Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.4173.490ON21219510121e-141
Skud_7.4403.490ON2131956817e-91
Smik_6.2253.490ON2131966652e-88
YGR129W (SYF2)3.490ON2151986532e-86
ZYRO0D10032g3.490ON2091952621e-27
NCAS0E008203.490ON2021982551e-26
TDEL0D055803.490ON1932002444e-25
Kpol_480.153.490ON2071922421e-24
SAKL0F02816g3.490ON1921912392e-24
CAGL0I10538g3.490ON2001901887e-17
KLTH0F14784g3.490ON1952041861e-16
Kwal_55.212263.490ON1962031852e-16
AFR308W3.490ON1921941842e-16
Ecym_12393.490ON1931941834e-16
NDAI0G009503.490ON2132001652e-13
KLLA0E04643g3.490ON2211941643e-13
TBLA0C044703.490ON2221861521e-11
TPHA0D042403.490ON2092001152e-06
KNAG0B008203.490ON20751910.002
AAR012C7.120ON25158672.5
KLTH0E06380g8.157ON157758683.1
TPHA0C010008.295ON490150665.1
NDAI0J025404.301ON70625665.6
Smik_7.2584.88ON12039626.1
TPHA0E034601.152ON31067646.4
NOTE: 1 genes in the same pillar as Suva_7.417 were not hit in these BLAST results
LIST: KAFR0C01950

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.417
         (212 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...   394   e-141
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...   266   7e-91
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...   260   2e-88
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...   256   2e-86
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...   105   1e-27
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...   102   1e-26
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....    99   4e-25
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    98   1e-24
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...    97   2e-24
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    77   7e-17
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    76   1e-16
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    76   2e-16
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    75   2e-16
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    75   4e-16
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    68   2e-13
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    68   3e-13
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    63   1e-11
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    49   2e-06
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    40   0.002
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...    30   2.5  
KLTH0E06380g Chr5 (580587..585320) [4734 bp, 1577 aa] {ON} simil...    31   3.1  
TPHA0C01000 Chr3 (214320..229025) [14706 bp, 4901 aa] {ON} Anc_8...    30   5.1  
NDAI0J02540 Chr10 complement(627186..629306) [2121 bp, 706 aa] {...    30   5.6  
Smik_7.258 Chr7 (431437..431799) [363 bp, 120 aa] {ON} YGL029W (...    28   6.1  
TPHA0E03460 Chr5 (731135..732067) [933 bp, 310 aa] {ON} Anc_1.15...    29   6.4  

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score =  394 bits (1012), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 195/195 (100%), Positives = 195/195 (100%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKSDDKDRAFHYTVQEYNAW 77
           VDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKSDDKDRAFHYTVQEYNAW
Sbjct: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKSDDKDRAFHYTVQEYNAW 77

Query: 78  EQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSRI 137
           EQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSRI
Sbjct: 78  EQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSRI 137

Query: 138 EKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFINDKN 197
           EKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFINDKN
Sbjct: 138 EKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFINDKN 197

Query: 198 KQFNEKLGRESRGSE 212
           KQFNEKLGRESRGSE
Sbjct: 198 KQFNEKLGRESRGSE 212

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  266 bits (681), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 160/195 (82%), Gaps = 1/195 (0%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASDD-ELVRETKSDDKDRAFHYTVQEYNA 76
           V+ S+K RKLADREIQEA  NRKP+VYSMED +D  E V + ++ DKD+AFHYTVQEYNA
Sbjct: 18  VNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYNA 77

Query: 77  WEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSR 136
           W+QKQ QRK+G+ Q +GNSYDQ+AKLSY+KTLRNL TQN  K+E+SVN+ DS  S     
Sbjct: 78  WKQKQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNLVTQNSNKNENSVNKNDSNSSPKNGA 137

Query: 137 IEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFINDK 196
           I KIQ+N  TGKI IVDDD+LVNKLA TLES+SKKR++AR++QMEN KTPS VESFINDK
Sbjct: 138 IHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFINDK 197

Query: 197 NKQFNEKLGRESRGS 211
           NKQFNEKL RE + S
Sbjct: 198 NKQFNEKLSREPKDS 212

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  260 bits (665), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 161/196 (82%), Gaps = 1/196 (0%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASD-DELVRETKSDDKDRAFHYTVQEYNA 76
           V+ S+K RKLADREIQEA+ NRKPRVY+MED +D DE V  T+S DKDRAFHYT QEY A
Sbjct: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77

Query: 77  WEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSR 136
           WEQ+  QRK G+++ +G SYDQLAKLSY+KTLRNL TQ+  ++++ VNEKD K     SR
Sbjct: 78  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 137

Query: 137 IEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFINDK 196
           I++IQK++ TGKIRI DD +LVNKLA +LES+SKKR++ARKRQME+   PSGVESFINDK
Sbjct: 138 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 197

Query: 197 NKQFNEKLGRESRGSE 212
           NKQFNEKL RESR SE
Sbjct: 198 NKQFNEKLSRESRNSE 213

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score =  256 bits (653), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 164/198 (82%), Gaps = 3/198 (1%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASD-DELVRETKSDDKDRAFHYTVQEYNA 76
           VD S+K+RKLADREIQE S+NRKPRVYSMED +D DE V +T+S +K++AFHYTVQEY+A
Sbjct: 18  VDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDA 77

Query: 77  WEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQ--NYGKHESSVNEKDSKGSLGK 134
           WE++  Q K+G++Q  G SYDQLAKLSY+KTLRNL TQ  N  K +SS +E+D+K    K
Sbjct: 78  WERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKK 137

Query: 135 SRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFIN 194
            RI K+QK++ TGKI I DDD+LVNKLA +L+S+SKKR++ARKRQM+N KT  GVESFIN
Sbjct: 138 GRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFIN 197

Query: 195 DKNKQFNEKLGRESRGSE 212
           DKNKQFNEKL RES+GSE
Sbjct: 198 DKNKQFNEKLSRESKGSE 215

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score =  105 bits (262), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 116/195 (59%), Gaps = 25/195 (12%)

Query: 19  DASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKSDDK--DRAFHYTVQEYNA 76
           + S++ RKL + E +E ++ RKPRVY +E A +  L  +   DDK  ++  +YT+Q+Y  
Sbjct: 29  EISVENRKLVNAESKELAAGRKPRVYQLE-APEPSLPTQ---DDKHGNQLMNYTIQQYEE 84

Query: 77  WEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSV--NEKDSKGSLGK 134
           W  +Q  R     + +GN  D +AK +YDK L  L       H+ ++  N   + GS   
Sbjct: 85  WNSRQ--RDQTNKRDSGNLQD-MAKYTYDKELNKL-------HKDTMLQNRYTNGGS--- 131

Query: 135 SRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQME--NVKTPSGVESF 192
             I+K+ +N  TGK+ I DDD+LV KLA  ++  + +R++AR+R+ME  NV+  S    +
Sbjct: 132 --IQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQNASSGGGY 189

Query: 193 INDKNKQFNEKLGRE 207
           IN+KNKQFNEKL R+
Sbjct: 190 INEKNKQFNEKLDRQ 204

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score =  102 bits (255), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 113/198 (57%), Gaps = 22/198 (11%)

Query: 19  DASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKSDDKD----RAFHYTVQEY 74
           DA+++ R L DRE ++  S+ KPRVY+M+D  D++L  ET+ +D D    +  +YT+++Y
Sbjct: 20  DATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQL--ETQEEDADDKVAKLMNYTLRQY 77

Query: 75  NAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGK 134
             WE+KQK +K            QLA  SYDK + NL   N  + + +  E++ +     
Sbjct: 78  EEWEKKQKDKKIKDDSS---DMKQLAMFSYDKGVSNL---NRFRTDKTTTEREVQ----- 126

Query: 135 SRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFIN 194
                IQ NS TGK+ I D+ +LVN LA  L   + KR+   K++++     S  E +IN
Sbjct: 127 -----IQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYIN 181

Query: 195 DKNKQFNEKLGRESRGSE 212
           ++NK FNEKL RESR  E
Sbjct: 182 ERNKHFNEKLDRESRYGE 199

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score = 98.6 bits (244), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 119/200 (59%), Gaps = 30/200 (15%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKSDDKDRA--FHYTVQEYN 75
           VD +++ RK+A+RE ++ S   KP++YSMED +++   R   S ++ R    +Y+++EY 
Sbjct: 18  VDVAIQIRKIAEREAKDESLVGKPKIYSMED-TNEMGTRPVDSSERRRLKLMNYSMREYE 76

Query: 76  AWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKS 135
            W++KQK ++    +  G +  +LAK SY+K L + + QN G                 +
Sbjct: 77  EWDKKQKGKE---VKRGGANVQELAKYSYEKDL-SRSKQNNG-----------------N 115

Query: 136 RIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENV---KTPSGVESF 192
           R+ KI  ++ T ++++ DD++LVNKLA+ L+  +++R  ARK+ ME      TP G   +
Sbjct: 116 RVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGG---Y 172

Query: 193 INDKNKQFNEKLGRESRGSE 212
           IN+KNKQFN KL R+ + +E
Sbjct: 173 INEKNKQFNLKLDRQMKETE 192

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 97.8 bits (242), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 108/192 (56%), Gaps = 15/192 (7%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKSDDKDRAFHYTVQEYNAW 77
           VD  ++ RKL D   +E   N KP+ YSME+ ++D+ V     D+ DR  +Y+++EY  W
Sbjct: 20  VDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTVDEADRLLNYSIREYEEW 79

Query: 78  EQKQKQRKSG--KTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKS 135
           E+KQ + K     T+ + NS  Q+AK +YD            + + S N  D++G     
Sbjct: 80  EKKQGRHKENVHVTKSSVNSTAQIAKFTYD------KQIKKLQKQKSTN--DNRG----- 126

Query: 136 RIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFIND 195
           +I KI+K+  TGKI + D  +L+ +LA  L   +K+R+D   ++ +     +   S+IN+
Sbjct: 127 KISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENYSYINE 186

Query: 196 KNKQFNEKLGRE 207
           KNK+FN+KL R+
Sbjct: 187 KNKEFNDKLERQ 198

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score = 96.7 bits (239), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 111/191 (58%), Gaps = 24/191 (12%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKSDD-KDRAFHYTVQEYNA 76
           VD S+K RK A++E ++A  + KP+VYSM   ++DE  ++ K +D + +  +Y++++Y  
Sbjct: 18  VDVSVKNRKEAEKEEKQAKQSGKPKVYSM---NEDETFKDQKEEDTRGKLLNYSIKDYEK 74

Query: 77  WEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSR 136
           W+ K   R +      G+S   LAK +YDK +R +             EKD  GSL + +
Sbjct: 75  WQLK---RTAKLKNSDGSSQQDLAKYTYDKEIREM-------------EKD--GSLNRGK 116

Query: 137 IEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFINDK 196
           + K + N   G+I+I DD + + +LA  L   +K+R+  RK+Q E + + S    FINDK
Sbjct: 117 VTKARLNG-KGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDS-STTGGFINDK 174

Query: 197 NKQFNEKLGRE 207
           NKQFNEKL R+
Sbjct: 175 NKQFNEKLSRQ 185

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 77.0 bits (188), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 104/190 (54%), Gaps = 20/190 (10%)

Query: 19  DASLKTRKLADREIQEASSNRKPRVYSM---EDASDDELVRETKSDDKDRAFHYTVQEYN 75
           D  ++ R L  +E +E     KPRVYSM   ED SD++   + +SD +   F YTVQ++ 
Sbjct: 19  DIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSDEQSDMRTNLFQYTVQDFI 78

Query: 76  AWE-QKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGK 134
            WE ++Q+++KS     +G     LAK +YDK L+NL      + E  +  K+++  + K
Sbjct: 79  DWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLP-----RPEFKMKAKETQFRINK 133

Query: 135 SRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFIN 194
                      +GK+ I D+ ELV +L+  L+  +K+R+D+  R++ N K  + +   IN
Sbjct: 134 D----------SGKVNIKDNKELVQRLSQNLKETAKQRYDSN-RKIANDKEHTSLSGSIN 182

Query: 195 DKNKQFNEKL 204
            KN QFN+ L
Sbjct: 183 AKNLQFNKSL 192

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 76.3 bits (186), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 109/204 (53%), Gaps = 37/204 (18%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYSM--EDASDDELVRETKSDDKDRAFHYTVQEYN 75
           V  S+K ++   +E ++ S+  KP VYSM  E+A   E   E+K   + +   Y+++++ 
Sbjct: 18  VSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETTEESK---EAKLLQYSMKDFE 74

Query: 76  AWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKS 135
            W+ K++ RKS K+      Y  LAK +YDK ++ L  +NY                  +
Sbjct: 75  QWQDKER-RKSQKSSDVA-KYQDLAKFTYDKEVQQLR-KNYT-----------------N 114

Query: 136 RIEKIQKNSIT--GKIRIVDDDELVNKLASTLESDSKKRHDAR-----KRQMENVKTPSG 188
           ++EK +K SI   GKI + DD  LV  LA +L   + +R+ AR      RQM +  TP G
Sbjct: 115 KVEKPKKVSINKKGKIVVKDDPHLVGSLADSLNKTANERY-ARIEKKIHRQMVS-DTPGG 172

Query: 189 VESFINDKNKQFNEKLGRESRGSE 212
              FIN+KNKQFN+K+ R+++  E
Sbjct: 173 ---FINEKNKQFNDKIERQTKKRE 193

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 75.9 bits (185), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 107/203 (52%), Gaps = 35/203 (17%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYSME-DASDDELVRETKSDDKDRAFHYTVQEYNA 76
           +D S+K +    RE +  S++RKP VYSM  + +++E+ ++    +K     Y++ EY  
Sbjct: 18  IDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVTEANK--LLKYSMLEYEQ 75

Query: 77  WEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSR 136
           W+ K K + S + +G G S+  LAK +YDK ++ L+                   +  +R
Sbjct: 76  WQDKVK-KNSHRLEG-GASFQDLAKSTYDKEVQQLS------------------KIDGNR 115

Query: 137 IEKIQKNSIT--GKIRIVDDDELVNKLASTLESDSKKRHDAR-----KRQMENVKTPSGV 189
           + K  K  +   GKI + DD +LV  L  TL   + +R+ AR      RQM N  T SG 
Sbjct: 116 VNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERY-ARIQKKIGRQMNN--TTSG- 171

Query: 190 ESFINDKNKQFNEKLGRESRGSE 212
             +IN+KNKQFN+KL R+++  E
Sbjct: 172 -GYINEKNKQFNDKLERQTKKRE 193

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 75.5 bits (184), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 98/194 (50%), Gaps = 25/194 (12%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKSDDKDRAFHYTVQEYNAW 77
           VDAS++ RK A  E +   +  KPRVYSM +   DE   +    ++ +  +Y + +Y  W
Sbjct: 18  VDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQSEQLKLLNYRIADYEKW 77

Query: 78  EQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSRI 137
           ++KQK+ K       G    +LA  +Y   L  L       H   V     KG     RI
Sbjct: 78  DEKQKRHKQ---PSDGADLGELANSTYRSELHQL-------HRRGV----VKGRATNGRI 123

Query: 138 EKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQM--ENVKTPSGVESFIND 195
                 S +GK+ + D+ ELV KLA+ ++  +K+RH+ R+++   +  +  +G    +ND
Sbjct: 124 ------SASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGS---LND 174

Query: 196 KNKQFNEKLGRESR 209
           KN+ FNEKL RE R
Sbjct: 175 KNRHFNEKLDREFR 188

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 75.1 bits (183), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 104/194 (53%), Gaps = 28/194 (14%)

Query: 18  VDASLKTRK-LADREIQEASSNRKPRVYSMED--ASDDELVRETKSDDKDRAFHYTVQEY 74
           VD S+K RK +   E+ +   + KP VYS+ D  A+ +E V+ T + ++ +  +Y++ +Y
Sbjct: 18  VDISIKNRKEIVSEEVLQVGRS-KPEVYSINDEGAAVNE-VQSTSNTERRKLLNYSLIDY 75

Query: 75  NAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGK 134
             W++K+KQ         G     +A  +Y   ++ L                 KG L K
Sbjct: 76  EKWDEKEKQ-----ANFDGTYSGDIAYSTYKNEIKQL----------------RKGGLTK 114

Query: 135 SRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKT-PSGVESFI 193
            +I K  + S +GK+ I D+ ELVNKLA TLE  S++R    K++++  K   S + +F+
Sbjct: 115 GKITK-GRISESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFV 173

Query: 194 NDKNKQFNEKLGRE 207
           N+KN+ FNEKL R+
Sbjct: 174 NEKNRHFNEKLSRQ 187

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 68.2 bits (165), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 112/200 (56%), Gaps = 26/200 (13%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASDDE-------LVRETKSDDKDRAF--- 67
           +D   + RK AD+E++E S + KP+VY ++   DD+        + +  ++++ R F   
Sbjct: 21  LDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEEEKRKFKLM 80

Query: 68  HYTVQEYNAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKD 127
           +YT++EY  W+++QK ++  +  G+  +  +LA  +Y+K L  L +    K E+  +E+ 
Sbjct: 81  NYTIREYEEWDKQQKDKQRKRVDGSDLT--ELATFTYEKELSKLNS----KLENISHEQ- 133

Query: 128 SKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPS 187
            K  +G         N+  GK+ + D++ L+N L + L   +KKR+  RK+++++  +  
Sbjct: 134 -KHQIGV--------NTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASSD 184

Query: 188 GVESFINDKNKQFNEKLGRE 207
              ++  DKNKQFNEKL RE
Sbjct: 185 IAGNYFKDKNKQFNEKLERE 204

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 67.8 bits (164), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/194 (31%), Positives = 96/194 (49%), Gaps = 32/194 (16%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKSDDKD--RAFHYTVQEYN 75
           V+ S++ +K     I E   N + RVYSM D  +D+  R  KS+ +D  +  +Y+++EY 
Sbjct: 54  VEVSIRNKKAI---IAEEKKNSERRVYSMADDGEDK-ARSNKSEPEDPIKLANYSIREYE 109

Query: 76  AWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKS 135
            WE K +  +  K+      +  +AK SY K +  L              KD    L   
Sbjct: 110 KWEAKTQNSRHNKS--VMGDFQTIAKNSYKKEVDALP-------------KDISHPL--- 151

Query: 136 RIEKIQKNSIT--GKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFI 193
                 K  IT  GK+++ D+ ELV K+ + L   SKKR+  RK++++     +  + FI
Sbjct: 152 ------KGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFI 205

Query: 194 NDKNKQFNEKLGRE 207
           NDKNK+FN KL  E
Sbjct: 206 NDKNKRFNAKLNSE 219

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 63.2 bits (152), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 94/186 (50%), Gaps = 23/186 (12%)

Query: 35  ASSNRKPRVYSMEDASD-------DELVRETKSDDK--DRAFHYTVQEYNAWEQKQKQRK 85
           +++N KP+VYSM D  D       DE  R+  S+++   +  +YT++EY  WE KQ +  
Sbjct: 36  SATNNKPKVYSMTDEFDKDELPINDENARKNHSEEERISKLMNYTLREYKDWELKQNEYT 95

Query: 86  SGKTQGTGN----SYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSRIEKIQ 141
           +     + +    S D LAK +YDK +R L      K   + N  +     GK  I K  
Sbjct: 96  TESQTNSKDDQIESLDSLAKRTYDKDIRKL-----NKALRATNSGNKSNKPGK--IIKNH 148

Query: 142 KNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFINDKNKQFN 201
           +N  + KI I DD  LV +L + L++ S + +     + +N  T   +   +N KN++FN
Sbjct: 149 RNE-SNKIVIKDDKFLVEELVNNLKTKSDRLYKHLGERRKNYST--TLSGHVNTKNQEFN 205

Query: 202 EKLGRE 207
           EKL RE
Sbjct: 206 EKLTRE 211

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 102/200 (51%), Gaps = 23/200 (11%)

Query: 18  VDASLKTRKLADREIQEASSNRKPRVYS--MEDASDDELVRETKSDDKDRAF-HYTVQEY 74
           +D+ ++ RK  + + +E  S  KP+VYS  M+D  D +   +  +++ +RA   YT+++Y
Sbjct: 18  LDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDLLTNNSERALLTYTIRDY 77

Query: 75  NAWEQ--KQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSL 132
             WE+  K+K +    T  + +S  Q AK +YDK +  +  +  GK   + +E+ ++GS 
Sbjct: 78  EEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMKKRQ-GKF--ATDEEITRGSA 134

Query: 133 GKSRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKR--QMENVKTPSGVE 190
            K  ++        GK+ I DD  LVN   S +   S  R+  R +   + N  T S V 
Sbjct: 135 MKEVLD-------DGKLLIKDDKHLVNGFISDINKVSNDRYIKRMKLNAVNNDATGSKVS 187

Query: 191 ------SFINDKNKQFNEKL 204
                 S+ N KNK FN+KL
Sbjct: 188 HDKGKTSYNNAKNKDFNDKL 207

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 158 VNKLASTLESDSKKRHDARKRQM--ENVKTPSGVESFINDKNKQFNEKLGR 206
           V +L + L   SKKR+  RK +M  +  +  S ++ +IN+KNKQFN+KL R
Sbjct: 152 VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%)

Query: 106 KTLRNLTTQNYGKHESSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLAS 163
           KT+R    +NY KH    +E+D      KS +E +Q  +   +I +V  D  +  L +
Sbjct: 169 KTVREFLEKNYSKHTPPASEQDCVKLTVKSLLEVVQTGAKNIEITVVRPDARIVTLTT 226

>KLTH0E06380g Chr5 (580587..585320) [4734 bp, 1577 aa] {ON} similar
           to uniprot|P53094 Saccharomyces cerevisiae YGL197W MDS3
           Protein with an N-terminal kelch- like domain putative
           negative regulator of early meiotic gene expression
           required with Pmd1p for growth under alkaline conditions
          Length = 1577

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 14/58 (24%)

Query: 94  NSYDQLAKLSYDKTLRNL---TTQNYGKHESSVNEKDSKGS-------LGKSRIEKIQ 141
           N +++ AKLSYD +  N+   TTQ++G    S   KD+ G+        G S+ E++Q
Sbjct: 549 NRHNEFAKLSYDSSHHNVSTPTTQHFG----STGSKDAPGTSLNGSFDAGNSKTEQVQ 602

>TPHA0C01000 Chr3 (214320..229025) [14706 bp, 4901 aa] {ON} Anc_8.295
            YLR106C
          Length = 4901

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 30   REIQEASSNRKPRVY--SMEDASDDELVRETKSDDKDRAFHYTVQEYNAW 77
            +E+  A  NR   ++  SM D SD EL+ E+K D+K +     + +++ W
Sbjct: 1553 KELSPALRNRFTEIWVPSMGDFSDVELIVESKLDNKLKELTKPIVKFSEW 1602

>NDAI0J02540 Chr10 complement(627186..629306) [2121 bp, 706 aa] {ON}
           Anc_4.301 YLR424W
          Length = 706

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%)

Query: 144 SITGKIRIVDDDELVNKLASTLESD 168
           ++  KIRI+DDD LV+KL + L S+
Sbjct: 240 TVAQKIRIIDDDLLVDKLMAQLFSE 264

>Smik_7.258 Chr7 (431437..431799) [363 bp, 120 aa] {ON} YGL029W
           (REAL)
          Length = 120

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 119 HESSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDEL 157
           HES  N+  +KG+    R+ K+QK  +  K R+V + +L
Sbjct: 3   HESGENQNVAKGTPVSGRVWKVQKEPLRVKSRVVKNKKL 41

>TPHA0E03460 Chr5 (731135..732067) [933 bp, 310 aa] {ON} Anc_1.152
           YJL185C
          Length = 310

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 95  SYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDD 154
           S+DQ + LS   +   L T + G++  S  E  + G +   +IE  +K+S T K +I+DD
Sbjct: 103 SFDQYSILSLSSSF-GLHTTSRGQNSDSDKESSAAGLISIPKIE--EKSSFTKKYKIIDD 159

Query: 155 DELVNKL 161
             L N+L
Sbjct: 160 WCLNNEL 166

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.122    0.321 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,101,847
Number of extensions: 1001433
Number of successful extensions: 4663
Number of sequences better than 10.0: 322
Number of HSP's gapped: 4596
Number of HSP's successfully gapped: 330
Length of query: 212
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 107
Effective length of database: 41,441,469
Effective search space: 4434237183
Effective search space used: 4434237183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 63 (28.9 bits)