Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.4163.489ON71371333580.0
Skud_7.4393.489ON71371427950.0
Smik_6.2243.489ON70571326880.0
YGR128C (UTP8)3.489ON71371426680.0
NCAS0E008303.489ON67172314850.0
TDEL0D055703.489ON64971614330.0
Kpol_480.163.489ON65571614120.0
ZYRO0D10054g3.489ON66471914110.0
NDAI0G009603.489ON70075113571e-178
TPHA0D042303.489ON65271413321e-175
SAKL0F02838g3.489ON65471613181e-173
TBLA0C044603.489ON69873312851e-167
KLTH0F14762g3.489ON65071512571e-164
CAGL0I10560g3.489ON67872012541e-163
AFR307C3.489ON65072011821e-152
KLLA0E04665g3.489ON64771711801e-152
Kwal_55.212223.489ON3733967312e-89
KAFR0C019403.489ON6095766052e-68
KNAG0B008303.489ON6076455921e-66
Kwal_55.21225singletonOFF2152513261e-33
Kwal_27.113528.362ON684151733.7
NDAI0G01600singletonON344138699.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.416
         (713 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...  1298   0.0  
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...  1081   0.0  
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...  1040   0.0  
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...  1032   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   576   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   556   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   548   0.0  
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   548   0.0  
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   527   e-178
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   517   e-175
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   512   e-173
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   499   e-167
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   488   e-164
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   487   e-163
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   459   e-152
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   459   e-152
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   286   2e-89
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   237   2e-68
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   232   1e-66
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   130   1e-33
Kwal_27.11352 s27 complement(764840..766894) [2055 bp, 684 aa] {...    33   3.7  
NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON}               31   9.0  

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score = 1298 bits (3358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/713 (91%), Positives = 649/713 (91%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITL            NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVEIWSFGLM 120
           PKLTFDYPIPSTNIITACNAVQGQVEIE            HEVTNFQSKRDVEIWSFGLM
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVTNFQSKRDVEIWSFGLM 120

Query: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180
           VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID
Sbjct: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180

Query: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDKV 240
           AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDKV
Sbjct: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDKV 240

Query: 241 CYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQ 300
           CYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQ
Sbjct: 241 CYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQ 300

Query: 301 LQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTF 360
           LQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTF
Sbjct: 301 LQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTF 360

Query: 361 QLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGKN 420
           QLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGKN
Sbjct: 361 QLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGKN 420

Query: 421 DTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIFF 480
           DTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIFF
Sbjct: 421 DTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIFF 480

Query: 481 KDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXNRTHNL 540
           KDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKA            NRTHNL
Sbjct: 481 KDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPLNRTHNL 540

Query: 541 LSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMK 600
           LSRLRDQPRLFKQAIVTC            FSIRNKELLLDISFRILQDFTRDSIKQEMK
Sbjct: 541 LSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMK 600

Query: 601 NLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDNLAS 660
           NLSKLDIQNFIDFITNTDEDSTLENLNH                IGLFSLEGALLDNLAS
Sbjct: 601 NLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNLAS 660

Query: 661 YIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713
           YIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI
Sbjct: 661 YIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score = 1081 bits (2795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/714 (75%), Positives = 590/714 (82%), Gaps = 2/714 (0%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLATLPKIASLSNFSLQADYVQVADG FNE TNNITL            NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHE-VTNFQSKRDVEIWSFGL 119
           PKLTFDYPIPSTN+ITAC+A + QV +E             E   N Q+KR++EIWSFG 
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 120 MVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKI 179
           MVNKGNYTLNV TK +E N +TSN+HL E+  D + +AG DD LSQ+KIKTK KVMNIKI
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180

Query: 180 DAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDK 239
           DAKNSL+IAVLQNGL+EFYD KLKLL+S+DISY NLKYAKWFTENGT+FVFVLCPLEDDK
Sbjct: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240

Query: 240 VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHC 299
           VCYK+ ELSDFE K++SPIKELSSTIIEGFSFESSK CYQFGKLYKLNQGKI+VYSLPHC
Sbjct: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300

Query: 300 QLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRT 359
           QLQQII++PLINK  SE+DLISFQPVSVNRILLTVNN IYLLDLLHCSILN RELTHV+T
Sbjct: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360

Query: 360 FQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGK 419
           FQLL+SA+IDSEKS NSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ+GK
Sbjct: 361 FQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGK 420

Query: 420 NDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIF 479
           ND +SV+LKPLFDDE+V +NMVKRNDIDGNI+VP F YDE+I+K+S LKNND+ASFD+IF
Sbjct: 421 ND-ASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIF 479

Query: 480 FKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXNRTHN 539
           F DLKVKEEHYTEKDRFISD  FLN+VLDLIF KF GNDYPKA            NRTH 
Sbjct: 480 FNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKALTFLLTHPLFPLNRTHG 539

Query: 540 LLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEM 599
           LLS LRDQPRLFKQAIVTC            FSIRN+ELLLDISFR+LQDFTRDSIKQEM
Sbjct: 540 LLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQEM 599

Query: 600 KNLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDNLA 659
           K LSKLDIQNFI+ ITNT+ED  LE  NH                IGLFSLEGALL+NL 
Sbjct: 600 KKLSKLDIQNFIECITNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLENLT 659

Query: 660 SYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713
            YIDKQV+IAERNTELWNL++ KGSQHGF  ++S S TSQKQALP Y MEYL+I
Sbjct: 660 LYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score = 1040 bits (2688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/713 (72%), Positives = 585/713 (82%), Gaps = 8/713 (1%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASLSNFSLQA+YVQVADG FNE TNNITL            NPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVEIWSFGLM 120
           PKL FDYPIPSTNIITACNA + QV IE             +V N Q+KR++EIWSFGLM
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNN-------EKVINSQTKRNIEIWSFGLM 113

Query: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180
           VNKGNYTLNVITK +E+  + ++++L EN  +   Y G++ +LSQYKIK K KVM+IKID
Sbjct: 114 VNKGNYTLNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKID 173

Query: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDKV 240
            KN+L+IA+LQNGL+EFYDFKLKLLHS+DISY NLKYAKWFTENG EF+FVLCPL+DDKV
Sbjct: 174 TKNNLIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKV 233

Query: 241 CYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQ 300
           CYKL EL+D+E +E+SPIKELSSTIIEGFSF+ SK CYQFGKLYKLN+GKI+VYSLPHCQ
Sbjct: 234 CYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQ 293

Query: 301 LQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTF 360
           LQQ+I++PLIN    E+DLISFQPVSVNR+LLTVNN +YLLDLLHCS L QREL+HV+TF
Sbjct: 294 LQQVIELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTF 353

Query: 361 QLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGKN 420
           QLL +AVI+SEKS +SKTIAIGISTKNG NPTSSLEIINIDVGTNTLKDSLGKSFQ  K 
Sbjct: 354 QLLNTAVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKK 413

Query: 421 DTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIFF 480
           D SSV+LKPLFDDE V +NMVKRN+IDG+IS+PTFQYDEII K+SALK+ND+ SFDDIFF
Sbjct: 414 D-SSVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFF 472

Query: 481 KDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXNRTHNL 540
           KDLK+KEEHYTEKDRFISD  FLN+VLDLIFEKFNGNDYPK             +RT NL
Sbjct: 473 KDLKIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNL 532

Query: 541 LSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMK 600
           LS LRDQPRLFKQAIVTC            FSIRNKELLLDISFRILQDFTRDSIKQEMK
Sbjct: 533 LSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMK 592

Query: 601 NLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDNLAS 660
            LSKLDIQNFI+F+T+T+ D++LE  NH                IGLFSLEGALL++L S
Sbjct: 593 RLSKLDIQNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTS 652

Query: 661 YIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713
           YIDKQV+IAERNTELWNL++ K SQHGFTN+  +S +SQKQALPTYTMEYL+I
Sbjct: 653 YIDKQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score = 1032 bits (2668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/714 (72%), Positives = 581/714 (81%), Gaps = 2/714 (0%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLATLPKIASLSNFSLQADYVQVADG FNE TNNITL            NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVT-NFQSKRDVEIWSFGL 119
           PKLTFDYPIPSTNIITACNA +GQ  I+            +E T N Q KR+VEIW+FGL
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 120 MVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKI 179
           MVNKGNYTLNVITKA+ED  DTSNDHL+E+  D KAY G+D+ LSQYKIK K KVM+IKI
Sbjct: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180

Query: 180 DAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDK 239
           D KNSLVIA+LQNGL+E +DFKL LLHS+DISY NLKYAKWFTENGTE+VFVLCPL+DDK
Sbjct: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240

Query: 240 VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHC 299
           VCYKL EL+D    ESSPIKELSSTIIEGFSFE+SK CYQFGKLYKLNQGKI++YSLPHC
Sbjct: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300

Query: 300 QLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRT 359
           QLQQ+I+ P+++K +  +DLISFQPVSVNR+LLTVNN IYLLDLLHCS L+QRELTHV+T
Sbjct: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360

Query: 360 FQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGK 419
           FQLL+SAVI+SEKS NSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ+G 
Sbjct: 361 FQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGN 420

Query: 420 NDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIF 479
           ND SSV+LKPLFDD+++ D  VK ND+ G+ SVP    +E+I+K+SAL++ND+ SFDDIF
Sbjct: 421 ND-SSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIF 479

Query: 480 FKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXNRTHN 539
           FK+LK+KEEHYTEKDR+ISD  FLN+VLDLIF KF+GNDYPK             +RT N
Sbjct: 480 FKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTRN 539

Query: 540 LLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEM 599
           LLS LRDQPRLFKQAIVTC            FSIRN+ELLLDISFRILQDFTRDSIKQEM
Sbjct: 540 LLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEM 599

Query: 600 KNLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDNLA 659
           K LSKLD+QNFI+FIT+  EDS+ E  N                 IGLFSLEGALL+NL 
Sbjct: 600 KKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLT 659

Query: 660 SYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713
            YIDKQVEIAERNTELWNL++TKG QHGF +   D+ TSQK+ALPTYTMEYL+I
Sbjct: 660 LYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/723 (46%), Positives = 460/723 (63%), Gaps = 62/723 (8%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRL  LPKIASLSNF+LQ+DY+QV D  F+  TN IT+            NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVEIWSFGLM 120
           PKL F++PIPSTNI+TACN  +                        Q     E W F  M
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFE------------------------QKGSSEETWCFATM 96

Query: 121 VNKGNYTLNVITK-AVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKI 179
            NK + TLN+I K   + N++ S D    + +          + S++KIK  D V++IKI
Sbjct: 97  ANKTS-TLNLINKNQYQTNEEESGDSAPSDSS----------VTSEFKIKADDHVVDIKI 145

Query: 180 DAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDK 239
             K  +++ VL+NG ++ YDF+LKLL+S +++Y N+++ + F E+G +F+FVLC LE+DK
Sbjct: 146 LNKKKIIV-VLKNGKIQTYDFELKLLNSINMAYNNVRFVEHFHEDGKDFMFVLCDLENDK 204

Query: 240 VCYKLFELSD-FEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPH 298
           VC KLF++++  E    S I EL+STI+E F  E++KFCYQFGK YKL   KI VYSLP 
Sbjct: 205 VCLKLFQINENIETINDSAI-ELTSTILENFPLENAKFCYQFGKFYKLTDDKILVYSLPQ 263

Query: 299 CQLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVR 358
            Q Q  I +P+I        ++SF+P+S NRILLTVNN IYLLDL+H SIL++RELTH++
Sbjct: 264 FQFQYSITLPMITDLKEGERVVSFKPISPNRILLTVNNKIYLLDLIHNSILSERELTHLK 323

Query: 359 TFQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIG 418
           TFQLL++AV+D+  +QN +T+AIG+STK G NPTSSLE++N+DVGT+T+KDSLGKSFQ  
Sbjct: 324 TFQLLKTAVVDTNINQN-RTLAIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTS 382

Query: 419 KNDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDI 478
             + +   LK LFDDEN   +  K+        V  F Y++I K++   K NDV  FDDI
Sbjct: 383 STENNVQSLKSLFDDENDYSDKKKQ--------VKNFNYEKIYKELVDSK-NDVTKFDDI 433

Query: 479 FFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXNRTH 538
           FFK   +K+E+YTEKDRFI + EFL +++DLIFE F   +YPK              RT 
Sbjct: 434 FFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFETF-KEEYPKTFTYLLTDPLFPLERTK 492

Query: 539 NLLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQE 598
            LL+RL + PRLFKQAIVTC            F+I N EL LDIS RILQD+TRDSIK+E
Sbjct: 493 GLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTISNGELSLDISLRILQDYTRDSIKKE 552

Query: 599 MKNLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDNL 658
           +K L K++++NFI+FI   DE+S +++  +                IGLF+L+ A+L+ L
Sbjct: 553 LKKLPKIEVENFIEFI--IDEESDIKDTTN--APHLFQLLSLVVDSIGLFALDNAVLERL 608

Query: 659 ASYIDKQVEIAERNTELWNLVETKG-----SQHGFTNMNSDSRTS---QKQALPTYTMEY 710
           + YID+QV IA+ NTELW+L++        +    T+ + DS TS   Q++ LP Y++EY
Sbjct: 609 SKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKLQEEVLPKYSVEY 668

Query: 711 LEI 713
           L++
Sbjct: 669 LDL 671

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/716 (43%), Positives = 434/716 (60%), Gaps = 70/716 (9%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQ F+LA LP++ASLSNF+ Q +++QVAD      +N IT+            NPT
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNPT 59

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVEIWSFGLM 120
           PKL    PIPSTNI+TAC+  +   +                          EIW + L 
Sbjct: 60  PKLVLSIPIPSTNIVTACDVARSDEQ--------------------------EIWCYALQ 93

Query: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180
             K   TLNV +K              ENG +      +DD+L   K+K  D+ + + ++
Sbjct: 94  AGKV-CTLNVASKVSH----------AENGVN------SDDVL---KVKVDDQAVGVHVN 133

Query: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDKV 240
            K+  ++ VL+NGL++FYDF+LKLLHS D+SY ++   K+FTE   +F+F+LC L +DKV
Sbjct: 134 GKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGANDFLFILCSLPEDKV 193

Query: 241 CYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQ 300
           C+KLFELS        PIKELSS I+E FS  +SK CYQ G+LY+L   ++ VY+LP CQ
Sbjct: 194 CFKLFELS-LPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIGHEVLVYALPQCQ 252

Query: 301 LQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTF 360
           L Q + +P++       D+IS +P+S NRIL+T +N IYLL+L H SIL QRELTH+++F
Sbjct: 253 LVQAVTLPMVQGA----DVISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKSF 308

Query: 361 QLLRSAVIDSEKSQ---NSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQI 417
           QLL+SAVIDS  S    N KT  IG+ TK+G NPTSSLEI+N+DVGT TLKDSLGK F +
Sbjct: 309 QLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFTV 368

Query: 418 GKNDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDD 477
             N+  S VLKPLF DE+                   F +++I + +   K + ++SFD 
Sbjct: 369 S-NEPISQVLKPLFSDEDNEAEDEDNK-------FEHFDFNQIYQHLEKNKQS-ISSFDR 419

Query: 478 IFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXNRT 537
           IF ++L +K EHYTE DRFI D +FL+ V+ LI + F   +YPKA            + T
Sbjct: 420 IFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQ-EEYPKALTFLLTHPLFPVDCT 478

Query: 538 HNLLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQ 597
             LLSRLR+ PRLFKQAIVTC            FSI N EL LDIS RILQD+T D IKQ
Sbjct: 479 PKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQ 538

Query: 598 EMKNLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDN 657
           E++ L+K+D+QNFI+F+ ++++++ + + +                 IGLF+L+G LLD 
Sbjct: 539 EVRKLNKIDVQNFIEFVISSNDENAIRSSHQ-----LFQLLSLVLDSIGLFALDGVLLDR 593

Query: 658 LASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713
           LA YI ++V IAERN++L +L++ K +  GF    + S  S ++A+P YT+EYL++
Sbjct: 594 LADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/716 (44%), Positives = 443/716 (61%), Gaps = 64/716 (8%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPS SQPFRLA LPKI SLSN   Q   +Q+AD  F+  +N IT+            NPT
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADD-FSLESNKITIGISGSTISQYIINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVEIWSFGLM 120
           P L F+ PIPSTN +TACN                     H V++    + +E W++GL 
Sbjct: 60  PSLVFNVPIPSTNNVTACNI-------------------GHFVSDTDGSK-LECWAYGLS 99

Query: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180
            NK N+TLN+  K  +D              DK A +G  +++  Y  K  DK+ +IKI+
Sbjct: 100 YNK-NHTLNISIKTSDD--------------DKYATSG-GEVVETYSQKCDDKIEHIKIN 143

Query: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDKV 240
            K  +++ VL+NGL++FYDF LKLL S ++ Y ++ + + F E+G +F  +L  +E  K+
Sbjct: 144 EKEKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDISFVEHFEEDGKQFAIILSNIEGKKI 203

Query: 241 CYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQ 300
            +KL+EL  F   ++S I ELSSTI+E      S+ CYQFGK+Y+L + ++++Y+LP CQ
Sbjct: 204 SFKLYEL--FTNDKTS-INELSSTILEDADLGESQICYQFGKIYRLFEDRLYIYNLPQCQ 260

Query: 301 LQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTF 360
           LQQ I++P I K  S  D++SF P++ NRILLTVNN IYLLDL+H SIL +R+L+HV+ +
Sbjct: 261 LQQTIELPFIQKKDS--DVLSFSPIANNRILLTVNNKIYLLDLVHNSILAERDLSHVKVY 318

Query: 361 QLLRSAVIDSE-KSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGK 419
           QLL+S V+ S+ +++NSKTIAIG+S KNGP+P SSLE+IN+DVG+ TLKDSLGKSFQ+  
Sbjct: 319 QLLKSIVVPSKGENKNSKTIAIGVSIKNGPSPISSLEVINVDVGSGTLKDSLGKSFQVA- 377

Query: 420 NDTSSVVLKPLF-DDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDI 478
           N   ++ L+ LF +DE +     ++          +F Y  I++++   KN D+  FDDI
Sbjct: 378 NVKKNIPLQSLFPEDETIYAKGEQK----------SFDYKNILQELQNNKN-DINKFDDI 426

Query: 479 FFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXNRTH 538
           FFK L + +E+YTE+DRFI D +FL+ VLDLIF  F   DYP+A            + T 
Sbjct: 427 FFKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFK-KDYPRALTFLLTHPLFPISHTR 485

Query: 539 NLLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQE 598
           NLL++ R+QPRLFKQA+VTC            F+I N EL LDIS RILQD+TRDSIKQE
Sbjct: 486 NLLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRILQDYTRDSIKQE 545

Query: 599 MKNLSKLDIQNFIDFITNTD-EDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDN 657
           +K LSK+DIQNFI+F+ +TD ED +  N                    GLF+LE   L+ 
Sbjct: 546 LKTLSKVDIQNFIEFVIDTDSEDKSQFN------PQLFQLLSLVLDASGLFALEEETLEK 599

Query: 658 LASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713
           L++YID QV +AERN  LW+L++    +    N  +D    Q ++L  Y++EYLE+
Sbjct: 600 LSAYIDNQVNVAERNNRLWHLLDENSDKRSTLNQANDQNVLQTKSLSAYSVEYLEL 655

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/719 (43%), Positives = 436/719 (60%), Gaps = 61/719 (8%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPS+ QPFRL+ LP+I +LSN+ +Q+DY++V+    +  +N IT+            NPT
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSD-ISPNSNKITIGISESAISQYILNPT 59

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVEIWSFGLM 120
           PKL  +  IPSTN+++AC+                               D EIW + + 
Sbjct: 60  PKLLSNISIPSTNVVSACDVA-------------------------TLADDKEIWCYCVK 94

Query: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180
             K ++ LN   K V+     ++  L  +G DK     T+D    +KIK   KV+ IKI 
Sbjct: 95  SGKSHF-LNASVKPVD-----ADTVLDTDGGDK-----TED----FKIKMDSKVVGIKII 139

Query: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDKV 240
                ++ VL++GL+++YDF+L+ L S DISY N+K   +F+ENG  F+FVL   E++KV
Sbjct: 140 PDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNKV 199

Query: 241 CYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQ 300
           C+KLFEL   +GK  +PIKELS+TI+E F+ + SK CYQ GKLY+L    I  Y+LP C 
Sbjct: 200 CFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQCH 259

Query: 301 LQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTF 360
           L Q   +P+I  P S+   +S  PVS NRILLTVNN +YLLDL+H S+L++R LTH +TF
Sbjct: 260 LVQTTHLPMILDPNSQK--VSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKTF 317

Query: 361 QLLRSAVIDSEKSQN-----SKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSF 415
           QLLRSA ++   S       ++T+AIG++TKNG NPTS+LE+IN+DVGT TLKDSLGKSF
Sbjct: 318 QLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKSF 377

Query: 416 QIGKNDTSSVVLKPLF-DDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVAS 474
           Q   ND+ +  L+PLF DDE+ A +    ++      V  F Y++I K++S   N  ++ 
Sbjct: 378 Q-SINDSKTHNLQPLFSDDESDAGDNADSDE------VVAFAYEDIFKELSK-NNKSISK 429

Query: 475 FDDIFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXX 534
           FD  F K L ++EEHYT+++RFI D EFL++V+ LI + F+  +YP+A            
Sbjct: 430 FDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFD-QEYPRALTFLLTHPLFPT 488

Query: 535 NRTHNLLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDS 594
           + T  LL R R+ PRLFKQAIVTC            FSI N EL LDIS RILQDFT D 
Sbjct: 489 DCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDM 548

Query: 595 IKQEMKNLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGAL 654
           IK E+K L+K+D+ NF++F+ +  ++  ++N                   IGLF+L+GAL
Sbjct: 549 IKDEVKKLNKVDVHNFVNFLISPKDEELIQN---KSTYELFQLLSLVIDAIGLFALDGAL 605

Query: 655 LDNLASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713
           L  L+ YID+QV +AERN  LWNL++T+    G T   + S  +++Q LP YT+EYLE+
Sbjct: 606 LQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLEL 664

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  527 bits (1357), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 321/751 (42%), Positives = 450/751 (59%), Gaps = 89/751 (11%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRL  LPKIASLSN+SLQ DY+QV    FN  TN + +            NPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVEIWSFGLM 120
           PKL F+YPIPSTNI+TAC+ ++                            + E+W FGL+
Sbjct: 61  PKLIFNYPIPSTNIVTACDVLEND----------------------NDNTNNEVWCFGLV 98

Query: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180
            NK  YTL +ITK      D      T    +         I  ++ +K   K+++IKI 
Sbjct: 99  ANK-TYTLTLITK------DKQKSSATMEDDEDVVDVIDTTIKDEFNVKLDSKIVDIKII 151

Query: 181 AKNSL---VIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLED 237
            K +    ++ VL+NGL++F++  LKLL++  I+Y N+K+ + F E+  +F+F +C L D
Sbjct: 152 KKKADDISIMIVLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGD 211

Query: 238 -DKVCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSL 296
            +KVC KLF++++      S I EL+S I+E F+ +++KFCYQFGK YKL    + VYSL
Sbjct: 212 NNKVCIKLFQINN-----DSAI-ELNSIIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSL 265

Query: 297 PHCQLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTH 356
           P  QL+    +P+I    +++ ++S +P+S NRILLT+NN IYLLDL+H SIL++RELTH
Sbjct: 266 PQFQLEHTTTIPMIK---TDDQIVSMKPISTNRILLTINNKIYLLDLIHNSILSERELTH 322

Query: 357 VRTFQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ 416
           +++ QLLRSAVI  +   N+KTI IG+STK G NPTSSLEIIN+DVG+NTLKDSLGK FQ
Sbjct: 323 LKSLQLLRSAVI-GKGENNNKTITIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFQ 381

Query: 417 ----IGKNDTSSVVLKPLFD---DENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKN 469
                 +   S+  LKPLFD   D +  D++ K+      ++   F YDEI+ K+S    
Sbjct: 382 NLNLQNQIQISTQALKPLFDPNTDGDKDDDLFKK-----LVTKEQFNYDEILTKLSE-NT 435

Query: 470 NDVASFDDIFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNG-------NDYPKA 522
           ND+  FD+IFF+   +K+EHYTE DRFI + EF  +++DLIFEKF         N+YPK 
Sbjct: 436 NDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGSTATTAQTNEYPKT 495

Query: 523 XXXXXXXXXXXXNRTHNLLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDI 582
                        RT +LLSR  + PRLFKQAIVTC             +I+N EL LDI
Sbjct: 496 LTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVTCPNLPLPELLNELLTIKNNELSLDI 555

Query: 583 SFRILQDFTRDSIKQEMKNLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXX 642
           S RILQD+++DSIKQE++NL +L+I+NFIDFI N DE    +N                 
Sbjct: 556 SLRILQDYSKDSIKQELRNLPRLEIENFIDFILN-DEIKDDQN-----SPQLFQLLALVL 609

Query: 643 XXIGLFSLEGALLDNLASYIDKQVEIAERNTELWNLVETKGS-------QHGFTNMNSDS 695
             IGLF+L   +L+NL++YID+QV I E+NTELW L+++  +        + F++ ++ +
Sbjct: 610 DSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSHNKKDNSFSSASAST 669

Query: 696 RT-------------SQKQALPTYTMEYLEI 713
            +             +QK+ALP Y+++YLE+
Sbjct: 670 NSKSNNISSNNKKSFTQKEALPMYSVDYLEL 700

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  517 bits (1332), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 307/714 (42%), Positives = 432/714 (60%), Gaps = 63/714 (8%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIA LS++++Q+  +QVAD  F   +N IT+            NPT
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVEIWSFGLM 120
           P ++   PIPSTN +TACN  Q +                    +  ++   EIW + L 
Sbjct: 60  PNVSQTVPIPSTNNVTACNVAQYK--------------------DADTEELFEIWVYNLA 99

Query: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180
           VNK N TL+V  K V+ +               K      D L  Y +K    V+ IKI+
Sbjct: 100 VNKKN-TLHVAIKTVDPD---------------KFSTTQSDALETYTVKCDASVVGIKIN 143

Query: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDKV 240
            ++  ++  L NG ++ +DFKLKLL+S + SY N+ +++ F EN   F  +L  +E +K+
Sbjct: 144 KEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNKL 203

Query: 241 CYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQ 300
            YKL+EL    G++ + IKELSSTI+E    + SK  YQFGKLY+L + ++ VYSLP CQ
Sbjct: 204 SYKLYELF---GQDKTSIKELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQ 260

Query: 301 LQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTF 360
           L   I +P I+   S+   ISF+PVS NRILLTV+N I++LDL+H + L +R L HV+ F
Sbjct: 261 LVDTITLPQIDLKKSQA--ISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKMF 318

Query: 361 QLLRSAVIDS-EKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGK 419
           QLL+S VI++ + S N KTIAIG+S KNGP+P ++LEIIN +VGT TLKDSLG SF + K
Sbjct: 319 QLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVSK 378

Query: 420 NDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIF 479
           +  S++ L+PLF D+    N+VKR+D         F+Y+ I+KK+S+ +N D+  FDDIF
Sbjct: 379 SFKSNI-LQPLFTDDA---NLVKRHD---------FKYEAILKKLSSTEN-DIKKFDDIF 424

Query: 480 FKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXNRTHN 539
           F DL +++ +YT+ +RFI D  FL+ V+DLIF+ F   +YP A            ++T N
Sbjct: 425 FGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQ-KEYPSALTFLLTHPLFPIHQTKN 483

Query: 540 LLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEM 599
           LL +LR+ PRLFKQA+VTC            FSI N EL +DIS RILQD+T+DSIK E+
Sbjct: 484 LLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLEL 543

Query: 600 KNLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDNLA 659
           KNL+K+DIQNFIDF+ + + +   E   H                 GLFS+EG LL  L+
Sbjct: 544 KNLNKIDIQNFIDFVIDPNNE---EEKKHNEQLFVLLSLVLDAS--GLFSIEGPLLTQLS 598

Query: 660 SYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713
            YIDKQVE+ E++ +LW+L++    +       S +   + +AL  Y++EYLE+
Sbjct: 599 EYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  512 bits (1318), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 309/716 (43%), Positives = 425/716 (59%), Gaps = 67/716 (9%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           M S+SQPFRL  LPKIASL+NFS Q DY+QVA+       N I +            NPT
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANT-LTPSANKINIGVSGSSISQYIINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVE---IWSF 117
           PKL  +  IPST+I+TAC+  + Q                      Q++ D E   +W +
Sbjct: 60  PKLVHNLSIPSTSIVTACDVSEIQ----------------------QNEGDTETQEVWCY 97

Query: 118 GLMVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNI 177
            L+ NK  +TLN I K +  +  + N   T                  YK+  K KV ++
Sbjct: 98  ALVANKS-FTLNTIIKPLTADAPSVNSTQT---------------FENYKVSIKHKVASV 141

Query: 178 KIDAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFT-ENGTEFVFVLCPLE 236
           KI      +IAVLQNGLV+ +DF+LKLLHS DISYGN+   K+FT E   +F+ VL  L 
Sbjct: 142 KIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNISLVKYFTNEVLQDFMIVLTDLN 201

Query: 237 DDKVCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSL 296
           DDKVCYKLFE+       + P+KEL+S I+EGFS ++SK  YQFGK+Y L+ GKI +YSL
Sbjct: 202 DDKVCYKLFEI--IHHDSNVPLKELNSVILEGFSLQNSKTFYQFGKIYTLSNGKISIYSL 259

Query: 297 PHCQLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTH 356
           PH QL   I++P +   T EN ++SF+P+S NR LLTV+N IYLLDLLH +IL+QRELTH
Sbjct: 260 PHFQLSNTINLPFV---THEN-VVSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTH 315

Query: 357 VRTFQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ 416
           V+TFQLL +A+I    ++N+KTIAIG+STK+  N TS+L+I+NI+VG+ TLKDS+ K F 
Sbjct: 316 VKTFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGFL 375

Query: 417 IGKNDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFD 476
               D +  VL  LFD+++   +    +  D         Y++I+ ++   K+     FD
Sbjct: 376 --TQDATEEVLNSLFDEQDDELDEDGTSQFD---------YNQILSELEKAKSK-TEKFD 423

Query: 477 DIFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXNR 536
           ++FFK L +K+E+YTE DRF +   FL++VL LIFE FN  +YP+A              
Sbjct: 424 NVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFN-KEYPRALTYLLTHPLFPAKH 482

Query: 537 THNLLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIK 596
              LLS+ ++ PRLF+QAIVTC            F++ N EL LD+S RILQDFT+DSIK
Sbjct: 483 ATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIK 542

Query: 597 QEMKNLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLD 656
           Q +K +SK+DI NFI F+ N D+D       +                IGLF+L+G  L+
Sbjct: 543 QSIKKMSKVDINNFIGFVINEDDDEE----RNKSKPQLFQLLNLVLDSIGLFALDGESLE 598

Query: 657 NLASYIDKQVEIAERNTELWNLV-ETKGSQHGFTNMNSDSRTSQKQALPTYTMEYL 711
           NL  +I+ QV+I E+N EL NL+ +T        +  S S ++ +QALP+Y++EYL
Sbjct: 599 NLHQFIENQVDIVEQNIELLNLLDDTSAKSTSIISSYSASSSTTEQALPSYSVEYL 654

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  499 bits (1285), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 306/733 (41%), Positives = 437/733 (59%), Gaps = 55/733 (7%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASLSN+SLQ DY+QVA   F   TN +TL            NPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXX----------XXXXHEVTNFQ--- 107
           PKL F+  IPSTN +TA N      E+E                       EV+  +   
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 108 -SKRDVEIWSFGLMVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQY 166
            +KR VE+W++GL+ NK N TLN+  K                G D+ +     +I+ + 
Sbjct: 121 VTKRSVELWAYGLVANKSN-TLNISVKTT--------------GLDEFS-TTPGEIIRKK 164

Query: 167 KIKTKDKVMNIKIDAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGT 226
            IK   KV+NIKI  +   ++ VL+NGLV+ +DF L L  S DI+Y ++++ + FTE+  
Sbjct: 165 TIKVDSKVVNIKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQ 224

Query: 227 EFVFVLCPLEDDK--VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLY 284
            F+ +L  ++++K  VC+KL++L      +S+ + ELS +I++ F    SK  YQFGKLY
Sbjct: 225 NFLLILSNIDEEKSSVCFKLYQLR--LDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLY 282

Query: 285 KLNQGKIHVYSLPHCQLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLL 344
           +L   ++ VYSLP CQL Q I +  I   T   D+ S +PV+ NR++L +NN +YL+D L
Sbjct: 283 RLTGSELFVYSLPQCQLLQNISLAEIFPNTI--DVSSIKPVANNRLVLAINNVVYLIDTL 340

Query: 345 HCSILNQRELTHVRTFQLLRSAVI-DSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVG 403
           H SIL +RE THV+TFQLL+SA I DS  +Q  +TIAIG+STK+GP   S+LE+INI+VG
Sbjct: 341 HRSILAEREFTHVKTFQLLQSATIGDSNITQ--RTIAIGVSTKSGPTSASALELINIEVG 398

Query: 404 TNTLKDSLGKSFQIGKNDTSSVVLKPLFDDENVADNMVKR--NDIDGNISVPTFQYDEII 461
           + TLKDSLGK      ++ S   LKPLF DEN   +++    +DI    +V +F +++I 
Sbjct: 399 SGTLKDSLGKGVSKKLSEGSHSDLKPLF-DENDEKSLIGTPVHDIS---NVKSFNFNKI- 453

Query: 462 KKISALKNND-VASFDDIFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYP 520
             ++ LK++D ++ FD  FF+ L++KE HYTE DRFISD +F+   +DLIF+KF+  ++P
Sbjct: 454 --LADLKSSDTISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFD-TEFP 510

Query: 521 KAXXXXXXXXXXXXNRTHNLLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLL 580
           KA              T  LL +L+D PRLFKQAIVTC            F+++N EL L
Sbjct: 511 KAFTFLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTL 570

Query: 581 DISFRILQDFTRDSIKQEMKNLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXX 640
           DIS R+LQD++R+ +KQE+K L  +DI+NFI+FI     +    N               
Sbjct: 571 DISLRVLQDYSRNDVKQEIKKLDNVDIENFIEFIITPTTEEIQTN-----TPQLFQLLSL 625

Query: 641 XXXXIGLFSLEGALLDNLASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQK 700
               IGLF+L+G LL+ L++YI++QV IAER++ELW+L++T  +   F N    S    K
Sbjct: 626 VLDSIGLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGNK 685

Query: 701 QALPTYTMEYLEI 713
           + L  Y+++YL+I
Sbjct: 686 ETLSVYSVDYLDI 698

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  488 bits (1257), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 280/715 (39%), Positives = 417/715 (58%), Gaps = 67/715 (9%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPS+SQPFRL  LPKIASL+N++ Q +Y+QVAD      TNNI +            NPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADT-LTPTTNNINVGVSGSAVSQYIINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVEIWSFGLM 120
           PKL ++ PI STN+++AC                       E+T    K   E+  +G+ 
Sbjct: 60  PKLVYNQPISSTNVVSACAVA--------------------EITTTSEKDSQEVICYGIQ 99

Query: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180
            N+  Y+L    K V     T++D      +  + YA        +K+   D+++N+K+ 
Sbjct: 100 SNRV-YSLCATIKPV---SSTASD-----SSFGETYAA-------HKVSVSDQIVNLKVF 143

Query: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFT-ENGTEFVFVLCPLEDDK 239
                ++AVL++GL++F+DF+LKL HS D SY N+ Y + FT E+G  + F+L  ++  K
Sbjct: 144 PDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDIDGHK 203

Query: 240 VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHC 299
           V +KLFE+   +   ++P  ELSS I+E    + S+  YQFG++Y+L+   + +Y+LPH 
Sbjct: 204 VSFKLFEIG--QSDSATPATELSSVILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPHF 261

Query: 300 QLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRT 359
           Q  + I++P +    +   +ISF+P+S NR LLT +N I+LLDLLH +IL+QRE+ HV+ 
Sbjct: 262 QHSRTIELPFL----APESIISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVKI 317

Query: 360 FQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGK 419
           FQLL +AVI    + N+KTIA+G+S K+G NP+SSL+IINIDVGT TL+DS+GK F   +
Sbjct: 318 FQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGFMSRE 377

Query: 420 NDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIF 479
           N +    L+PL    N             +     F YD I+K++S   +N + +FD +F
Sbjct: 378 NKSQH--LQPLISTLN-------------DTEAAEFNYDRILKELSKAADN-IENFDSVF 421

Query: 480 FKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXNRTHN 539
           FK L +K  +YT+ DRF++D EFL  V  LIF+ F  ++YPKA            + THN
Sbjct: 422 FKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFK-SEYPKALTYLLTNPLFPVSHTHN 480

Query: 540 LLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEM 599
           LL +L+D PRLFKQAIVTC            F++ N EL LD+S RILQDF +DSIK+ +
Sbjct: 481 LLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAI 540

Query: 600 KNLSKLDIQNFIDFITNTD-EDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDNL 658
           K  SK+D+ NFI+F+ + + E+  ++N                   +GLF+LE  +L+ L
Sbjct: 541 KQKSKIDVNNFINFVISENFEEDRIKN-----KPRLFQLLSLVLDSVGLFALENEMLEKL 595

Query: 659 ASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713
             YID+Q+ + + N EL+NLVE K  ++GF     D+ TS +  +  Y++E LE+
Sbjct: 596 TKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  487 bits (1254), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 282/720 (39%), Positives = 428/720 (59%), Gaps = 49/720 (6%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASL NFS +  Y++VAD  F   +N++ L             PT
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADS-FTPDSNSVLLGISGSSISKYVITPT 59

Query: 61  PKLTFDYPIPSTNIITACN----AVQGQVEIEXXXXXXXXXXXXHEVTN-FQSKRDVEIW 115
           P+L F+ PIPST++++ACN    +    V  +               TN  +  +  EIW
Sbjct: 60  PRLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIW 119

Query: 116 SFGLMVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVM 175
            + L  N   +TLN + + V++N    N  +TEN               Q+  K K++++
Sbjct: 120 CYALSANNKTHTLNCLIREVDNN----NTSITENN-------------PQFNAKFKEQII 162

Query: 176 NIKIDAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPL 235
           NI++D K+ +++ + + GLV+FYD +LKLL+S +  Y ++K  K F ENG E++ ++  L
Sbjct: 163 NIEVDTKHKVIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDL 222

Query: 236 EDDKVCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYS 295
           +D KV  +L+E+S  E K    +KEL+S+IIE F+ + S  CYQFG++Y+L + +I VYS
Sbjct: 223 KDQKVALQLYEVSTEEKK----VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYS 278

Query: 296 LPHCQLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELT 355
           +P  QL   + +P +++   +N LIS +P++ NR+LLTV N IYLLDLLH SIL++RE++
Sbjct: 279 IPSLQLNSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVS 338

Query: 356 HVRTFQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSF 415
           H++TFQ+L++A ++ + S++  T+A+GISTKNG NPTS+LEIINIDVG+N+LKDSLGKSF
Sbjct: 339 HMKTFQILKTA-MNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSF 397

Query: 416 QIGKNDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKN-NDVAS 474
            + +N+     LK LF +                  +P+  + EI+ K   LKN N    
Sbjct: 398 -LRRNNQIQGQLKNLFPEPKY--------------ELPSINFPEILGK---LKNANSAEK 439

Query: 475 FDDIFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGN-DYPKAXXXXXXXXXXX 533
           FD+ FF  L +KEE +TE  RF++D  FL  VLDLIF K + N   P++           
Sbjct: 440 FDETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFP 499

Query: 534 XNRTHNLLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRD 593
             +   LL++++   RLFKQAIVTC            F+I+N EL++DIS RILQD+T+D
Sbjct: 500 KEKAIGLLTKVKSNSRLFKQAIVTCPNLPLQELLQELFTIKNSELVVDISMRILQDYTKD 559

Query: 594 SIKQEMKNLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGA 653
           +IK+E+K L ++ ++NF++FI   +      +                   IGLF LE +
Sbjct: 560 AIKEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGLEES 619

Query: 654 LLDNLASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713
           +L  L+S I+K+V+IAERN ELWN+++ K      ++  + S+ ++    P Y +EY++I
Sbjct: 620 ILIQLSSIIEKEVKIAERNVELWNIMDAKMLSVKKSSSTAASKLAENSQTP-YIVEYIDI 678

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  459 bits (1182), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 268/720 (37%), Positives = 411/720 (57%), Gaps = 79/720 (10%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           M  ++QPFRLA LPKI+SL+N++ Q  Y+QVAD      +N +T+            NPT
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVAD-VLEPTSNTVTVGVSGSSISQYVINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVEIWSFGLM 120
           PKL ++ PIPSTN++T C+ +                               E+WS+ L 
Sbjct: 60  PKLVYNIPIPSTNVVTGCDVLA-------------------------MSDGAELWSYALT 94

Query: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180
            N   +TL+ + +        +     E G D    A  D+    +K   K +V+ ++I 
Sbjct: 95  ANGKVHTLHAVLR-------KAGAAPQETGLD----ASEDE---HFKQTLKGRVVRVRIL 140

Query: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTEN-GTEFVFVLCPLEDDK 239
           +    ++ VL  GL++ YD++L+LLHS DISY N+   ++FT++ G +++FVLC +++ K
Sbjct: 141 SACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVLCDIQNKK 200

Query: 240 VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHC 299
            CYKLF+L+     E+ PI EL+S I+E F+   SK  YQFGKLY+L   K++VYSLPH 
Sbjct: 201 TCYKLFQLN--HSAENLPITELNSVILEDFALAESKMVYQFGKLYRLVDSKMYVYSLPHF 258

Query: 300 QLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRT 359
           QL   + +P + K    +D +S Q +S NR+LLT  N I+LLDLLH +IL +REL++++ 
Sbjct: 259 QLSHCVPLPFVRK----DDQVSLQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNIKF 314

Query: 360 FQLLRSAVI-DSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIG 418
           FQLLR+AVI  +   ++++T AIG+STK G NP+S+L+++ I VGT TLKDSLGK F  G
Sbjct: 315 FQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFLSG 374

Query: 419 KNDTSSVVLKPLF---DDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASF 475
           ++  +   LKPLF   DDE+                 P   +  I+ ++++       +F
Sbjct: 375 EHRRTEA-LKPLFGTDDDES-----------------PNIDFAAILAELTS--RTTPKAF 414

Query: 476 DDIFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXN 535
           D IF+K L  K+E+YTE DRFI++SEFL  +LD IF  F  +++PKA            +
Sbjct: 415 DSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATF-ADEFPKALIYLLTHPLFPSS 473

Query: 536 RTHNLLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSI 595
            T  LL +L+  PRLFKQA+VTC            F++ N EL LD+S R+LQ+FT++ I
Sbjct: 474 HTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDI 533

Query: 596 KQEMKNLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALL 655
           KQ ++ LS++D+ NF++F+    +DST                      +GL +LEG +L
Sbjct: 534 KQGIRELSRVDLHNFLNFVI---KDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDIL 590

Query: 656 DNLASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQ---KQALPTYTMEYLE 712
             L+++ID QV +A++  EL  L+E   ++ G  ++NS +R  +      +P Y++EYL+
Sbjct: 591 HRLSAFIDSQVAVADQLVELLYLLENSSTKKG-KHLNSVTRLDESPVAATIPLYSVEYLD 649

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  459 bits (1180), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 272/717 (37%), Positives = 419/717 (58%), Gaps = 76/717 (10%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           M S+SQPFRL+ LPKI SL+N++ Q DY+QV D   +   N + +            NPT
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVEIWSFGLM 120
           PKL F+ PIPSTNI+TAC+ V+                            + E+W +GL 
Sbjct: 60  PKLVFNLPIPSTNIVTACDVVEDAA-------------------------NTEVWCYGLE 94

Query: 121 VNKGNYTLNVITKA-VEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKI 179
             K ++ L++ TK  ++D   +SN  +T                SQ+K K K +V++IKI
Sbjct: 95  ARKVSH-LHLATKPMIQDAVSSSNAEIT----------------SQFKYKLKSEVVSIKI 137

Query: 180 DAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTEN-GTEFVFVLCPLEDD 238
            +K   V+ +L+NGL++ +D++LKL ++ DISY ++++ ++F +  G +F FVLC L D+
Sbjct: 138 YSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRFVQFFQDGQGNDFFFVLCQLSDE 197

Query: 239 KVCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKL-NQGKIHVYSLP 297
           K+CYKLF++      ES    EL+S I+E ++ E++K C++FGKLY L N  ++ +Y LP
Sbjct: 198 KICYKLFQVR----SESVSCIELNSIILENYTLENAKLCFEFGKLYVLKNSNELSIYQLP 253

Query: 298 HCQLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHV 357
           H QLQ  I +P I+K    + ++S +PVS NR+LLT +NTIYL+DLL+ +IL Q++L ++
Sbjct: 254 HLQLQTSIQLPFISK----DAVVSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQNI 309

Query: 358 RTFQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQI 417
           +  QLL +AV+      N KTIA+ ++TKNG NPTS L++INIDVGT TLKD++GK F +
Sbjct: 310 KAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFMV 369

Query: 418 GKNDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDD 477
            +       L+ LF++ N           D ++ +P+  Y+ IIK++   K   + +FD 
Sbjct: 370 KQKQK----LQKLFEESNE----------DDDVELPSPDYERIIKQLHICKK--IENFDS 413

Query: 478 IFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXNRT 537
           IFFK L + +E+YT+ DRF++DS+ L +++D +F  F  ++YPKA               
Sbjct: 414 IFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFK-DEYPKALTYLLTHPLFPPVHA 472

Query: 538 HNLLSRLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQ 597
             LL++L++ PRLFKQAIVTC            F+I N EL  DI+ R+LQD+ ++SIK 
Sbjct: 473 KGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKA 532

Query: 598 EMKNLSKLDIQNFIDFITNTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDN 657
            ++ + K+DI NF+D I N+++  +   LN                 IGLF+L+   L+ 
Sbjct: 533 GIRKIEKMDITNFLDMILNSNKADSDLKLNK---PQIFQLMSLIIDSIGLFALDDEYLEK 589

Query: 658 LASYIDKQVEIAERNTELWNLVE--TKGSQHGFTNMNSDSRTSQKQALPTYTMEYLE 712
           L+S++D QV +  +N EL +L E  TK S       NS + +S  Q +  YT++YLE
Sbjct: 590 LSSFVDAQVSVVSQNIELLHLAEHYTKHSSVVNNKSNSSTNSSSTQPISAYTVDYLE 646

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  286 bits (731), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 166/396 (41%), Positives = 234/396 (59%), Gaps = 25/396 (6%)

Query: 320 ISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTFQLLRSAVIDSEKSQNSKTI 379
           +SF P+S+NR LLT +N +YLLDLLH +IL+QRE THV+TFQLL +AVI    S N+ TI
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 380 AIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGKNDTSSVVLKPLFDDENVADN 439
           AIG++TK G   TSSL+++NIDVGT TLKDS+GK F   K  T     + L    N    
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSK--TKVQCPQSLLGTPN---- 114

Query: 440 MVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIFFKDLKVKEEHYTEKDRFISD 499
                    +  V    Y +I+K ++  K+N    FD +FFK L +K ++YT+ DRF++D
Sbjct: 115 ---------DTEVQEHNYTQILKDLAKTKSNS-DKFDSVFFKKLNIKNDYYTDSDRFLND 164

Query: 500 SEFLNRVLDLIFEKFNGNDYPKAXXXXXXXXXXXXNRTHNLLSRLRDQPRLFKQAIVTCX 559
            EFL   L LIFE F  ++YPKA              TH+LL +L+D PRLFKQAIVTC 
Sbjct: 165 QEFLGNSLKLIFENFQ-SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCP 223

Query: 560 XXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKNLSKLDIQNFIDFIT--NT 617
                      F++ N EL LD+S RILQDF++DSIK  +K  SK+D+  FI+F+   N 
Sbjct: 224 NLPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENV 283

Query: 618 DEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDNLASYIDKQVEIAERNTELWN 677
           DED                        +GLF+LE   LD L++YID+Q+ + ++N +L+N
Sbjct: 284 DEDRV------KNKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYN 337

Query: 678 LVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713
           LV+ +  ++     ++DS +  + A+  Y++E LE+
Sbjct: 338 LVDERNFKNILGQHHADSLSVGEGAITAYSVEQLEL 373

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  237 bits (605), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 183/576 (31%), Positives = 308/576 (53%), Gaps = 80/576 (13%)

Query: 163 LSQYKIKTKDKVMNIKIDAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNL------- 215
           L+  K+  + K+M  K+ +  S  I +L+NG +E YD  L +  +Y   + +L       
Sbjct: 89  LNGKKVPIQSKIM--KLFSDESQTITILENGTIEKYDSNL-IKSTYKTPHKDLVNVEFIE 145

Query: 216 -KYAKWFTENGTEFVFVLCPLEDDKVCYKLFELSDFEGKESSPIKELSSTIIEGFSFESS 274
            KYA   ++N          L D     +L  +++ +    S  K L             
Sbjct: 146 SKYALLISQNS-------ISLYDINTMIELRNVANVQDIVDSDFKSLD------------ 186

Query: 275 KFCYQFGKLYKLNQ--GKIHVYSLPHCQLQQIIDVPLINKPTSENDLISFQPVSVNRILL 332
                 GKLY+ NQ   K  ++ +    +  II +P IN    E D++SF  V  N +++
Sbjct: 187 ------GKLYQFNQKLSKFDIWEISSMTIVNIITIPFIND--VEKDVVSFTVVDDNCVVM 238

Query: 333 TVNNTIYLLDLLHCSILNQRELTHVRTFQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPT 392
            VN+TIY L+L   S+++  EL +++ F+L     ID+  +Q      +G+S  N     
Sbjct: 239 AVNSTIYALNLHLSSVISMSELLNLKWFKL-----IDNLSNQ----FVLGLSFNNE---N 286

Query: 393 SSLEIINIDVGTN-TLKDSLGKSFQ----IGKNDTSSVVLKPLFDDENVADNMVKRNDID 447
              E+IN+D+ +N  LKDSLGK F+      +++  ++VLK LF  +   +++   ND D
Sbjct: 287 YKFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDL--HNDSD 344

Query: 448 GNISVPTFQYDEIIKKIS-ALKNNDVASFDDIFFKDLKVKEEHYTEKDRFISDSEFLNRV 506
            ++   TF YD+II  ++ A+KN   + FD IFF+   +K+EHYTE DRF+ + +FL +V
Sbjct: 345 SDVE-HTFNYDKIIVDLNKAVKNP--SKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKV 401

Query: 507 LDLIFEKF----NGNDYPKAXXXXXXXXXXXXNRTHNLLSRLRDQPRLFKQAIVTCXXXX 562
           ++LI + +    +GN+YPK             + T NLL + R+ PRL+KQAIVTC    
Sbjct: 402 IELILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLP 461

Query: 563 XXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKNLSKLDIQNFIDFITNTDEDST 622
                   F+I N EL LDIS R+LQD+T+DSIK+++K L K+DI+NFI+F+T  DED  
Sbjct: 462 LGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQ-DEDQQ 520

Query: 623 LENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDNLASYIDKQVEIAERNTELWNLVETK 682
           + +                   IGLF+L+  +L  ++++I+++  +A++N+EL +L++  
Sbjct: 521 VSS-------QLFQLLSLIIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYN 573

Query: 683 GSQHGFTN-----MNSDSRTSQKQALPTYTMEYLEI 713
            S+          +N+++++  ++ LPTYT+E+L++
Sbjct: 574 PSKQSSARQSSKLINNNNKSLHRKTLPTYTVEHLDL 609

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 1  MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
          MPS+SQPF + T+PK +S S        + V+       +N++ +            NPT
Sbjct: 1  MPSISQPFAITTVPKQSSTSP-------IIVSSHSLTANSNSLDVAISKYAVSKFVINPT 53

Query: 61 PKLTFDYPIPSTNIITA 77
          PKL    PIPS  ++TA
Sbjct: 54 PKLINSIPIPSNEVVTA 70

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  232 bits (592), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 198/645 (30%), Positives = 307/645 (47%), Gaps = 97/645 (15%)

Query: 101 HEVTNFQSKRDVEIWSFGLMVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTD 160
           H +T+  +  DV +  + +      Y +N   K V      SN  LT    D   YA   
Sbjct: 28  HSLTSNANTLDVAVSKYSI----SQYIINPTPKLVNSKAIPSN--LTVTAFDNGVYATQS 81

Query: 161 DILS-------QYKIKTKDKVMNI---KIDAKNSLVIAVLQNGLVEFYDFKLKLLHSYDI 210
           +  S        ++I  K  V+N    KI  ++ +  A+LQ+G V+ Y            
Sbjct: 82  NNKSFCLYLDESHQIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQKY------------ 129

Query: 211 SYGNLKYAKWFTENGTEFVFV-LCPLEDDK-VCYKLFELSDFEGKESSPIKELSS----T 264
                         G E VF    PL+D K V +   + +     +S+ + EL +     
Sbjct: 130 -------------KGGEQVFAKHLPLKDIKQVEFIDGQYALIVAAQSTALYELENLTELR 176

Query: 265 IIEGFSFESSKFCYQ-FGKLYK--LNQGKIHVYSLPHCQLQQIIDVPLINKPTSENDLIS 321
           +     FE  K   Q  GK+Y+  L      ++ L       ++++P ++   S+   ++
Sbjct: 177 VSTTLHFEQFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLS--ASKGAPLT 234

Query: 322 FQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTFQLLRSAVIDSEKSQNSKTIAI 381
           F  V  +R+ L + N IYLLDL   S+L+  +   ++  +L+  A           + AI
Sbjct: 235 FTVVGDSRVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGA--------RDGSFAI 286

Query: 382 GISTKNGPNPTS-SLEIINIDVGTNTLKDSLGKSFQI----GKNDTSSVVLKPLFDDENV 436
            +S  +GP   + SL+IIN+++G+ ++KDSLGK F       ++  S V L+P+ D    
Sbjct: 287 ALS--HGPQDNAVSLDIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILD---- 340

Query: 437 ADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIFFKDLKVKEEHYTEKDRF 496
           A +  KR          +F Y  I+KK++A    D A FD IFFK+L + +E YTE DRF
Sbjct: 341 AGDKTKR----------SFDYASILKKLTA-AAKDPAKFDQIFFKELYIVQECYTEGDRF 389

Query: 497 ISDSEFLNRVLDLIFEKFN---GNDYPKAXXXXXXXXXXXXNRTHNLLSRLRDQPRLFKQ 553
           I D  FL+  + +I + ++    + YP A            ++T +LLS+++  PRL+KQ
Sbjct: 390 IIDQNFLSETVGVILKNYSFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQ 449

Query: 554 AIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKNLSKLDIQNFIDF 613
            IVTC            F I N EL LD+S +ILQD+T+DSIK+EMK L ++++ NFI F
Sbjct: 450 VIVTCPNLPLDELLTESFVIENNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKF 509

Query: 614 IT----NTDEDSTLENLNHXXXXXXXXXXXXXXXXIGLFSLEGALLDNLASYIDKQVEIA 669
           +     N+DE S                       IGLF+L+G LL  LA YID  V+IA
Sbjct: 510 VIGNYNNSDESSV-------ATPQLFQLLSLVIDSIGLFALDGELLTELAGYIDNMVKIA 562

Query: 670 ERNTELWNLVETKGSQHGFTNMN-SDSRTSQKQALPTYTMEYLEI 713
           E NTELWNL+E + ++      N S    +QK+  P Y +++LEI
Sbjct: 563 EMNTELWNLLEFRTNKASVAGSNRSKYVKTQKKVFPPYLVDHLEI 607

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 7/75 (9%)

Query: 3  SLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPTPK 62
          S+SQPF +A +P+ AS +        V ++        N + +            NPTPK
Sbjct: 4  SISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56

Query: 63 LTFDYPIPSTNIITA 77
          L     IPS   +TA
Sbjct: 57 LVNSKAIPSNLTVTA 71

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  130 bits (326), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 126/251 (50%), Gaps = 43/251 (17%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLXXXXXXXXXXXXNPT 60
           MPS+SQPFRL  LPKIASL+N++ Q  Y+QVAD      TN + +            NPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVADT-LTPATNRVNVGISGSAISQYVINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEXXXXXXXXXXXXHEVTNFQSKRDVEIWSFGLM 120
           PKL ++ PI STN++TAC+        E            HEV             + L 
Sbjct: 60  PKLVYNLPISSTNVVTACDVA------EVAGTNNEGTAEAHEV-----------LCYALQ 102

Query: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTD----DILSQYKIKTKDKVMN 176
            NK  +++  + K +                     A TD    +  + +K+   ++ +N
Sbjct: 103 ANK-TFSICAVKKPIPS-------------------AATDSSFGETYATHKVALANQAVN 142

Query: 177 IKIDAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWF-TENGTEFVFVLCPL 235
           +K+      ++AVL +GL++F+D+ LKL HS D SYGN+++ + F +E+  +F+F+L  L
Sbjct: 143 VKVFPATKSIVAVLSSGLIQFFDYDLKLQHSIDSSYGNVQFVQHFVSESKQDFMFLLSDL 202

Query: 236 EDDKVCYKLFE 246
           +  KV +KL +
Sbjct: 203 DGRKVSFKLLK 213

>Kwal_27.11352 s27 complement(764840..766894) [2055 bp, 684 aa] {ON}
           YLR149C - Hypothetical ORF [contig 28] FULL
          Length = 684

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 69/151 (45%), Gaps = 16/151 (10%)

Query: 176 NIKIDAKNSLVIAVLQNGLVEFYDFKLK---LLHSYDISYGNLKYAKWFTENGTEFVFVL 232
           ++K D++     +V++N  +  Y    +   + H Y++  G+  +   F+EN   F  V 
Sbjct: 298 SLKYDSQPEWGSSVIRNKRIPRYAMPDRSGFVDHIYEVPSGDHGFYTSFSENDMMFASVF 357

Query: 233 CPLEDDKVCYKLFELSDFEGKESSPIKELSSTI--IEGFSFESSKFCYQFGKLYKLNQ-- 288
              ++   C  +++    E    +P+ E+SST    +  +F   KF      L  +++  
Sbjct: 358 ---QNGTCC--VYDTRKME----TPLCEISSTRKHTQNGAFRVCKFSQGLDDLLFISEHH 408

Query: 289 GKIHVYSLPHCQLQQIIDVPLINKPTSENDL 319
           G++H+    +    Q+I +P  +K  SEN L
Sbjct: 409 GRVHIVDTRNFMNHQVIMIPDRSKTVSENKL 439

>NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 64/138 (46%), Gaps = 34/138 (24%)

Query: 210 ISYGNLKYAKWFTENGTEFVFVLCPLEDDKVCY----KLFELSDF--EGKESSPIKELSS 263
           +SYG+  +A+W  E+  E +F +      K CY    + F+ +D    GK          
Sbjct: 25  MSYGSKAWAQW-VEDDKEKIFQIF-----KHCYDIGFRTFDTADVYSNGK---------- 68

Query: 264 TIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQLQQIIDVPLINKPTSEN---DLI 320
                    S +   +F + +++ +  + + +  + ++ + +D+PL   P SEN   DL+
Sbjct: 69  ---------SERLLGEFLRKFEIRRETVVILTKTYFRVDETLDLPLGEFPHSENDVLDLV 119

Query: 321 SFQPVSVNRILLTVNNTI 338
           + Q +S   IL +V N++
Sbjct: 120 NQQGLSRKHILDSVKNSV 137

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,585,862
Number of extensions: 3537172
Number of successful extensions: 13065
Number of sequences better than 10.0: 67
Number of HSP's gapped: 13367
Number of HSP's successfully gapped: 71
Length of query: 713
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 596
Effective length of database: 40,065,477
Effective search space: 23879024292
Effective search space used: 23879024292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)