ K  D + L +RL+ +K+IA  LA S N + L ++
Sbjct: 215 EKQGMVVKAVGEAKSAELIGEAIKKSKDYVEL-KRLDTAKEIATILAASPNRVVLDNE 271

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  284 bits (727), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 186/238 (78%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           S+++V GG R +++ RI+GV  ++  EGTHF++PW++  IIYDVR KP+++A+ TGT+DL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP V  LP+IY+ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  R++ F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V+RA+GEA+SAE I +A+ K  D + L +RL+ +++IA  LA S N + L ++
Sbjct: 239 EKQGMVVRAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILAKSPNRVVLDNE 295

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  282 bits (722), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 134/241 (55%), Positives = 187/241 (77%), Gaps = 1/241 (0%)

Query: 25  LQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 84
           L  ++++V GG R +++ RI GV  ++  EGTH ++PWL+  ++YDVR KP+++A+ TGT
Sbjct: 56  LNSALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGT 115

Query: 85  RDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 144
           +DLQMV++T RVL RP V QLP+IY+ LG DY ERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 116 KDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQ 175

Query: 145 REIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEK 204
           RE +S+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 176 REKVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 235

Query: 205 AEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPS 264
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IAQ LA S N + L +
Sbjct: 236 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAQILARSPNRVILDN 294

Query: 265 Q 265
           +
Sbjct: 295 E 295

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  280 bits (715), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 187/238 (78%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ RI GV  ++  EGTH L+PW +  ++YDVR KP+++A+ TGT+DL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP+V QLP IY+ LGLDYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  V++A+G+A+SAE I +A+ K  D + L +RL+ +++IAQ L+ S N + L ++
Sbjct: 240 EKQGLVVKAQGDAKSAELIGEAIRKSKDYVEL-KRLDTAREIAQILSRSPNRVVLDNE 296

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  279 bits (713), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 187/238 (78%), Gaps = 1/238 (0%)

Query: 28  SMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTRDL 87
           ++++V GG R +++ RINGV+ ++  EGTHF++PW++  ++YDVR KP+++++ TGT+DL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 88  QMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 147
           QMV++T RVL RP V  LP IY+ LG+DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 148 ISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQ 207
           +S+ IR+ L  RA  F I L+DVSIT+MTF PEFT +VE KQIAQQDA++A F+V+KA Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 208 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSSNVIYLPSQ 265
           E+Q  +++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  L+ S N + L ++
Sbjct: 238 EKQGMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIASILSRSPNKVILDNE 294

>KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON}
           similar to uniprot|Q06179 Saccharomyces cerevisiae
           YLR454W FMP27 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 2777

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 165 IKLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAE 224
           IKL DVSI++     + TK++E     Q+ AER++    ++ ++   + ++     ES E
Sbjct: 197 IKLRDVSISY----DQLTKSIESA-YQQKAAERSEAPANESHKDHFQTNMQPVTTGESIE 251

Query: 225 YISKALAKVGDGLLLIRRLEASKD 248
           YI   L K  D + +  R   + D
Sbjct: 252 YIKSLLLKASDFVTMFDRFYVALD 275

>KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3.410
           YGR082W
          Length = 185

 Score = 29.3 bits (64), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 16/17 (94%)

Query: 183 KAVEQKQIAQQDAERAK 199
           KAV+QK++AQQDA RAK
Sbjct: 43  KAVKQKKLAQQDAARAK 59

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,739,303
Number of extensions: 1035286
Number of successful extensions: 3847
Number of sequences better than 10.0: 62
Number of HSP's gapped: 3985
Number of HSP's successfully gapped: 62
Length of query: 287
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 179
Effective length of database: 41,097,471
Effective search space: 7356447309
Effective search space used: 7356447309
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)