Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.4183.492ON83183131440.0
Skud_7.4413.492ON80762318030.0
Smik_6.2263.492ON83962117580.0
YGR130C3.492ON81649917180.0
NCAS0E008103.492ON6924708841e-107
CAGL0I10516g3.492ON8134738021e-93
SAKL0F02772g3.492ON7734707885e-92
NDAI0G009403.492ON6564916633e-75
TDEL0D056003.492ON7002666111e-67
KLTH0F14828g3.492ON8363066126e-67
ZYRO0D09988g3.492ON9943165861e-62
Kpol_480.143.492ON6993195741e-62
KLLA0D16236g3.492ON8714945751e-61
Kwal_55.212293.492ON7872995224e-55
TPHA0D042503.492ON6292744943e-52
KNAG0B008103.492ON7572723566e-34
Ecym_12373.492ON7273053361e-31
KAFR0C019603.492ON5632672885e-26
AFR310C3.492ON6232652512e-21
TBLA0C044803.492ON802942004e-15
KNAG0A079403.492ON2751671641e-11
KAFR0G036903.492ON3631281296e-07
NCAS0F035503.492ON4411161191e-05
NDAI0B058603.492ON681921083e-04
YMR183C (SSO2)6.258ON29592870.060
Smik_13.3886.258ON29592840.14
AGL058Cna 1ON969141820.48
Skud_13.3496.258ON29592780.75
Suva_13.3082.406ON133956781.2
Kwal_26.79022.502ON532133771.3
KLTH0F14498g3.479ON70284781.3
TDEL0F047508.351ON70569771.5
KNAG0D021008.157ON168774771.8
KLLA0F07997g7.101ON1119109762.0
KLTH0G11550g8.351ON70169762.1
NCAS0A093801.282ON1018119743.8
Ecym_7269na 1ON980133744.1
Suva_13.3646.258ON29663725.1
Ecym_24785.123ON96183725.7
KNAG0F001301.19ON36381716.0
ZYRO0G01584g7.101ON1088145718.2
Kpol_1044.137.101ON1103186718.5
TBLA0B096504.366ON23468698.7
SAKL0H14894g8.351ON72377718.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.418
         (831 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...  1215   0.0  
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   699   0.0  
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   681   0.0  
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   666   0.0  
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   345   e-107
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   313   1e-93
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   308   5e-92
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   259   3e-75
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   239   1e-67
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   240   6e-67
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   230   1e-62
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   225   1e-62
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   226   1e-61
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   205   4e-55
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   194   3e-52
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   141   6e-34
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   134   1e-31
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...   115   5e-26
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...   101   2e-21
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    82   4e-15
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    68   1e-11
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    54   6e-07
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    50   1e-05
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    46   3e-04
YMR183C Chr13 complement(626921..627808) [888 bp, 295 aa] {ON}  ...    38   0.060
Smik_13.388 Chr13 complement(611342..612229) [888 bp, 295 aa] {O...    37   0.14 
AGL058C Chr7 complement(599289..602198) [2910 bp, 969 aa] {ON} N...    36   0.48 
Skud_13.349 Chr13 complement(601023..601910) [888 bp, 295 aa] {O...    35   0.75 
Suva_13.308 Chr13 (506450..510469) [4020 bp, 1339 aa] {ON} YMR12...    35   1.2  
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    34   1.3  
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...    35   1.3  
TDEL0F04750 Chr6 complement(893402..895519) [2118 bp, 705 aa] {O...    34   1.5  
KNAG0D02100 Chr4 (351677..356740) [5064 bp, 1687 aa] {ON} Anc_8....    34   1.8  
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    34   2.0  
KLTH0G11550g Chr7 (971803..971833,971902..973976) [2106 bp, 701 ...    34   2.1  
NCAS0A09380 Chr1 (1859233..1862289) [3057 bp, 1018 aa] {ON} Anc_...    33   3.8  
Ecym_7269 Chr7 complement(566660..569602) [2943 bp, 980 aa] {ON}...    33   4.1  
Suva_13.364 Chr13 complement(607107..607997) [891 bp, 296 aa] {O...    32   5.1  
Ecym_2478 Chr2 (933106..935991) [2886 bp, 961 aa] {ON} similar t...    32   5.7  
KNAG0F00130 Chr6 complement(7147..8238) [1092 bp, 363 aa] {ON} A...    32   6.0  
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    32   8.2  
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    32   8.5  
TBLA0B09650 Chr2 (2286336..2287040) [705 bp, 234 aa] {ON} Anc_4....    31   8.7  
SAKL0H14894g Chr8 (1291462..1293633) [2172 bp, 723 aa] {ON} simi...    32   8.9  

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score = 1215 bits (3144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/831 (76%), Positives = 634/831 (76%)

Query: 1   MLFNTSRQEDDPFTQLIXXXXXXXXXXXXXEKPYQFLQKVVSNEPKGKEDWVSPFRQDAL 60
           MLFNTSRQEDDPFTQLI             EKPYQFLQKVVSNEPKGKEDWVSPFRQDAL
Sbjct: 1   MLFNTSRQEDDPFTQLINQSSAQNQQVQQQEKPYQFLQKVVSNEPKGKEDWVSPFRQDAL 60

Query: 61  SGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTKNE 120
           SGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTKNE
Sbjct: 61  SGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTKNE 120

Query: 121 ERQYQXXXXXXXXXXXXXXXXXXXXITDLTGXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           ERQYQ                    ITDLTG                             
Sbjct: 121 ERQYQLLTELELKEKHLKYLKKCQKITDLTGDANDDTTSTTSSSSSLSSSDDEDTASATA 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEEEQKENAGETTPTVETTADNEKEIQEPE 240
                                         IEEEQKENAGETTPTVETTADNEKEIQEPE
Sbjct: 181 PAENETATTATTTATSTTSAAGDSADEATSIEEEQKENAGETTPTVETTADNEKEIQEPE 240

Query: 241 TFKDEQNLAEPAVAEITPVTARSDIPESAVAAASDDVPEVAVANTSDNVPEVTVAAASDX 300
           TFKDEQNLAEPAVAEITPVTARSDIPESAVAAASDDVPEVAVANTSDNVPEVTVAAASD 
Sbjct: 241 TFKDEQNLAEPAVAEITPVTARSDIPESAVAAASDDVPEVAVANTSDNVPEVTVAAASDE 300

Query: 301 XXXXXXXXXXXQXXXXXXXXXXXXXXEGKGEVADVEEETEQSSADEHGXXXXXXXXXXXX 360
                      Q              EGKGEVADVEEETEQSSADEHG            
Sbjct: 301 VPEEAVAPIEEQTEKTSVVKTDTVTKEGKGEVADVEEETEQSSADEHGEETSTPETSEAE 360

Query: 361 XDGDITPIDPSKAPKVPFQERPQKERTGFFALWXXXXXXXXXXXXXXXXLNPVATPENPE 420
            DGDITPIDPSKAPKVPFQERPQKERTGFFALW                LNPVATPENPE
Sbjct: 361 SDGDITPIDPSKAPKVPFQERPQKERTGFFALWKSPTSSSAKKGAATAPLNPVATPENPE 420

Query: 421 LIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQID 480
           LIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQID
Sbjct: 421 LIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQID 480

Query: 481 EIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEV 540
           EIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEV
Sbjct: 481 EIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEV 540

Query: 541 LNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEI 600
           LNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEI
Sbjct: 541 LNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEI 600

Query: 601 DNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQE 660
           DNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQE
Sbjct: 601 DNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQE 660

Query: 661 NANERTHLSAITKKLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 720
           NANERTHLSAITKKLEDERRAH                                      
Sbjct: 661 NANERTHLSAITKKLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAELEHE 720

Query: 721 XXITQVKKTYNDQLTELQDKXXXXXXXXXXVKRERTKLQGEKAIEEQTRQKNADEILKQT 780
             ITQVKKTYNDQLTELQDK          VKRERTKLQGEKAIEEQTRQKNADEILKQT
Sbjct: 721 EQITQVKKTYNDQLTELQDKLAAEEEELEAVKRERTKLQGEKAIEEQTRQKNADEILKQT 780

Query: 781 ILDKQHKQATGLHAAENRVNTPSSNLQESKRAVPKNDSLYEYHTEEDVMYA 831
           ILDKQHKQATGLHAAENRVNTPSSNLQESKRAVPKNDSLYEYHTEEDVMYA
Sbjct: 781 ILDKQHKQATGLHAAENRVNTPSSNLQESKRAVPKNDSLYEYHTEEDVMYA 831

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/623 (61%), Positives = 438/623 (70%), Gaps = 33/623 (5%)

Query: 211 IEEEQKENAGETTPTVETTADNEKEIQEPETFKDEQNLAEPAVAEITPVTARSDIPESAV 270
           IEEEQ + A ETT   +  A N +  QEP   K+E ++AEP     T VT + D+PE AV
Sbjct: 216 IEEEQDDKASETTSVEKAAAGNGEGAQEPVALKNEGSVAEP-----TAVTTQVDVPEPAV 270

Query: 271 AAASDDVPEVAVANTSDNVPEVTVAAASDXXXXXXXXXXXXQXXXXXXXXXXXXXXEGKG 330
            + S+ VPE AV  T ++  E +V                                EG+ 
Sbjct: 271 TSQSN-VPESAVLPTEESKSETSVV------------------------KEVNPTEEGQT 305

Query: 331 E-VADVEEE-TEQSSADEHGXXXXXXXXXXXXXDGDITPIDPSKAPKVPFQERPQKERTG 388
           E V D E+E +EQSS +EHG               D  PIDPSKAPKVPF+ERP+KERTG
Sbjct: 306 EEVHDEEDEKSEQSSVEEHGEETSTPETSEAESVEDKAPIDPSKAPKVPFKERPKKERTG 365

Query: 389 FFALWXXXXXXXXXXXXXXXXLNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQA 448
            FALW                 NPVATPENPELIVKTKEHGYLSKAVYDKINYDEK+HQA
Sbjct: 366 IFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQA 425

Query: 449 WLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQI 508
           WL DL+A+EKAKYDA +T Y E+LQDLQNQIDEIENSMK +R+ETS+KIEV+KNRLVKQI
Sbjct: 426 WLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQI 485

Query: 509 IDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDW 568
           ID+NT HNNKKLMIFKDTENMK QKL+EK+EVL KQT VKSEIDELNS K+NVQKEFNDW
Sbjct: 486 IDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDW 545

Query: 569 TTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVL 628
           TTNLS+LSQQLDAQIFKINQINLKQSK QNEID L+K+K+DLI QTEENKKLHE+NV+ L
Sbjct: 546 TTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTL 605

Query: 629 ESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERTHLSAITKKLEDERRAHXXXXXX 688
           ESVENKEYLPQINDID Q+STLLN+MTIIRQENANE+T LSAITK+LEDERRAH      
Sbjct: 606 ESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAHEEQLKL 665

Query: 689 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITQVKKTYNDQLTELQDKXXXXXXXX 748
                                             ITQVK+TYNDQLTELQDK        
Sbjct: 666 EAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQLTELQDKLAAEEKEL 725

Query: 749 XXVKRERTKLQGEKAIEEQTRQKNADEILKQTILDKQHKQATGLHAAENRVNTPSSNLQE 808
             VKRERT+LQGEKAIEEQTRQK++DE LKQ IL KQHKQA GLHAAE + N P+S+  +
Sbjct: 726 EAVKRERTRLQGEKAIEEQTRQKSSDEALKQEILGKQHKQAEGLHAAE-KHNIPNSHSPK 784

Query: 809 SKRAVPKNDSLYEYHTEEDVMYA 831
           ++  VPK+DSLYEYHTEEDVMYA
Sbjct: 785 NEILVPKDDSLYEYHTEEDVMYA 807

 Score =  216 bits (551), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 105/153 (68%), Positives = 113/153 (73%), Gaps = 2/153 (1%)

Query: 1   MLFNTSRQEDDPFTQLIXXXXXXXX--XXXXXEKPYQFLQKVVSNEPKGKEDWVSPFRQD 58
           MLFNT+RQ++DPFTQLI               EKPYQFLQKVVSNEPKGKE+WVSPFRQD
Sbjct: 1   MLFNTNRQDEDPFTQLINQSSANAQNQREQQEEKPYQFLQKVVSNEPKGKEEWVSPFRQD 60

Query: 59  ALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTK 118
           ALS NQNNRLYV DAKN+KFPTVSATS YSKQQP+DLGYKNIPK+ KRAKDI+FPTYLTK
Sbjct: 61  ALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTK 120

Query: 119 NEERQYQXXXXXXXXXXXXXXXXXXXXITDLTG 151
           NEERQYQ                    ITDLT 
Sbjct: 121 NEERQYQLLTELELKEKHLKYLKECQKITDLTS 153

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/621 (59%), Positives = 433/621 (69%), Gaps = 4/621 (0%)

Query: 211 IEEEQKENAGETTPTVETTADNEKEIQEPETFKDEQNLAEPAVAEITPVTARSDIPESAV 270
           IEE+Q + A E+T   E+T+ N+  ++E  +  DE N+AE ++++ T  + + ++PE A 
Sbjct: 223 IEEKQGDKASESTSIEESTSKNDNNVREAASLNDEGNVAESSISKTTADSTQMNVPEPAA 282

Query: 271 AAASDDVPEVAVANTSDNVPEVTVAAASDXXXXXXXXXXXXQXXXXXXXXXXXXXXEGKG 330
            +  D   +V  ++   + P     +               +              +   
Sbjct: 283 TSQRDTSAQVVTSSNDASEPHTKSESGISKSDIIPTEELKEETVVAKKISSAV---KSTE 339

Query: 331 EVADVEEETEQSSADEHGXXXXXXXXXXXXXDGDITPIDPSKAPKVPFQERPQKERTGFF 390
           E     EETEQSS +E G             + D  PIDPSKAPKVPFQERP+K +TG F
Sbjct: 340 EEEGEGEETEQSSVEEPGEETSTPGTSESESEEDKVPIDPSKAPKVPFQERPRKGKTGIF 399

Query: 391 ALWXXXXXXXXXXXXXXXXLNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWL 450
           ALW                 NPVATPE PELIVKTKEHGYLSKAVYDKINYDEK+HQAWL
Sbjct: 400 ALWKSSTSSSAQKSNTAAPSNPVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWL 459

Query: 451 VDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIID 510
            DLRAREKAKYDAKN EY+EKLQDLQNQIDE+E+SMK +R+ETS+KIEV+KNRLVKQIID
Sbjct: 460 TDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIID 519

Query: 511 INTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTT 570
           +N  HNNKKLMIFKDTENMK QKLEEKN VLNKQTNVKS+IDELNSEK+NVQK+FNDWTT
Sbjct: 520 VNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTT 579

Query: 571 NLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLES 630
           NLS+LSQQLDAQIFKINQINLKQSK Q+EID+LE++K  L+TQT+EN+KLHEKNV+VLES
Sbjct: 580 NLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLES 639

Query: 631 VENKEYLPQINDIDTQISTLLNQMTIIRQENANERTHLSAITKKLEDERRAHXXXXXXXX 690
           VEN+EYLPQINDID QISTLLN+MTII+QENANE+T LSAITK+LEDERRAH        
Sbjct: 640 VENREYLPQINDIDNQISTLLNEMTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEA 699

Query: 691 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITQVKKTYNDQLTELQDKXXXXXXXXXX 750
                                           ITQVKKTYNDQLTELQDK          
Sbjct: 700 EERKRKEENLLEKQRQELEEQARQAQLDHEEQITQVKKTYNDQLTELQDKLAAEEKELET 759

Query: 751 VKRERTKLQGEKAIEEQTRQKNADEILKQTILDKQHKQATGLHAAENRVNTPSSNLQESK 810
           VKRE+T+LQGEKAIEEQTRQ+NADE LKQ IL KQHKQA GLHAAE R   P+ + Q++K
Sbjct: 760 VKREKTRLQGEKAIEEQTRQRNADEALKQEILSKQHKQAEGLHAAE-RYKIPNDHPQKNK 818

Query: 811 RAVPKNDSLYEYHTEEDVMYA 831
             VPK+DSLYEYHTEEDVMYA
Sbjct: 819 NVVPKDDSLYEYHTEEDVMYA 839

 Score =  207 bits (526), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 110/153 (71%), Gaps = 3/153 (1%)

Query: 1   MLFNTSRQEDDPFTQLIXXXXXXXXXXXXXEK--PYQFLQKVVSNEPKGKEDWVSPFRQD 58
           MLFN +RQ DDPFTQLI             +K  PYQFLQKVVSNEPKGKE+W+SPFRQD
Sbjct: 1   MLFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQD 60

Query: 59  ALSGNQNN-RLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLT 117
           AL+  QNN RLYV DAKNRKFPTVSATS YSKQQP+DLGYKNIPK+ KRAKDI+FPTYLT
Sbjct: 61  ALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT 120

Query: 118 KNEERQYQXXXXXXXXXXXXXXXXXXXXITDLT 150
           +NEERQYQ                    ITDLT
Sbjct: 121 QNEERQYQLLTELELKEKHLQYLKKCQKITDLT 153

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/499 (69%), Positives = 384/499 (76%), Gaps = 1/499 (0%)

Query: 333 ADVEEETEQSSADEHGXXXXXXXXXXXXXDGDITPIDPSKAPKVPFQERPQKERTGFFAL 392
            D EEETEQSSA+E               + D +PIDPSKAPKVPFQE  +KERTG FAL
Sbjct: 319 GDAEEETEQSSAEESAERTSTPETSEPESEEDESPIDPSKAPKVPFQEPSRKERTGIFAL 378

Query: 393 WXXXXXXXXXXXXXXXXLNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVD 452
           W                 NPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWL D
Sbjct: 379 WKSPTSSSTQKSKTAAPSNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLAD 438

Query: 453 LRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDIN 512
           LRA+EK KYDAKN EYKEKLQDLQNQIDEIENSMK +REETS+KIEV+KNRLVK+IID+N
Sbjct: 439 LRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVN 498

Query: 513 TEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNL 572
            EHNNKKLMI KDTENMK QKL+EKNEVL+KQTNVKSEID+LN+EK+NVQKEFNDWTTNL
Sbjct: 499 AEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNL 558

Query: 573 SSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVE 632
           S+LSQQLDAQIFKINQINLKQ K QNEIDNLEK+K+DL+TQTEENKKLHEKNV+VLESVE
Sbjct: 559 SNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVE 618

Query: 633 NKEYLPQINDIDTQISTLLNQMTIIRQENANERTHLSAITKKLEDERRAHXXXXXXXXXX 692
           NKEYLPQINDID QIS+LLN++TII+QENANE+T LSAITK+LEDERRAH          
Sbjct: 619 NKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEE 678

Query: 693 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITQVKKTYNDQLTELQDKXXXXXXXXXXVK 752
                                         ITQVK+TYNDQLTELQDK          VK
Sbjct: 679 RKRKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQLTELQDKLATEEKELEAVK 738

Query: 753 RERTKLQGEKAIEEQTRQKNADEILKQTILDKQHKQATGLHAAENRVNTPSSNLQESKRA 812
           RERT+LQ EKAIEEQTRQKNADE LKQ IL +QHKQA G+HAAEN    P+   Q++   
Sbjct: 739 RERTRLQAEKAIEEQTRQKNADEALKQEILSRQHKQAEGIHAAENH-KIPNDRSQKNTSV 797

Query: 813 VPKNDSLYEYHTEEDVMYA 831
           +PK+DSLYEYHTEEDVMYA
Sbjct: 798 LPKDDSLYEYHTEEDVMYA 816

 Score =  208 bits (530), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 108/152 (71%), Gaps = 2/152 (1%)

Query: 1   MLFNTSRQEDDPFTQLIXXXXX--XXXXXXXXEKPYQFLQKVVSNEPKGKEDWVSPFRQD 58
           MLFN +RQEDDPFTQLI               E PYQFLQKVVSNEPKGKE+WVSPFRQD
Sbjct: 1   MLFNINRQEDDPFTQLINQSSANTQNQQAHQQESPYQFLQKVVSNEPKGKEEWVSPFRQD 60

Query: 59  ALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTK 118
           AL+  QNNR Y  DAKNRKFPTVSATS YSKQQP+DLGYKNIPK+ KRAKDI+FPTYLT+
Sbjct: 61  ALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQ 120

Query: 119 NEERQYQXXXXXXXXXXXXXXXXXXXXITDLT 150
           NEERQYQ                    ITDLT
Sbjct: 121 NEERQYQLLTELELKEKHLKYLKKCQKITDLT 152

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  345 bits (884), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/470 (42%), Positives = 284/470 (60%), Gaps = 17/470 (3%)

Query: 367 PIDPSKAPKVPFQERPQKERTGFFALWXXXXXXXXXXXXXXXXLNPVATPENPELIVKTK 426
           PIDP+ AP VPF            +L                  NPVA+P N E IVKT 
Sbjct: 235 PIDPALAPMVPF------------SLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTA 282

Query: 427 EHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSM 486
           + GYLSKAVYDKI YDE+ H+ WL D   ++  KY+AK  EYK+ LQD+ NQ+ E+ + +
Sbjct: 283 QFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLI 342

Query: 487 KQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTN 546
           ++   +T +KI+V   +LVK++ D      N K+ IF +T+ +K +KL EK  VLN  T 
Sbjct: 343 EKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTE 402

Query: 547 VKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQ 606
           VK  IDEL +EK+ V+ E+++WTTN++++  +LDA++FKI+QIN+ Q   QN+ID L  Q
Sbjct: 403 VKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQ 462

Query: 607 KKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERT 666
           K +L  +  +NK +H+ NV+++ESV+NKEYLP++NDID +I+ LLNQMTI++QENANE+ 
Sbjct: 463 KNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKV 522

Query: 667 HLSAITKKLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITQV 726
            L+ ITKKLEDERRAH                                        I  +
Sbjct: 523 QLAEITKKLEDERRAHEEQLQLEAEERKRQEENLLGKQRDELEAKANTMQVNHQQEIDAL 582

Query: 727 KKTYNDQLTELQDKXXXXXXXXXXVKRERTKLQGEKAIEEQTRQKNADEILKQTILDKQH 786
           K  Y  +L E +++          VKR++T+L+GEKA++EQ RQK+AD++LK  I +KQH
Sbjct: 583 KNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQH 642

Query: 787 KQATGLHAAE--NRVNTPSSNLQE-SKRAVP--KNDSLYEYHTEEDVMYA 831
           KQA    AA+   R +  ++  +E +  A P  K++SLY+Y TEEDVMY 
Sbjct: 643 KQAEAFSAAQLKGRKHPLAALAREITGEAKPSSKDNSLYDYETEEDVMYV 692

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (61%), Gaps = 6/86 (6%)

Query: 38  QKVVSNEPKGKEDWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGY 97
           +K+ ++E K   D+ SPFR +  + N      V + K R+FPTVSATS Y+ + P+  G+
Sbjct: 60  KKIAASEAKAMSDYASPFRAEYSNVN------VQNEKTRRFPTVSATSNYTLKNPKQKGF 113

Query: 98  KNIPKDVKRAKDIKFPTYLTKNEERQ 123
             I K    AKDI FP YLT+NE+RQ
Sbjct: 114 TTIKKGQNFAKDIYFPNYLTENEQRQ 139

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  313 bits (802), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 196/473 (41%), Positives = 284/473 (60%), Gaps = 32/473 (6%)

Query: 366 TPIDPSKAPKVPFQERPQ--KERTGFFAL---WXXXXXXXXXXXXXXXXLN-PVATPENP 419
           TP    K P++P+ E+P+  K+ + FF                      L+ P+ATPENP
Sbjct: 366 TPQPYDKVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPENP 425

Query: 420 ELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQI 479
           ELI KT+E+GY+SK +YDK+ YDE  H+ WL   +  EKAKYD K  EY  +L++LQ +I
Sbjct: 426 ELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEI 485

Query: 480 DEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNE 539
           D I  SM+ L++ET+ KIEV++N LVK+I + NT HN +K  IFK+TEN+K QK+++K E
Sbjct: 486 DMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQKIQQKKE 545

Query: 540 VLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNE 599
           +L+K   V+ EI +LN  K  V++EF+ WTTN+++L QQLDA+I K+ QI +KQ + Q E
Sbjct: 546 ILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKE 605

Query: 600 IDNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQ 659
           I+ LE QKK+   Q +  KK HE+  +V+ES ENKEYLP+I+ ID QIS LLN++ II+Q
Sbjct: 606 IEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIKQ 665

Query: 660 ENANERTHLSAITKKLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 719
           ENANE+T LS ITK+LE+ERRAH                                     
Sbjct: 666 ENANEQTELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEEKAEQQKREH 725

Query: 720 XXXITQVKKTYNDQLTELQDKXXXXXXXXXXVKRERTKLQGEKAIEEQTRQKNADEILKQ 779
              + ++K+ Y ++L                VK+++  L+ EK +EE  R +N    +K+
Sbjct: 726 EEQVRKMKEQYENELN--------------NVKKQKESLETEKLVEEHNRNEN----IKK 767

Query: 780 TILDKQHKQATGLHAAENR-VNTPSSNLQESKRAVPKNDSLYEYHTEEDVMYA 831
            +LDKQ KQA   HAA+ + + T ++N  +       ++SLYE+ TEE++MY 
Sbjct: 768 EVLDKQRKQAEAQHAAQTKSIATNAANDMQ-------DNSLYEFKTEEEIMYV 813

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 8/72 (11%)

Query: 52  VSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIK 111
           V+PF         N   Y  +AK  KFPTVSATS  + Q P++LG+K + K  KRAKDIK
Sbjct: 105 VNPFT--------NKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIK 156

Query: 112 FPTYLTKNEERQ 123
           FP YLT+NE RQ
Sbjct: 157 FPVYLTENEFRQ 168

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  308 bits (788), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 182/470 (38%), Positives = 284/470 (60%), Gaps = 19/470 (4%)

Query: 363 GDITPIDPSKAPKVPFQERPQKERTGFFALWXXXXXXXXXXXXXXXXLNPVATPENPELI 422
           G   PIDP+KAP+VPF     K +TG FALW                  P+ATP++PE I
Sbjct: 316 GLAQPIDPNKAPRVPF-----KAKTGVFALWTRSDKQD----------QPLATPQDPEYI 360

Query: 423 VKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEI 482
           V+T + GY+SKA+YDK+ YDE++HQ  L      +  KYDA   EY +KL  LQ+QIDE+
Sbjct: 361 VRT-DKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDEL 419

Query: 483 ENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLN 542
           + +M+QLR +T +KI+V+++ L K+++D+N  H + K +IFK+TEN+K QK+ E++E+  
Sbjct: 420 QATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITA 479

Query: 543 KQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDN 602
           K   VK+EI+ELN  K  V  EFN++   L  L+ QLD+++ KI ++N KQ +    I  
Sbjct: 480 KHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAE 539

Query: 603 LEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENA 662
           L ++K ++ T+T + ++LH+++  +LES++NKEYLP+IN ID+Q++TLL  +T+I+QENA
Sbjct: 540 LNQKKLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENA 599

Query: 663 NERTHLSAITKKLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 722
           N++T  +AITK+LE+ER+AH                                        
Sbjct: 600 NQKTEFAAITKRLEEERKAHEEKLRREEEERKRLEEERLQKQREELEAKAEDARLKHEEE 659

Query: 723 ITQVKKTYNDQLTELQDKXXXXXXXXXXVKRERTKLQGEKAIEEQTRQKNADEILKQTIL 782
           + Q+K+ +   L +   +          V+RE+T+L GEKAI+EQ R + AD  LKQ ++
Sbjct: 660 LRQIKEEHEKALNDANVQLAKEKEEREVVEREKTRLAGEKAIQEQERAQEADLALKQELM 719

Query: 783 DKQHKQATGLHAAE--NRVNT-PSSNLQESKRAVPKNDSLYEYHTEEDVM 829
           +K+ KQA  + AAE   +++T   S L    + + +  SLY+Y T E+++
Sbjct: 720 EKRRKQAEAVDAAEQARKISTQKKSVLSNPSQNLTRESSLYDYETVEEII 769

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 65/125 (52%), Gaps = 18/125 (14%)

Query: 1   MLFNTSRQEDDPFTQLIXXXXXXXXXXXXXEKPYQFLQKVVSNEPKGKE--DWVSPFRQD 58
           M     +Q+ DPF  L+             E+P  FL+KVV+N+ K +E  D+ SPFR  
Sbjct: 1   MSIFKKKQQVDPFAHLLQPEQPQ-------EQP-NFLRKVVTNKKKEEEEKDYSSPFR-- 50

Query: 59  ALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTK 118
               +Q   +   + K +KFPTVSATS  +     DLGYK I    +RAKDI  P YL  
Sbjct: 51  ----SQQELIAAKNVKAKKFPTVSATSGTAS--AADLGYKVIDSAKRRAKDISVPRYLKN 104

Query: 119 NEERQ 123
            +E+Q
Sbjct: 105 TDEKQ 109

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  259 bits (663), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 175/491 (35%), Positives = 267/491 (54%), Gaps = 50/491 (10%)

Query: 367 PIDPSKAPKVPFQ-----------------ERPQKERTGFFALWXXXXXXXXXXXXXXXX 409
           PIDP   P V FQ                 E  +KER                       
Sbjct: 190 PIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKER----------------------- 226

Query: 410 LNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYK 469
            NP ATP + E IVKTK+ G LSK++YD++ YD++ H+ +L   +A  + KYD K  EY+
Sbjct: 227 -NPKATPNSKEEIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYE 285

Query: 470 EKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENM 529
            +L+ L  +I      ++Q +++T  K+++    LVK++ D  +   + K+ IF +T+ +
Sbjct: 286 NELKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLI 345

Query: 530 KKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQI 589
           K++K++EK  V      V  EID+LN EK  V  EFN+WT N++++++QLDA++FKI QI
Sbjct: 346 KREKIDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQI 405

Query: 590 NLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQIST 649
           N+ Q   QN+ID L  +K  L  + E NK  H  NVE +E+V+NK+YLP++N+ID+QI+ 
Sbjct: 406 NITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQIND 465

Query: 650 LLNQMTIIRQENANERTHLSAITKKLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXX 709
           LLNQ+T+I+QENANE+  LS +T+KLE ER  H                           
Sbjct: 466 LLNQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELE 525

Query: 710 XXXXXXXXXXXXXITQVKKTYNDQLTELQDKXXXXXXXXXXVKRERTKLQGEKAIEEQTR 769
                        +T +K +Y  QL + + K          +K ++++L+G KAIE+Q R
Sbjct: 526 QKANDLQLNHETEMTNLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDR 585

Query: 770 QKNADEILKQTILDKQHKQATGLHA---AENRVN-TPSSNLQESKRAVP-----KNDSLY 820
           QK +D +LK  IL KQH+QA   +A   A+ + N +P +     +  +P     K+DSL+
Sbjct: 586 QKQSDNVLKNEILSKQHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPALSKAKDDSLF 645

Query: 821 EYHTEEDVMYA 831
           EY TEE++MY 
Sbjct: 646 EYETEEEIMYV 656

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 66/103 (64%), Gaps = 18/103 (17%)

Query: 36  FLQKVVSN---------------EPKGKEDWVSPFRQDALSGNQNNRLYVHDAKNRKFPT 80
           FLQ+V+S+               +    E+++SPFR + ++   NN+ Y+ + K ++FPT
Sbjct: 38  FLQRVISSTSSIQKTPTTSSSSKKKVSTEEYLSPFRSNLVT---NNKAYIQNEKTKRFPT 94

Query: 81  VSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTKNEERQ 123
           VSATS Y+ +  +++G+K IPKD   AKDI FP+YLT+NE+RQ
Sbjct: 95  VSATSNYTNRTSKEMGFKKIPKDKNFAKDIFFPSYLTQNEQRQ 137

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  239 bits (611), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 179/266 (67%), Gaps = 1/266 (0%)

Query: 417 ENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQ 476
           ENPE +VKTK+ GYL+K +YDKI   ++ H  W+   +  E+ K+D K  E   K+  L+
Sbjct: 346 ENPEHVVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLR 404

Query: 477 NQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEE 536
            QI EI+N M QLR +T  KIEV++N L ++  ++   H  KK  +FKDTE +K QKL E
Sbjct: 405 AQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSE 464

Query: 537 KNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKA 596
           K+ VL+KQ  V+ EIDELN EK  V++E   WT ++  LS ++DA++  + ++N+KQ   
Sbjct: 465 KDSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNT 524

Query: 597 QNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTI 656
           Q EI+ L++QK D++ Q E+N   H +N +V+E  +NK YLP++N++D QIS LL Q+T 
Sbjct: 525 QEEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTT 584

Query: 657 IRQENANERTHLSAITKKLEDERRAH 682
           IRQ  ANERT LSAITKKL+ ER  H
Sbjct: 585 IRQHCANERTELSAITKKLDKERLEH 610

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 10/81 (12%)

Query: 47  GKEDWVSPFR--QDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDV 104
           G+ D+VSPFR  Q+ LS  +         + ++FPT SA S Y   +P++LGYK I    
Sbjct: 36  GERDYVSPFRDEQEVLSAQRR--------RTQRFPTTSAASAYVNARPEELGYKKIGAGE 87

Query: 105 KRAKDIKFPTYLTKNEERQYQ 125
           KRAKDI FP YL + E++Q +
Sbjct: 88  KRAKDISFPVYLEEIEKKQLE 108

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  240 bits (612), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 125/306 (40%), Positives = 197/306 (64%), Gaps = 18/306 (5%)

Query: 367 PIDPSKAPKVPFQERPQKERTGFFALWXXXXXXXXXXXXXXXXLNPVATPENPELIVKTK 426
           P D  + P+VPF        TG FALW                  PVA+P +PE IVK  
Sbjct: 348 PKDIKETPRVPFA-------TGIFALWTRSDKRG----------QPVASPNDPEFIVKF- 389

Query: 427 EHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSM 486
           + GY+SKA+YD + Y+E IH+  + D      AKY+AK  EY+++L  L++QI E+E +M
Sbjct: 390 DKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATM 449

Query: 487 KQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTN 546
           + L+++T++KIE+++ +L  Q+ID+N EH++ K +IFK+TENMK  K+EEK  V  KQ +
Sbjct: 450 ETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAAKVEEKEGVEAKQED 509

Query: 547 VKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQ 606
           VK+E++EL   ++ +  E  +    +  L+ +LDA++  I ++N +Q++ Q  ID+L++Q
Sbjct: 510 VKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQ 569

Query: 607 KKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERT 666
           K  LI++     + H  NV VLES+ENKEYLP++N IDT+IS LL  +T+++QE AN +T
Sbjct: 570 KDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKT 629

Query: 667 HLSAIT 672
             +A++
Sbjct: 630 EFAAVS 635

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 50/89 (56%), Gaps = 11/89 (12%)

Query: 36  FLQKVVSNEPKGKEDWVSPFR-QDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQD 94
           FL KVVS E + +  + SPFR   +L+  Q  ++       +KFPTVSA+   S     D
Sbjct: 27  FLHKVVSKE-QEQSAYNSPFRTSQSLAAAQKRKM-------QKFPTVSASV--SAHSSSD 76

Query: 95  LGYKNIPKDVKRAKDIKFPTYLTKNEERQ 123
           +GYK I    +RAKDI  P YL  N+ERQ
Sbjct: 77  MGYKVIDAARRRAKDIAVPRYLQGNDERQ 105

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 49/114 (42%), Gaps = 36/114 (31%)

Query: 751 VKRERTKLQGEKAIEEQTRQKNADEILKQTILDKQHKQATGLHAAENRVNTPSSNLQESK 810
           V+RER KLQGEKAI EQ   K AD+ L++ I  + H +A  L  AE  V      + E K
Sbjct: 710 VERERVKLQGEKAIREQEEAKAADKALEEEIKQRNHSRALALDGAEAAVQKSQKEITEQK 769

Query: 811 R-------------------------------AVPK-----NDSLYEYHTEEDV 828
           +                               A PK     N SLYEY TE+++
Sbjct: 770 KTPLLPASEQKETPLLPAPVQKETPLLPAPESAQPKALTNDNSSLYEYFTEKEI 823

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  230 bits (586), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 116/316 (36%), Positives = 201/316 (63%), Gaps = 7/316 (2%)

Query: 367 PIDPSKAPKVPFQERPQKERTGFFALWXXXXXXXXXXXXXXXXLNPVATPENPELIVKTK 426
           P+D +  P+V      +K+R+  F+++                 NP+ATPENPE++VKT 
Sbjct: 450 PVDYAAVPRVVTFPEVEKKRS-IFSIFGRKKKSQNRAP------NPLATPENPEILVKTD 502

Query: 427 EHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSM 486
             G+LSKAVYDK+ Y+   H  WL +  + EK +Y+ K  +Y  +L++L+ +++++E SM
Sbjct: 503 REGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEKLEESM 562

Query: 487 KQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTN 546
           ++++++ ++ IE+   RL K+ ++   ++  KK  IF +T+ ++ QK +E +E+ ++Q  
Sbjct: 563 QEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEE 622

Query: 547 VKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQ 606
           V+ EI  LN+EK N+ +EF  WT  L+  S  LDA+++ ++ +  K +K Q +ID L  +
Sbjct: 623 VQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHK 682

Query: 607 KKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERT 666
           K  L  +   +K+ H KN + +E   NKEYLP++++ID +IS LL ++++I+QE+ANE+ 
Sbjct: 683 KAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEKL 742

Query: 667 HLSAITKKLEDERRAH 682
            L +ITKKLE ER+AH
Sbjct: 743 KLGSITKKLESERQAH 758

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 12/79 (15%)

Query: 50  DWVSPFRQDALSGNQNNRLYVHDAKNRK---FPTVSATSPYSKQQPQDLGYKNIPKDVKR 106
           ++ SPFR   L  N+       DA+ R+   FPTVS  S +SK  P++LGY+ + +  +R
Sbjct: 68  EFASPFR---LESNEK------DAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRR 118

Query: 107 AKDIKFPTYLTKNEERQYQ 125
           AKDI+FP YL +NE RQ Q
Sbjct: 119 AKDIQFPIYLRENEARQDQ 137

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  225 bits (574), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 128/319 (40%), Positives = 203/319 (63%), Gaps = 6/319 (1%)

Query: 365 ITPIDPSKAPKVPFQE-RPQKERTGFFALWXXXXXXXXXXXXXXXXLNPVATPENPELIV 423
           + PI+P +AP +     +PQ   TG  A++                 NP+++PENPE ++
Sbjct: 312 VEPINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSK----NPMSSPENPEYVI 367

Query: 424 KTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIE 483
           KTK+HGYLSKAVYDK+ YD+ +HQ WL +L   E+ KY  K TEY++ L D+Q++ID I 
Sbjct: 368 KTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIH 427

Query: 484 NSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNK 543
           + M +L+ +TSQKIEV + +LVK I+D+   HN+ K  IFK+TE MK +KL  K + ++K
Sbjct: 428 DLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISK 487

Query: 544 QTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNL 603
           Q  ++ EI+ L+ E++ V  +FN+W + L+ ++ QLDA+I  I   N ++   + E+  L
Sbjct: 488 QAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKL 547

Query: 604 EKQKKDLITQTEENKKLHEKNVEVLESVE-NKEYLPQINDIDTQISTLLNQMTIIRQENA 662
              K +L  + ++N+++H+ N E+L  +   K YLP+IN+ID +I+  L +++ I++E  
Sbjct: 548 NISKMELEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETI 607

Query: 663 NERTHLSAITKKLEDERRA 681
            E   L+ +TKKLEDER A
Sbjct: 608 EENNRLTILTKKLEDERIA 626

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/92 (45%), Positives = 56/92 (60%), Gaps = 5/92 (5%)

Query: 32  KPYQFLQKVVSNEPKGKEDWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQ 91
           + +  L+KVVS +     ++VSPFR  +     N   Y    K  +FPTVSA+S +S+  
Sbjct: 21  RSHSMLKKVVSRDHNV--EYVSPFRDPSNVQAAN---YAKAKKMERFPTVSASSHFSRMS 75

Query: 92  PQDLGYKNIPKDVKRAKDIKFPTYLTKNEERQ 123
           P +LGYKNI K  KRAKDI FP++L  NE RQ
Sbjct: 76  PNELGYKNISKSTKRAKDISFPSFLIANERRQ 107

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  226 bits (575), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 161/494 (32%), Positives = 258/494 (52%), Gaps = 35/494 (7%)

Query: 367 PIDPSKAPKVPFQERPQKER-----------TGFFALWXXXXXXXXXXXXXXXXLN---- 411
           P D + AP+VPF      +            +G FAL+                      
Sbjct: 379 PPDINSAPRVPFTPSGANKAGTAAATSGIAASGLFALFKRSKKPESSTKVAANAAAGTVV 438

Query: 412 -----PVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNT 466
                PVATPE+PELIV+T+E GY+SK+VYDK+ YDE  HQA L      +  +Y+ K  
Sbjct: 439 PGDDAPVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQ 497

Query: 467 EYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDT 526
           EY+EK+Q +Q +I E++  M+Q+R E  +K+++ +    + +++ N +H N K  ++K T
Sbjct: 498 EYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQT 557

Query: 527 ENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKI 586
           E +K Q + +K +       V+SEIDEL   K  V KE  +  + +  L+ +LD +   +
Sbjct: 558 EEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSAL 617

Query: 587 NQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQ 646
           N+   K+ +   EI  LE++K  L  + +E ++LH++NV  +ES++NKEYLP++N+I+T+
Sbjct: 618 NESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTE 677

Query: 647 ISTLLNQMTIIRQENANERTHLSAITKKLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXX 706
           IS+LL  + +I+QE AN++   S++T++LE+ER+ H                        
Sbjct: 678 ISSLLASLGLIQQEIANQKVEFSSVTRRLEEERKQHEEQLLKEKEERERLEKERLEKQRT 737

Query: 707 XXXXXXXXXXXXXXXXITQVKKTYNDQLTELQ-------DKXXXXXXXXXXVKRERTKLQ 759
                           +  +K+T+++ L E Q        +          V+RERT+LQ
Sbjct: 738 EYEKQAEEARLKHEEELANLKQTHDEALKEAQLQREAAAKQLEEEQQRREQVERERTRLQ 797

Query: 760 GEKAIEEQTRQKNADEILKQTILDKQHKQATGLHAAENRVNTPSSNLQESKRAVPK---- 815
           GEKAIE Q R    D+ L+    +K  +QA    A EN +   SSN +++K AVP     
Sbjct: 798 GEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALK--SSN-KKTKAAVPPANTT 854

Query: 816 NDSLYEYHTEEDVM 829
           N SLY+Y T E+V+
Sbjct: 855 NSSLYDYETVEEVI 868

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 50  DWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIP-KDVKRAK 108
           ++ SPFR    +  +  R      +  KFPT+S  +   +  P+ +GY  +  K VK+AK
Sbjct: 60  EYHSPFR----TAEETQR--ARQVRQEKFPTLSQGA--VQLDPEQMGYSVVTDKSVKKAK 111

Query: 109 DIKFPTYLTKNEERQ 123
           DI  P+ L   E  Q
Sbjct: 112 DIIIPSGLKDTEAEQ 126

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  205 bits (522), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 111/299 (37%), Positives = 181/299 (60%), Gaps = 18/299 (6%)

Query: 374 PKVPFQERPQKERTGFFALWXXXXXXXXXXXXXXXXLNPVATPENPELIVKTKEHGYLSK 433
           P+VPF        TG FALW                  PVA+P++PE IVK  + GY+SK
Sbjct: 327 PRVPFA-------TGIFALWTRSDKRG----------QPVASPDDPEFIVKF-DKGYMSK 368

Query: 434 AVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSMKQLREET 493
           A+YD + Y+E +H+  +         KYDAK  EY++ L  L++QI E+E +M+QL+ +T
Sbjct: 369 ALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDT 428

Query: 494 SQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDE 553
           + KI ++   L  ++I+ N +H+N K +IFK+TEN K  K++EK  V+ KQ  VK+E +E
Sbjct: 429 TDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEE 488

Query: 554 LNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQ 613
           L ++++       +  + +  L+ QLD++   I ++N +Q++ Q  ID LE+QK  L+  
Sbjct: 489 LEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVAD 548

Query: 614 TEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERTHLSAIT 672
                +LH  N+ +LE + NK+YLP+IN +D+QIS LL+ + +++QE AN+ T  +A++
Sbjct: 549 ATAADELHNSNIAILEGISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAAVS 607

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (55%), Gaps = 13/90 (14%)

Query: 36  FLQKVVSNEPKGKED--WVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQ 93
           FL+KVV+ E   +ED  + SPFR         +++     K ++FPTVSA+S        
Sbjct: 26  FLRKVVTKE---QEDATYSSPFR------TSQSQVEAQKRKVQRFPTVSASS--GGNSSA 74

Query: 94  DLGYKNIPKDVKRAKDIKFPTYLTKNEERQ 123
           ++G+K I    KRAKDI  P YL  N+ERQ
Sbjct: 75  EMGFKVIDAARKRAKDIAVPRYLQGNDERQ 104

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 54/95 (56%), Gaps = 15/95 (15%)

Query: 751 VKRERTKLQGEKAIEEQTRQKNADEILKQTILDKQHKQATGLHAAENR------------ 798
           V+RER +LQGEKAI+EQ + K AD+ L+  + ++ H +A  + AAE              
Sbjct: 682 VERERVRLQGEKAIQEQEQAKLADKALEDEVKERNHNRAQAIDAAEAARARNAKSISNNN 741

Query: 799 ---VNTPSSNLQESKRAVPKNDSLYEYHTEEDVMY 830
              ++TP  + + + +    ++SLYEY TE++V Y
Sbjct: 742 APALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRY 776

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  194 bits (494), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 117/274 (42%), Positives = 180/274 (65%), Gaps = 7/274 (2%)

Query: 413 VATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKL 472
           VA+PENPE +V+T E+  +SKAVYD++NY++K+H  WL +  A E  KY+ K  EY++KL
Sbjct: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374

Query: 473 QDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQ 532
            +LQ Q+D+IE   K    +  QKIE+ + +LVK ++D+ +++N  K  + K+TE MK Q
Sbjct: 375 VELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434

Query: 533 KLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLK 592
           K+  K ++L KQ +VK+EI++LN+EK  +  E+N W  NL +L+  LD +I KI  IN  
Sbjct: 435 KINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494

Query: 593 QSKAQNEIDNLEKQKKDL---ITQTEENKKLHEKNVEVLESVE-NKEYLPQINDIDTQIS 648
             + Q +I+ L+ +K +L   I   EE  KL   N +VL+ +   K+YLP++N+ID QI+
Sbjct: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKL---NKDVLQKLNVEKDYLPRLNEIDEQIA 551

Query: 649 TLLNQMTIIRQENANERTHLSAITKKLEDERRAH 682
              +++ II+ E  +E   LS +TKKLE+ER AH
Sbjct: 552 AKFDKLAIIKNETISENNQLSILTKKLEEERIAH 585

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 58/92 (63%), Gaps = 8/92 (8%)

Query: 36  FLQKVVSNEPKGKEDWVSPFR--QDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQ 93
           FL + +S + +  E ++SPFR  QD +  N     Y    K +KFPT SATS ++K  P 
Sbjct: 23  FLTRHISRKSENTE-YISPFRNPQDTVRSN-----YAKSLKEKKFPTTSATSNFNKMVPG 76

Query: 94  DLGYKNIPKDVKRAKDIKFPTYLTKNEERQYQ 125
           ++GY ++ K+ KRAKDI+FP YL  NE+RQ Q
Sbjct: 77  EMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQ 108

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score =  141 bits (356), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 85/272 (31%), Positives = 169/272 (62%), Gaps = 4/272 (1%)

Query: 411 NPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKE 470
           NP AT + PEL++K  ++G++S AV++K+ YD+K+H+A + D +  +++K+  K  EY++
Sbjct: 297 NPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQ 356

Query: 471 KLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMK 530
           KL  + ++   +   M   + +   K EV +N+ +KQ+ D N   N+ K+ +  + + +K
Sbjct: 357 KLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVK 416

Query: 531 KQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQIN 590
            QKL++   +  K+T ++ E+++L  EKS+ +K+++ WTTNL++++++LDAQ+FK++Q N
Sbjct: 417 LQKLQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFN 476

Query: 591 LKQSKAQNEIDNLEKQKKDLITQTEEN---KKLHEKNVEVLESVENKEYLPQINDIDTQI 647
            KQ K   +I +L ++K +L  + + N   K   ++N+  LE+ ++ +    +   D+ I
Sbjct: 477 HKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDS-I 535

Query: 648 STLLNQMTIIRQENANERTHLSAITKKLEDER 679
              L+ + +++QE + ER  L  IT ++E  R
Sbjct: 536 QGKLDSLAVVKQEISGERLKLIGITNEMERAR 567

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query: 49  EDWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAK 108
           E++VSPFR   L+     +L +   + +KFPTVSATS Y+    ++LG+  +  D +RA+
Sbjct: 46  EEYVSPFRGGQLTKASKKQLQLQ--RTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRAR 103

Query: 109 DIKFPTYLTKNEERQ 123
           DI FP YL +NE+RQ
Sbjct: 104 DIVFPEYLLENEDRQ 118

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score =  134 bits (336), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/305 (29%), Positives = 165/305 (54%), Gaps = 18/305 (5%)

Query: 372 KAPKVPFQERPQKERTGFFALWXXXXXXXXXXXXXXXXLNPVATPENPELIVKTKEHGYL 431
           K  + PF+      + G FALW                LN  ATPE+PE IV T E GY+
Sbjct: 295 KGHRGPFK----FSKKGIFALWKRSEKPEK--------LN--ATPEDPEFIVLT-EKGYM 339

Query: 432 SKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSMKQLRE 491
           SK +YD++ Y+E++HQ  L  L     AKY+     Y+EKL  L N+I E+  +M QL+ 
Sbjct: 340 SKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKS 399

Query: 492 ETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEI 551
           +T  +++  +  L + ++DI  +H+ +K  + K+ EN K  K+ EKN +  K T V+ E+
Sbjct: 400 QTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPEL 459

Query: 552 DELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLI 611
           + L   +   + E   + + + +L+ +LDA++ ++  ++ +Q++    +  LE+++  + 
Sbjct: 460 EALKRLELERKVELQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIE 519

Query: 612 TQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERTHLSAI 671
               E+  +   N E+L+++EN    P I  +D Q+S +   ++ + QE+A ++  L+ +
Sbjct: 520 KDISESNAVVANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTEL 576

Query: 672 TKKLE 676
           + K E
Sbjct: 577 STKKE 581

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score =  115 bits (288), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 155/267 (58%), Gaps = 13/267 (4%)

Query: 412 PVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEK 471
           PVA+PEN E +VK      +SK VYDKI +D K++  ++V  +  +  K +   +EY EK
Sbjct: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306

Query: 472 LQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKK 531
           ++ +Q +  +  N ++ L  E+    EV +N+LVK ++D     ++ K+ I + T  +K 
Sbjct: 307 IKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366

Query: 532 QKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINL 591
           QKL E   +  K+  ++ E + +N EK + +  FN    +L+ + Q+LDA++FK++Q N+
Sbjct: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426

Query: 592 KQSKAQNEIDNLEKQKKDLITQTE--ENKKLH-EKNVEVLESVENKEYLPQINDIDTQIS 648
           +    ++EI+ L+ +K+ L+ + +  E KKLH + + + LE          +N++D QI+
Sbjct: 427 RNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQIN 476

Query: 649 TLLNQMTIIRQENANERTHLSAITKKL 675
           + L+ + +I+QE  NE+  +S +T  L
Sbjct: 477 SKLSNLNLIKQEIINEKLKISKLTNDL 503

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 2   LFNTSRQEDDPFTQLIXXXXXXXXXXXXXEKPYQFLQKVVSNEPKGKED---WVSPFRQD 58
           +F T    D+ F +L+              K +QFL KV +N+ K  +D   + SPFR +
Sbjct: 1   MFKTRSLADEAFDKLLSETTSVKTTDTA--KKHQFLSKVNTNKSKENDDENKYNSPFRNN 58

Query: 59  ALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTK 118
           A S  Q  +L   D K  KFP VSATS Y+    +D+ YK++      A+DIKFP+ L  
Sbjct: 59  APSREQKKQL--QDLKTAKFPLVSATSTYN-TDTKDV-YKDLDPKKNFARDIKFPSRLID 114

Query: 119 NEERQYQ 125
           NE RQ Q
Sbjct: 115 NENRQNQ 121

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 143/265 (53%), Gaps = 1/265 (0%)

Query: 410 LNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYK 469
           L P  TPE PE+++ T   GY+SKAVYD++N +EK H   LV+        Y   +  Y+
Sbjct: 277 LVPNGTPEEPEVVLLTN-RGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYE 335

Query: 470 EKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENM 529
           +++ DL  +I ++   +  L+ ET  +I+  +  L K I D+  E+ +K+ ++ +  E  
Sbjct: 336 KEIADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHEQAEAQ 395

Query: 530 KKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQI 589
           + ++L +K E++++   ++ EID L   K N   E  +    +  L QQLDAQ  ++  +
Sbjct: 396 RAEQLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLV 455

Query: 590 NLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQIST 649
             +Q++    +  L++QK  L  +  ++ +  ++N E LE +   +Y   + +ID + S 
Sbjct: 456 TDQQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSE 515

Query: 650 LLNQMTIIRQENANERTHLSAITKK 674
           +L ++  IRQE   +R  L A+ ++
Sbjct: 516 ILTEIAKIRQEIEFQRKELVALKER 540

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 55/94 (58%), Gaps = 7/94 (7%)

Query: 33  PYQFLQKVVSNEP---KGKEDWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSK 89
           P   LQ  +++     KGK+ + SPFR      N N  L     KN ++PT+SATSPYS 
Sbjct: 36  PSDVLQTAINSHTLHGKGKQ-YKSPFRDTQTPSNMNVAL---KKKNHRYPTISATSPYSN 91

Query: 90  QQPQDLGYKNIPKDVKRAKDIKFPTYLTKNEERQ 123
             PQDLGYKNI    KRAKDI FP  L +NE RQ
Sbjct: 92  MTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQ 125

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 101/197 (51%), Gaps = 34/197 (17%)

Query: 410 LNPVATPENPELIVKTKEHG---YLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNT 466
           +NP ATP+NPEL+VKT+ +     LSK+VYD +NY+ K+H         R K   +  N 
Sbjct: 375 INPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHN-------KRVKDYINDSNI 427

Query: 467 EYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDT 526
           +YKEK ++  N I+E++  +K + ++      ++    +  +++ N E N+       D 
Sbjct: 428 KYKEKNEEFNNSINELDLKIKSIEKDI-----IDYKAKIDSLMNDNVEKND------IDI 476

Query: 527 ENMKKQKLEEKNEVLNKQ-------------TNVKSEIDELNSEKSNVQKEFNDWTTNLS 573
           EN  ++ L +KN+++ K                +  +  +  +++S+      DW +  S
Sbjct: 477 ENYHEKMLIKKNQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQS 536

Query: 574 SLSQQLDAQIFKINQIN 590
            L++Q+D+++  I Q+N
Sbjct: 537 KLNEQIDSKVNVIKQLN 553

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 76/167 (45%), Gaps = 24/167 (14%)

Query: 367 PIDPSKAPKVPFQERPQKERTGFFALWXXXXXXXXXXXXXXXXLNPVATPENPELIVKTK 426
           P+D  K PK+P+ E  Q     F                     NPVATPE PE +V  K
Sbjct: 96  PVDIQKVPKIPYSEYGQCNEAEF--------------------RNPVATPETPEEVVIYK 135

Query: 427 E----HGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEI 482
                +   SK ++D I  D   H AWL+    +   +   K  EY ++L  L +QI   
Sbjct: 136 HLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSE 195

Query: 483 ENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENM 529
           + +M  LR +  + I++N+NRL K  +    +   +K  I+K+TE +
Sbjct: 196 KAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKETERL 242

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 74  KNRKFPTVSATSPYSKQQPQDLGYK-NIPKDVKRAKDIKFPTYLTKNEERQ 123
           K +  P  +  S Y+  +P++LGYK   PK  K A++I FP  LT+NE RQ
Sbjct: 9   KRKSSPISNPHSSYNTLKPEELGYKQKFPK--KYAREIHFPAELTENEMRQ 57

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 71/128 (55%), Gaps = 6/128 (4%)

Query: 411 NPVATPENPE-LIVKTKEHG---YLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNT 466
           N +ATP+N E +IV  K+ G   Y SK V+D I Y+ KIH   L  L A+   ++ +K  
Sbjct: 183 NSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKIN 242

Query: 467 EYKEKLQDLQNQIDEIEN-SMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKD 525
           EY  ++ +L  +ID IEN  +++L  + S   + +  +  K  +   TE+NN K  ++ +
Sbjct: 243 EYDTQVSNLNTKID-IENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGE 301

Query: 526 TENMKKQK 533
            E +K Q+
Sbjct: 302 IEAIKNQR 309

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (53%), Gaps = 10/91 (10%)

Query: 36  FLQKVVSNEPKGKEDWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDL 95
           FL+  ++++ K    + SPFR++    N N   Y+ + KN K+   +  S ++K     +
Sbjct: 28  FLKDTIAHDAK----YQSPFRRNI---NPNYLNYIREHKNAKYTITNPNSDFNKLNLNTV 80

Query: 96  GYKNIPKDVKR---AKDIKFPTYLTKNEERQ 123
           GYK IP D K    AKDI FP  L +NEE Q
Sbjct: 81  GYKTIPTDRKSRKIAKDIDFPRSLRENEEAQ 111

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 62/116 (53%), Gaps = 2/116 (1%)

Query: 412 PVATPENPELIVKTKEH--GYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYK 469
           P+ATP+NPE++V+  E+    +SK  YD++   +  H AWL    A   A Y+ ++  Y+
Sbjct: 180 PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQ 239

Query: 470 EKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKD 525
           +++  L  +I   +     L  +  +  E+NKN+ + +   IN     +K+++ K+
Sbjct: 240 KQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQINKLIGEEKILLMKN 295

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 410 LNPVATPENPELIVKTKE-HGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEY 468
           LNP+AT  NPE+++K  +    ++K  YDK+    + H  W+++        Y+ K   Y
Sbjct: 382 LNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTY 441

Query: 469 KEKLQDLQNQIDEIENSMKQLREETSQKIEVN 500
           +EKL  L  QI+     +  ++++T +  E+N
Sbjct: 442 QEKLNKLNEQINHHNLIISMIKKDTLKNKELN 473

>YMR183C Chr13 complement(626921..627808) [888 bp, 295 aa] {ON}
           SSO2Plasma membrane t-SNARE involved in fusion of
           secretory vesicles at the plasma membrane; syntaxin
           homolog that is functionally redundant with Sso1p
          Length = 295

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 50/92 (54%), Gaps = 7/92 (7%)

Query: 556 SEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQTE 615
           +E   +Q++ N+  T  S  S    A + KIN IN   S+ +N I+ ++ Q KDL+TQ  
Sbjct: 14  AENYEMQEDLNNAPTGHSDGSDDFVAFMNKINSINANLSRYENIINQIDAQHKDLLTQVS 73

Query: 616 ENKKLHEKNVEVLESVENKEYLPQINDIDTQI 647
           E     E+ +E+  S++  +Y+ Q  D+  Q+
Sbjct: 74  E-----EQEMELRRSLD--DYISQATDLQYQL 98

>Smik_13.388 Chr13 complement(611342..612229) [888 bp, 295 aa] {ON}
           YMR183C (REAL)
          Length = 295

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 51/92 (55%), Gaps = 7/92 (7%)

Query: 556 SEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQTE 615
           +E   +Q++ N+  T  S  S    A + KIN IN   S+ ++ I++++ Q KDL+TQ  
Sbjct: 14  AENYEMQEDLNNVPTGHSDGSDDFVAFMNKINSINANLSRYESIINSIDAQHKDLLTQVS 73

Query: 616 ENKKLHEKNVEVLESVENKEYLPQINDIDTQI 647
           E     E+ +E+  S++  +Y+ Q  D+  Q+
Sbjct: 74  E-----EQEMELRRSLD--DYISQATDLQYQL 98

>AGL058C Chr7 complement(599289..602198) [2910 bp, 969 aa] {ON}
           NOHBY706; No homolog in Saccharomyces cerevisiae
          Length = 969

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 68/141 (48%), Gaps = 27/141 (19%)

Query: 514 EHNNKKLMIFKDTENMKK------QKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFND 567
           E   K+L I+KD+  ++K      Q +EEKNE + +   +K    +L  +K+ +QKE   
Sbjct: 510 ERLRKELNIYKDSPYLEKECQRLVQTIEEKNETVAQLMKIKENYRDLLVKKAAMQKELGV 569

Query: 568 WTTNLSSLSQQLDA-------QIFKINQINLKQSK----------AQNEIDNLEKQKKD- 609
              +   L +Q+ +       Q+ +++++ LKQ +           Q EI +LE Q ++ 
Sbjct: 570 LRDHAEELERQMSSMEDAHRKQVRELSKLPLKQRRKTLGFFNEKLYQEEIHSLELQLEEA 629

Query: 610 ---LITQTEENKKLHEKNVEV 627
              L+   EE  +LHEK   +
Sbjct: 630 HDKLLISAEEISELHEKIAHI 650

>Skud_13.349 Chr13 complement(601023..601910) [888 bp, 295 aa] {ON}
           YMR183C (REAL)
          Length = 295

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 7/92 (7%)

Query: 556 SEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQTE 615
           +E   +Q++ N+  T  +  S    A +  IN IN   S+ +N I+ ++ Q KDL+TQ  
Sbjct: 14  AENYEMQEDLNNTPTGHTDGSDDFVAFMNVINSINANLSRYENIINRIDAQHKDLLTQVS 73

Query: 616 ENKKLHEKNVEVLESVENKEYLPQINDIDTQI 647
           E     E+ +E+  S++  +Y+ Q  D+  Q+
Sbjct: 74  E-----EQEMELRRSLD--DYISQATDLQYQL 98

>Suva_13.308 Chr13 (506450..510469) [4020 bp, 1339 aa] {ON} YMR129W
           (REAL)
          Length = 1339

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 574 SLSQQLDAQIFKINQINLK-QSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVL 628
           S    +D+ +FK+N +N+  +  +  EID +E + +DL T   E + L +K+  V+
Sbjct: 260 SFCLPMDSSLFKVNSVNIPIRINSTEEIDLIELEYRDLYTNAIEQRSLTKKDFRVI 315

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 64/133 (48%), Gaps = 15/133 (11%)

Query: 552 DELNSEKSNV----QKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQK 607
           DEL+  K +V    ++ + DW     SL  ++   IF +N +     K   EI   ++Q+
Sbjct: 241 DELSFRKGDVIRVMEQVYRDWWRG--SLRGKIG--IFPLNYVTPVTDKTLEEICAEKRQE 296

Query: 608 KDLITQTEENKKLHEKNVEVLESVENKEYL---PQINDIDTQISTLLNQMTIIRQENANE 664
             +++Q  +  +LH+     + +  N   L   PQ+ND+ + ++ L  Q+T +    A +
Sbjct: 297 DAILSQYNKVNELHQ----TMRAGSNDVNLTQDPQVNDLYSTVTPLRPQLTKMIGTCAQK 352

Query: 665 RTHLSAITKKLED 677
           R   S++ K L D
Sbjct: 353 REDYSSLRKVLAD 365

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 9/84 (10%)

Query: 440 NYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQ-NQIDEIENSMKQLREETSQ--- 495
            YD +I Q     LRA+  A+ +A   +Y+ +L++L+  ++ ++ENS+ +LR + S+   
Sbjct: 155 GYDLEIQQ-----LRAKSTAELNAMEGDYRRQLENLRFAKVRKLENSLDELRRDISKARG 209

Query: 496 KIEVNKNRLVKQIIDINTEHNNKK 519
            I  NK     Q+ +    HN +K
Sbjct: 210 SIANNKENFESQLNECEVRHNYRK 233

>TDEL0F04750 Chr6 complement(893402..895519) [2118 bp, 705 aa] {ON}
           Anc_8.351 YDR164C
          Length = 705

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 494 SQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDE 553
           S  IE+ + +L+  I DI TEHN K L+I    EN+     +E  ++L   T V    D 
Sbjct: 2   SDLIELQREQLLGVINDIKTEHNVKFLVIDDYFENLLNYLFDEPQQLLRHVTAV----DR 57

Query: 554 LNSEKSNVQ 562
           ++S K N Q
Sbjct: 58  IDSPKRNGQ 66

>KNAG0D02100 Chr4 (351677..356740) [5064 bp, 1687 aa] {ON} Anc_8.157
            YGL197W
          Length = 1687

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 45/74 (60%), Gaps = 4/74 (5%)

Query: 535  EEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQS 594
            +E   ++N + NV SE+D ++S     Q E+N+   N+S + +QL  ++FK+  ++  + 
Sbjct: 1204 KEIGNIINDENNVSSELDIISSPSKMNQIEYNE--RNISEIEEQL--ELFKLQNLSGVEP 1259

Query: 595  KAQNEIDNLEKQKK 608
            K ++E++ LE+  K
Sbjct: 1260 KKKSELEKLERTSK 1273

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 57/109 (52%), Gaps = 21/109 (19%)

Query: 544 QTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNL 603
           + N KS+ID+L+  + + +  FN  T N+   S+ L              S+ +++++ L
Sbjct: 337 ENNCKSDIDDLSRRRYSAKTSFNSSTENIQKTSKYL--------------SECESKVNFL 382

Query: 604 EKQKKDLITQTEENKKLHEKNVEVLESVENKEYLP---QINDIDTQIST 649
             + K L    +E+ K++E+ ++ LE   NK  LP   +I+++D  +ST
Sbjct: 383 TTRNKSL----KEDIKVNEEKIKALEEERNKVVLPDPEKIHEVDENLST 427

>KLTH0G11550g Chr7 (971803..971833,971902..973976) [2106 bp, 701 aa]
           {ON} similar to uniprot|P38932 Saccharomyces cerevisiae
           YGL095C VPS45 Protein of the Sec1p family essential for
           vacuolar protein sorting required for the function of
           both Pep12p and the early endosome/late Golgi SNARE
           Tlg2p
          Length = 701

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 494 SQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDE 553
           S  IE+ +N ++  I DI TEHN K L+I      +      +KNE+L   T     ID 
Sbjct: 2   SDLIELQRNYILSFINDIKTEHNLKFLIIDDCVNALLDSLFADKNELLRAVT----AIDL 57

Query: 554 LNSEKSNVQ 562
           ++S K   Q
Sbjct: 58  IDSSKRKGQ 66

>NCAS0A09380 Chr1 (1859233..1862289) [3057 bp, 1018 aa] {ON}
           Anc_1.282 YJL084C
          Length = 1018

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 57/119 (47%), Gaps = 16/119 (13%)

Query: 509 IDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDW 568
           +DIN+ H+   LMI K   N  ++ L     V NK TN  S  D+L+S K + +K  ND 
Sbjct: 706 VDINSNHSIPSLMIPKIMVNKSQESL-----VSNKATN--SIRDQLSSNKDDSKKHDND- 757

Query: 569 TTNLSSLSQQLD-AQIFKINQINLKQSKAQNEIDNL------EKQKKDLITQTEENKKL 620
            T+L S+ +  D A  F  +  NL     +++  NL       K  +D++  T  N  +
Sbjct: 758 -TSLGSIEEDGDIASGFSFHGSNLPSGILRSQSSNLFPTANRRKSIQDILPSTIRNDTM 815

>Ecym_7269 Chr7 complement(566660..569602) [2943 bp, 980 aa] {ON}
           similar to Ashbya gossypii AGL058C
          Length = 980

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 68/133 (51%), Gaps = 27/133 (20%)

Query: 518 KKLMIFKDTENMKKQK------LEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTN 571
           K+L I+KD+  ++K+       +EEKNE +++ T +K    EL  +K+ +QKE      +
Sbjct: 534 KELNIYKDSPYLEKECQRLVAVMEEKNETISQLTQLKENYRELLVKKAAMQKELGVLRKH 593

Query: 572 LSSLSQQLDA-------QIFKINQINLKQSK----------AQNEIDNLEKQ----KKDL 610
              L +Q++        Q+ +++++++KQ +           Q EI +LE Q    +  L
Sbjct: 594 TEDLERQINTMEESHKKQLKELSKLSVKQRRKSLGFFDEKLYQEEIHSLEIQLEEARDKL 653

Query: 611 ITQTEENKKLHEK 623
           +   EE  +LH+K
Sbjct: 654 LLSVEEITELHDK 666

>Suva_13.364 Chr13 complement(607107..607997) [891 bp, 296 aa] {ON}
           YMR183C (REAL)
          Length = 296

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 7/63 (11%)

Query: 585 KINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDID 644
           KIN IN   ++ +N I+ ++ Q KDL+TQ  E     E+ +E+  S++  +Y+ Q  D+ 
Sbjct: 44  KINTINANLARYENIINRIDMQHKDLLTQVSE-----EQEMELRRSLD--DYISQATDLQ 96

Query: 645 TQI 647
            Q+
Sbjct: 97  YQL 99

>Ecym_2478 Chr2 (933106..935991) [2886 bp, 961 aa] {ON} similar to
           Ashbya gossypii ACL132C
          Length = 961

 Score = 32.3 bits (72), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 46/83 (55%), Gaps = 3/83 (3%)

Query: 522 IFKDTENMKKQKLE---EKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQ 578
           +  + E+++  K +   E+ E++ K TN +++  +LNSE   +Q + ND    L+  +  
Sbjct: 718 VLSELEDLRAHKSKWNKERQELMAKLTNFQTQTSQLNSENQTIQDQLNDVQIALNEKTMA 777

Query: 579 LDAQIFKINQINLKQSKAQNEID 601
           L ++  +I ++  + +  ++E+D
Sbjct: 778 LRSKDLQITKLKNRLATLESELD 800

>KNAG0F00130 Chr6 complement(7147..8238) [1092 bp, 363 aa] {ON}
           Anc_1.19 YDR532C
          Length = 363

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 505 VKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLN--KQTNVKSEIDELNSEKSNVQ 562
           + Q +      N+K+++  K   +MK + L+ + ++L   +    +SE+D L S  +N+ 
Sbjct: 97  LDQFLRYTISSNDKEVLGLKSIHDMKYESLKNQIKILEGERLAETRSEVDALRSSITNLS 156

Query: 563 KEFNDWTTNLSSLSQQLDAQI 583
           K  ++   ++ S+S+Q  AQI
Sbjct: 157 KTISNSERDILSISKQTSAQI 177

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 74/145 (51%), Gaps = 28/145 (19%)

Query: 512 NTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTN 571
           NT+  NK +M    +E  K +  EE  ++ ++   +++++DEL+ EK++++ + ND    
Sbjct: 636 NTQFYNKSVM----SEEQKTRINEEVAQLKSRHVGLRNDLDELSREKNDLKHQLND---- 687

Query: 572 LSSLSQQLDAQ-IFKINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLES 630
            ++L   + AQ    +N+I  K S  ++ I++LE + + +  ++                
Sbjct: 688 -NNLKNDMIAQRAHSLNEIRKKHSLTKSNIESLEVKIRQITYES---------------- 730

Query: 631 VENKEYLPQINDIDTQISTLLNQMT 655
             NK+   +I D++ +IST L + T
Sbjct: 731 --NKDVTQKIKDVEAEISTQLQKQT 753

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
           complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 32.0 bits (71), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 97/186 (52%), Gaps = 28/186 (15%)

Query: 469 KEKLQDLQNQIDEIENSMKQLREET----SQKIEVNKNRLVKQIIDINTEHNNKKLMIFK 524
           +EK   ++N+I+ +EN +K L ++T    S KI   +++L++ +     E +N   +IF+
Sbjct: 720 REKYFRVENEINSMENKLKDLEKQTQVDVSDKIREIESKLLQSV----KEESN---LIFR 772

Query: 525 DTENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIF 584
             E MKK    +K +VL+      S+++ L  E  N++K   D     S+  ++L+  + 
Sbjct: 773 MNEKMKKVYRCQK-DVLH------SDVEYL--EALNIEKSIGDIINLFSNKEKELEDVVA 823

Query: 585 KINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDID 644
            +      + + +N  ++ E+ K++  + TEE KK+ EK +E  +  +N      ++ ID
Sbjct: 824 SLKN----ELRTKNNTEDYERWKEETRSYTEERKKIIEKYIEKCKDKDN----LTVDFID 875

Query: 645 TQISTL 650
            +IS L
Sbjct: 876 REISRL 881

>TBLA0B09650 Chr2 (2286336..2287040) [705 bp, 234 aa] {ON} Anc_4.366
           YJR135C
          Length = 234

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 761 EKAIEEQTRQKNADEILKQTILDKQHKQATGLHAAENRVN----TPSSNLQESKRAVPKN 816
           +K I ++  +KN +E+L + I   +     G+  A N +N    + +  + + + ++  N
Sbjct: 50  DKGILDKKFKKNLEELLSKPIFLPERSDPIGISLASNSLNHKIKSSACLITDLQNSIDLN 109

Query: 817 DSLYEYHT 824
            +L EYHT
Sbjct: 110 SNLIEYHT 117

>SAKL0H14894g Chr8 (1291462..1293633) [2172 bp, 723 aa] {ON} similar
           to uniprot|P30619 Saccharomyces cerevisiae YDR164C SEC1
           Sm-like protein involved in docking and fusion of
           exocytic vesicles through binding to assembled SNARE
           complexes at the membrane localization to sites of
           secretion (bud neck and bud tip) is dependent on SNARE
           function
          Length = 723

 Score = 32.0 bits (71), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 486 MKQLREETSQKIEVNKNRLVKQII----DINTEHNNKKLMIFKDTENMKKQKLEEKNEVL 541
           +  LR + S  I +  N  +  I+    DI TEHN K L+I +  E +      ++NE+L
Sbjct: 13  LTCLRNQFS--IRLFTNPFITDILSFLNDIQTEHNIKFLVIDETVERLLDSLFADRNELL 70

Query: 542 NKQTNVKSEIDELNSEK 558
           N  T V    D ++S K
Sbjct: 71  NYVTAV----DRIDSTK 83

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.124    0.331 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,967,689
Number of extensions: 3005171
Number of successful extensions: 24291
Number of sequences better than 10.0: 2358
Number of HSP's gapped: 23181
Number of HSP's successfully gapped: 3962
Length of query: 831
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 713
Effective length of database: 39,950,811
Effective search space: 28484928243
Effective search space used: 28484928243
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 70 (31.6 bits)