Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.4193.493ON1741747181e-97
YGR131W (FHN1)3.493ON1741745931e-78
Smik_6.2273.493ON1741745731e-75
Skud_7.4423.493ON1741745341e-69
Smik_16.4023.493ON1731744881e-62
Skud_16.4443.493ON1731744845e-62
YPR149W (NCE102)3.493ON1731744828e-62
CAGL0I10494g3.493ON1721754714e-60
NDAI0G009303.493ON1761764646e-59
NDAI0B058803.493ON1821824352e-54
TDEL0D056103.493ON1751754202e-52
NCAS0E008003.493ON1741744115e-51
CAGL0L08448g3.493ON1731744115e-51
KAFR0C019703.493ON1791794108e-51
Suva_16.4783.493ON1661744081e-50
SAKL0F02750g3.493ON1701743977e-49
ZYRO0D09966g3.493ON1781783978e-49
KNAG0B008003.493ON1821823787e-46
Kpol_1017.63.493ON1871873743e-45
TBLA0D029603.493ON1891443743e-45
TPHA0D032803.493ON1841843701e-44
NCAS0F035603.493ON1831493673e-44
TBLA0C044903.493ON1861503674e-44
KLLA0D16280g3.493ON1691743612e-43
KNAG0A079503.493ON1821483431e-40
KAFR0G037003.493ON1861433231e-37
Kwal_55.212383.493ON1701743185e-37
KLTH0F14850g3.493ON1711752986e-34
AFR312W3.493ON1681222639e-29
Ecym_12363.493ON1691742325e-24
Kwal_26.87968.676ON79626691.2
SAKL0H06534g8.676ON80426672.3
Kwal_23.46502.61ON38535653.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.419
         (174 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   281   1e-97
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   233   1e-78
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   225   1e-75
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   210   1e-69
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   192   1e-62
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   191   5e-62
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   190   8e-62
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   186   4e-60
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   183   6e-59
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   172   2e-54
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   166   2e-52
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   162   5e-51
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   162   5e-51
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   162   8e-51
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   161   1e-50
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   157   7e-49
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   157   8e-49
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   150   7e-46
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   148   3e-45
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   148   3e-45
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   147   1e-44
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   145   3e-44
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   145   4e-44
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   143   2e-43
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   136   1e-40
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   129   1e-37
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   127   5e-37
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   119   6e-34
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   105   9e-29
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...    94   5e-24
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    31   1.2  
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    30   2.3  
Kwal_23.4650 s23 (802842..803999) [1158 bp, 385 aa] {ON} YDL218W...    30   3.9  

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  281 bits (718), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 144/174 (82%), Positives = 144/174 (82%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLSVADNIVRIINAIF              QTKHSSRVNFCMFAAAYGLLTDSFYGCLAN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
           LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           KAAVVFFYFSCILFLIKVVVSIAAMVQN                QMGIPTISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  233 bits (593), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 114/174 (65%), Positives = 126/174 (72%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLS ADN+VRIINA+F              QTKHSSRVNFCMFAA YGL+TDS YG LAN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
            W+SLTYP I+ VLDFLNF+FTF+A TALAVGIRCHSC NKTYL+ NKI QGS SRCHQ+
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +AAV FFYFSC LFLIKV V+   M+QN                QMGIPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  225 bits (573), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 109/174 (62%), Positives = 123/174 (70%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLS ADN++RIINA+F              Q KHSSRVNFCMF AAYGL+TDS YG LAN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
            WSSLTYP I+  LD LNF+FTF+A TALAVGIRCHSC NKTYL+ NKITQ S SRCHQ+
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +AAV FFYFSC LFLIKV V+ A  +QN                Q+G+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  210 bits (534), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 114/174 (65%), Positives = 127/174 (72%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLS ADN++RI++A+F              QT  SSRVNFCMFAAAYGL+TDSFYG LAN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
            WSSLTYP I+ VLDFLNFLFTF A TALAVGIRCHSC NKTYL+ N ITQGS SRCHQ+
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +AAV FFYFSC LFLIKV VS+A M+QN                QMG+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  192 bits (488), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 95/174 (54%), Positives = 118/174 (67%), Gaps = 1/174 (0%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           ML++ADNI+RIIN +F              Q KHSSRVN+CMFA AYG+ TDS YG  AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
               L +P+++F LDFLNF+FTF AGT LAVGIR HSC+N +Y+D+NKITQGSG+RC QA
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +AAV F YFSC +FL K ++SI  M+ N                Q+G+PTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISN-GAFGSGSFSKRRRTGQVGVPTISQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  191 bits (484), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 119/174 (68%), Gaps = 1/174 (0%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           ML+ ADNI+RIIN +F              Q ++SSRVNFCMFAAAYG+ TDS YG  AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
            +  L +P+++F LDFLNF+FTF AGT LAVGIR HSC+N++Y+D+N ITQGSG+RC QA
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +AAV F YFSC +FL K ++S+  M+ N                Q+G+PTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISN-GAFGSGSFSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  190 bits (482), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 118/174 (67%), Gaps = 1/174 (0%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           ML++ADNI+RIIN +F              Q +HSSRVN+CMFA AYG+ TDS YG  AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
               L +P+++F LDFLNF+FTF AGT LAVGIR HSC+N +Y+D+NKITQGSG+RC QA
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +AAV F YFSC +FL K ++S+  M+ N                Q+G+PTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISN-GAFGSGSFSKRRRTGQVGVPTISQV 173

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  186 bits (471), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 92/175 (52%), Positives = 120/175 (68%), Gaps = 4/175 (2%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLSVADN++RI+NA+F              + +HSSRVNFC+FAAAYG+ TDS YG  AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNN-KITQGSGSRCHQ 119
            +  L +P+++FVLDFLNF+FTF AGT LAVGIR HSC+NK YL+   KI QGSG+RC Q
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           A+A V FFYFS  +FL K+++SI ++V N                ++G+P+ISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSN---GAFGAKLRRKHHTEVGVPSISQV 172

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  183 bits (464), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 89/176 (50%), Positives = 119/176 (67%), Gaps = 2/176 (1%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLSVADN++R++NA+F              Q  H+SR+N+CMF   Y LLTDSF+G LAN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
            +  L++P I+F LDFLNF FTF+AGT LA GIR HSC+N++YLD NKITQGSG+RC ++
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXX--XXQMGIPTISQV 174
           +A V FFYFS  +FLIK+ +S  +M+QN                  ++G+P+ISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  172 bits (435), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 87/182 (47%), Positives = 117/182 (64%), Gaps = 8/182 (4%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLS  DNI+R+INAIF              Q  +SSR+NFCMFAAA+GLLTDSF+G   N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  LWSSL-TYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119
           ++ +L ++P+++F+ DFLNF+FTF AGT LAV IR HSC N+ Y+++N ITQGS +RC  
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNX-------XXXXXXXXXXXXXXXQMGIPTIS 172
           ++AAV FFYFSC +FL K+++S   M  N                       ++G+PTIS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 173 QV 174
           QV
Sbjct: 181 QV 182

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  166 bits (420), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 89/175 (50%), Positives = 114/175 (65%), Gaps = 1/175 (0%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           ML++ DN +R++N  F              +  HSSRVNFCMFAAA+G++TDSFYG LAN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
           +W    +PVI+F LDFLNF FTF A TALAVGIR HSC N+ YLD+N ITQGS  RC  A
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXX-XXXXXXXXXXXXXXQMGIPTISQV 174
           +A+V FFYFS  +FL K+++S+  ++ N                 Q+G+PTISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  162 bits (411), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 110/174 (63%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           ML VADN++RI+NA+F              +T ++SR+N+CMF  AY L TDS YG  AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
            +  L  P + F LDFLNF FTF+AGT LA GIR HSC ++ Y+++NKITQG  +RC ++
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +A V FFYFS  +FL K+++S   M+QN                ++G+P+ISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  162 bits (411), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 110/174 (63%), Gaps = 1/174 (0%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           ML+V DN++RI+N +F              + +HSSRVN+CMFAAAYG+ TDS YG  AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
            +  L +P+I+F LDFLNF F   AG  LAVGIR HSC+N  Y +NNKI QGS  RC ++
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +AAV FF+FS  +FL K+++S+  +  N                ++G+P++SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSN-GAFGTKFIRRRRNNAEVGVPSVSQV 173

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  162 bits (410), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 109/179 (60%), Gaps = 5/179 (2%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQT-KHSSRVNFCMFAAAYGLLTDSFYGCLA 59
           ML VADNI+R+INA+F              Q   H+SRVN+CMFA A+GL  DS YG  A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NLWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119
           N +  L +P+++F LDFLNF FTF A TALAVGIR HSC N++YLD+NKI +GSG RC +
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQM----GIPTISQV 174
           A+A V F YFS  +F+ K+++S   + QN                      G+P ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  161 bits (408), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 109/174 (62%), Gaps = 8/174 (4%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           ML+  DNI+RIIN +F              Q+ +SSR+N+CMFA AY ++TDS YG  AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
            +  L +P+I+F LDFLNF+FTF A       IR HSC N+TYL +N ITQGSG+RC +A
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +AAV F YFSC +FL K ++S+  M+ N                Q+G+PTISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISN-GAFGSGSFSKRRRTGQVGVPTISQV 166

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  157 bits (397), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 107/174 (61%), Gaps = 4/174 (2%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLS+ DN +R++N  F              Q +HS RVNF +F AA+ L+TDSFY   AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
           L+S+  +P+++   DFLNF+FTF A TALAVGIR HSC+N++YL +N ITQGS  RC +A
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +A V F YFS  +FL K+V+S    V N                 +G+PTISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLS----VINVFSSGAFGSGSGSRRANVGVPTISQV 170

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  157 bits (397), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 118/178 (66%), Gaps = 4/178 (2%)

Query: 1   MLSVADNIVRIIN-AIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLA 59
           ML++ DNI+R +N   F              +  H+SRVNFCMFAAA+G++ DSFYG LA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NLWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119
           N++    +PVI+F+LDFLNF+FTF A TALAVGIR HSC+N+ YLD+NKITQGS SRC +
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQ---MGIPTISQV 174
           A+A V FFYF+  +FL K+V+S  +++ N                Q   +G+PTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  150 bits (378), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 101/182 (55%), Gaps = 8/182 (4%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           ML VADN++R++N  F              Q  H SRVN+CMFAAAYG+ TD  YG LAN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
            W  L +P+I+F LDFLNF FT  AG  LAVGIR HSC N  Y + N I QGS +RC  +
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQM--------GIPTIS 172
           +AA  FF+FS  +F+ K+V+S   +  N                          G+P+IS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 173 QV 174
           QV
Sbjct: 181 QV 182

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  148 bits (374), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 84/187 (44%), Positives = 111/187 (59%), Gaps = 13/187 (6%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLS+ADNI+R IN  F              +  HSSRVN+CMF   + ++TDSFYG LAN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  LWSS-LTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119
           +W++   +P+I+F  DFLNF FTF AGT L+VGIR HSC N+ Y+DNNKI QGS  RC +
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXX------------XXXXXXXQMG 167
           A+A++ FFYFS  +F +KVV+S   ++ N                            Q+G
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 168 IPTISQV 174
           +P ISQV
Sbjct: 181 VPNISQV 187

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  148 bits (374), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 92/144 (63%), Gaps = 2/144 (1%)

Query: 1   MLSVADNIVRIIN-AIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLA 59
           ML + DN+ RI N   F                 HSSRVN+CMF  A+GL++DSFYG LA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NL-WSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCH 118
           NL      +P I+F  DFLNF+FTF AGT LAVGIR HSC+NK Y   N I QGS  RC 
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 QAKAAVVFFYFSCILFLIKVVVSI 142
           +A+A + FFYFS  LFL+KV++++
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITL 144

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  147 bits (370), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 112/184 (60%), Gaps = 10/184 (5%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           ML +ADNI+R +N  F              Q +HSSRVN+C+F   + L+TD+FYG LAN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  LWSS-LTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119
           +WS+ L +P+I+F  DFLNF FTF AGT LAVG R HSC+N++YLD+N ITQGS  RC +
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 AKAAVVFFYFSCILFLIKVVVS---------IAAMVQNXXXXXXXXXXXXXXXXQMGIPT 170
           A+AA  FFYFS  +FL K+++S         + +M                   Q+G+P 
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 171 ISQV 174
           ISQV
Sbjct: 181 ISQV 184

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  145 bits (367), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 83/149 (55%), Positives = 104/149 (69%), Gaps = 1/149 (0%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLS  DN +R  N IF              Q   SSRVN+CMFAAA+GLLTDSF+G  AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  LWSSLT-YPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119
           L   L+ +P+I+FV DFLNF+FTF AGT LAVGIRCHSC+N+ YL++NKI QGSG RC  
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQN 148
           ++AAV FFYF+  +FL K+++S  +M  N
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASN 149

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  145 bits (367), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 73/150 (48%), Positives = 97/150 (64%), Gaps = 2/150 (1%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTK-HSSRVNFCMFAAAYGLLTDSFYGCLA 59
           MLS   N++RIIN  F              + + HS RVN+CMFAA + L+TDSFY   A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NLWSS-LTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCH 118
           N W S   +P++++  DFLNF FTF AGT L+VGIR HSC NK YL +NKITQGS  RC 
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 QAKAAVVFFYFSCILFLIKVVVSIAAMVQN 148
            A+A++ F+YFS  ++L+++V S   M +N
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWEN 150

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  143 bits (361), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 105/174 (60%), Gaps = 5/174 (2%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLS+ DN +R +N +F              Q   SSRVNF +FAA +G++ DS Y  +AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
             S+L +P+I+  LDFLN++FTF A TALAVGIR  SC+N ++   NKI +GS  RC +A
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +A+ VF YFS  +FL+K ++SI   + +                Q+G+PTISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITS-----GAFGTSSNRKTQVGVPTISQV 169

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  136 bits (343), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 99/148 (66%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           ML++AD  +R++N +F              Q  HSSR+N+CMF AAYG+ TDSFYG +AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
            W  L++P+++  LDFLNF+FT  AG  LAVGIR HSC N  Y + NKI QGS +RC QA
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQN 148
           +AAV FF+FS  +FL K ++S+  +  N
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTN 148

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  129 bits (323), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 74/143 (51%), Positives = 99/143 (69%), Gaps = 1/143 (0%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKH-SSRVNFCMFAAAYGLLTDSFYGCLA 59
           ML++ADN +R++N  F              +  H S+RVN+CMFA A+G+LTDS YG  A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NLWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119
           N +  L +P+I+FV DFLNF+F F AGT LAVGIR H+C+N+ Y ++NKI +GS +RC  
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 AKAAVVFFYFSCILFLIKVVVSI 142
           A+AAV FFYFS  +FL+K V SI
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSI 143

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  127 bits (318), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 105/174 (60%), Gaps = 4/174 (2%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLS+ DN +R  N +F              +  ++ +VNF +FAAA+GLL D+ Y   AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
             S+L +P+++ V DFLNF+FTF A TALAV IR HSC+N  Y+DNNK+TQGS  RC +A
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +A+V F YF+  +FL+K+ +S+     N                 +G+PTISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLV----NVFSVGAFSTSSGRKSANVGVPTISQV 170

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  119 bits (298), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 104/175 (59%), Gaps = 5/175 (2%)

Query: 1   MLSVADNIVRIIN-AIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLA 59
           MLS+ DN +R +N A                +T ++ +VNF +F AA+GLL DS Y   A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NLWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119
           N  S+L +P+++ V DFLNF+FTF A TALAV IR HSC+N+ YLD+N +TQGS  RC +
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           A+A+V F YFS  +FL K+ +S+     N                 +G+PTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLV----NLISVGAFGAGSSRRTGNVGVPTISQV 171

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  105 bits (263), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 70/122 (57%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLS+ DN +R +N +F              Q    SRVNF +F A + L+TDSFY  +AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
             S+  +P+I   LD LN +FTF A TAL   I  HSCSN+ +LD N I++ S  RC + 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 KA 122
           +A
Sbjct: 121 QA 122

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score = 94.0 bits (232), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 90/174 (51%), Gaps = 5/174 (2%)

Query: 1   MLSVADNIVRIINAIFXXXXXXXXXXXXXXQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60
           MLS+ DN +R  N +F              Q +  SRVNF +F A + LL DS Y  LAN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120
             S+L +P+++   D LN +FTF A TAL   I  HSCSN  +L  N I++G   RC + 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNXXXXXXXXXXXXXXXXQMGIPTISQV 174
           +A+ VF +FS  +FL K V+S   +V                    G+PTISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRKTGG-----GVPTISQV 169

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score = 31.2 bits (69), Expect = 1.2,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 19/26 (73%)

Query: 95  CHSCSNKTYLDNNKITQGSGSRCHQA 120
           CH+ +N +YL+N K+TQG+ +  H+ 
Sbjct: 669 CHAGTNLSYLNNVKLTQGTKALLHEG 694

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score = 30.4 bits (67), Expect = 2.3,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 95  CHSCSNKTYLDNNKITQGSGSRCHQA 120
           CHS +N +YL+N ++TQG+    H+ 
Sbjct: 666 CHSGTNVSYLNNCRLTQGTKVLLHEG 691

>Kwal_23.4650 s23 (802842..803999) [1158 bp, 385 aa] {ON} YDL218W -
           1:1 [contig 5] FULL
          Length = 385

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 107 NKITQGSGSR-CHQAKAAVVFFYFSCILFLIKVVV 140
           N+ T  S SR CH  KAA+ F   + +LF+I  V+
Sbjct: 198 NRYTTNSYSRPCHSGKAAIAFAGLATLLFMITPVL 232

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.332    0.139    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,706,335
Number of extensions: 418560
Number of successful extensions: 1568
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1554
Number of HSP's successfully gapped: 34
Length of query: 174
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 72
Effective length of database: 41,785,467
Effective search space: 3008553624
Effective search space used: 3008553624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 62 (28.5 bits)