Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.4153.487ON31331316810.0
Skud_7.4383.487ON31331313960.0
YGR127W3.487ON31231313880.0
Smik_6.2233.487ON31331313840.0
NCAS0E008403.487ON3363258181e-108
CAGL0I10582g3.487ON3193257891e-104
NDAI0G009703.487ON3323397751e-101
KAFR0C019303.487ON3133237348e-96
SAKL0F02882g3.487ON2983167224e-94
Kpol_1017.93.487ON3103246713e-86
TDEL0D055503.487ON3103166574e-84
KNAG0B008403.487ON3133236513e-83
KLLA0E04687g3.487ON3063216426e-82
TPHA0D032603.487ON3143246123e-77
ZYRO0D10098g3.487ON2762615936e-75
Kwal_55.212173.487ON3033095913e-74
KLTH0F14718g3.487ON3003165601e-69
TBLA0D029903.487ON3183215272e-64
Ecym_12423.487ON3113235052e-61
AFR305W3.487ON3093214983e-60
TPHA0M004403.146ON31859721.5
KNAG0D005606.306ON88056685.6
NDAI0D008606.17ON66669668.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.415
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   652   0.0  
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   542   0.0  
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   539   0.0  
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   537   0.0  
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   319   e-108
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   308   e-104
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   303   e-101
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   287   8e-96
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   282   4e-94
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   263   3e-86
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   257   4e-84
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   255   3e-83
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   251   6e-82
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   240   3e-77
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   233   6e-75
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   232   3e-74
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   220   1e-69
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   207   2e-64
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   199   2e-61
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   196   3e-60
TPHA0M00440 Chr13 (85489..86445) [957 bp, 318 aa] {ON} Anc_3.146...    32   1.5  
KNAG0D00560 Chr4 (78466..81108) [2643 bp, 880 aa] {ON} Anc_6.306...    31   5.6  
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...    30   8.6  

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/313 (100%), Positives = 313/313 (100%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60
           MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60

Query: 61  GINKEGKLATILNLKMDDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYDGLR 120
           GINKEGKLATILNLKMDDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYDGLR
Sbjct: 61  GINKEGKLATILNLKMDDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYDGLR 120

Query: 121 TTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISEQAW 180
           TTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISEQAW
Sbjct: 121 TTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISEQAW 180

Query: 181 EKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVTMNT 240
           EKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVTMNT
Sbjct: 181 EKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVTMNT 240

Query: 241 IYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSHYSA 300
           IYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSHYSA
Sbjct: 241 IYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSHYSA 300

Query: 301 SAPKEEKRFEFEL 313
           SAPKEEKRFEFEL
Sbjct: 301 SAPKEEKRFEFEL 313

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/313 (80%), Positives = 285/313 (91%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60
           MCILMATRAHP YELILISNRDEFL RKTHATCWHNDDFILSPYD+AKTS EKQIFGTWS
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60

Query: 61  GINKEGKLATILNLKMDDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYDGLR 120
           GIN+EGKLATILNLK+D QR   KSKSRG+LPFTFL++HKA FQ+WD+Y+KFE +YDGL 
Sbjct: 61  GINREGKLATILNLKLDGQRDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYDGLN 120

Query: 121 TTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISEQAW 180
           TTGDFNFFYGDVIEK+YK+IDSLG TF+VL STC+ + +SYM +SNG+++NS SISEQAW
Sbjct: 121 TTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISEQAW 180

Query: 181 EKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVTMNT 240
           +KVK+ARD LE L+L NI+SDEET+ISNCFQLASKSS+P T  KP+ LQML DPNV MNT
Sbjct: 181 KKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVIMNT 240

Query: 241 IYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSHYSA 300
           IYVPPLRRPP DDLGASIPDGDYYGTRSQIVLLVSK+SSKVTFIER+LYSSDEDV+HYS 
Sbjct: 241 IYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNHYSV 300

Query: 301 SAPKEEKRFEFEL 313
           + PKEEKRFEF+L
Sbjct: 301 ATPKEEKRFEFKL 313

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/313 (81%), Positives = 288/313 (92%), Gaps = 1/313 (0%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60
           MCILMATRAHP YELILISNRDEFL RKTHATCWHN+DFILSPYD+AKTS EKQIFGTWS
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60

Query: 61  GINKEGKLATILNLKMDDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYDGLR 120
           GINKEGKLATILNLK+D++++ TKS+SRG+LPF FL+ HKA F+DWD+Y KFE HYDGL+
Sbjct: 61  GINKEGKLATILNLKLDNEQNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGHYDGLK 120

Query: 121 TTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISEQAW 180
           +TGDFNFFYGDVI+K+YKVIDSLG TFDVL STCR+D DSYMV+SNGK+++SSSI  QAW
Sbjct: 121 STGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPGQAW 180

Query: 181 EKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVTMNT 240
           EKVK+ARDSLE L+L+NIESDEE +IS+CFQLASKSSLP T   PD+LQM VDPNVTMNT
Sbjct: 181 EKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQM-VDPNVTMNT 239

Query: 241 IYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSHYSA 300
           IYVPPLRRPP DDLGASIPDGDYYGTRSQIVLLVSKDS++VTFIERVLYSSDEDV  YS 
Sbjct: 240 IYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKYSV 299

Query: 301 SAPKEEKRFEFEL 313
           ++PKEEKRF+F+L
Sbjct: 300 TSPKEEKRFKFKL 312

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/313 (80%), Positives = 283/313 (90%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60
           MCILMATRAHP YELILISNRDEFL RKTHATCWHNDDFILSPYD+A+TS E Q FGTWS
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60

Query: 61  GINKEGKLATILNLKMDDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYDGLR 120
           GINKEGKLATILNLK+  +RS  KSKSRG+LP+ FL++H+A F+DWD Y+KF  HYDGL+
Sbjct: 61  GINKEGKLATILNLKLGSERSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYDGLK 120

Query: 121 TTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISEQAW 180
            TGDFNFFYGDVIEK+YKVIDSLG TFDVL STCR+D DSYMVISNG+++N+SSI E+AW
Sbjct: 121 ATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEKAW 180

Query: 181 EKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVTMNT 240
           EKVK+ARDSLE L+ DNI  DEET+IS+CFQLASKSSLP T  KPD+LQMLVDPNVTM+T
Sbjct: 181 EKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVTMST 240

Query: 241 IYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSHYSA 300
           IYVPPLRRPPGDDLGASIPDGD+YGTRSQIVLL+SKDS+K TFIER++YSSDEDV  YS 
Sbjct: 241 IYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQYSV 300

Query: 301 SAPKEEKRFEFEL 313
           SAPKEEKRFEFEL
Sbjct: 301 SAPKEEKRFEFEL 313

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  319 bits (818), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 161/325 (49%), Positives = 213/325 (65%), Gaps = 24/325 (7%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTS--MEKQIFGT 58
           MCIL+AT AHP YELILISNRDEF ERKTH +CWHNDDFILSP+D+AK+    EK+IFGT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 59  WSGINKEGKLATILNLKMDDQ---RSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKH 115
           W GIN++ K+ATILNLK++ Q   +   K +SRGM+PF FL+ H + F  WD Y KF+  
Sbjct: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136

Query: 116 YDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSI 175
           Y+ LR TGDFNFFYGD +   Y++IDS G+TF VL        D Y+ +SN  +      
Sbjct: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSG------DPYLTVSNDMFATGGIT 190

Query: 176 SEQA-------WEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSL-PDTGLKPDL 227
            E+A       W K+K  +  L+ L+ ++   DE+ LI  CF+LAS  S+ P    K + 
Sbjct: 191 VERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFN- 249

Query: 228 LQMLVDPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERV 287
                +  + M TI+VPPL     DD+G S+  G YYGTRSQIV+L+SK+  +V  +E +
Sbjct: 250 ----QNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHI 305

Query: 288 LYSSDEDVSHYSASAPKEEKRFEFE 312
           LY+SD D+ HYS++ PKE K FEF+
Sbjct: 306 LYTSDNDIQHYSSTNPKEVKSFEFK 330

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  308 bits (789), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 213/325 (65%), Gaps = 19/325 (5%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAK--TSMEKQIFGT 58
           MCIL ATR HP YELI+ISNRDEFLERKTH+TCWHNDDFILSPYD+A+         FGT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 59  WSGINKEGKLATILNLKMDDQ---RSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKH 115
           W+G+N++G++AT+LNL++ D+   +     +SRG LPF FL   +  F+DWD Y KF K 
Sbjct: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120

Query: 116 YDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNG---KYHNS 172
           Y  ++ TGDFN FYGD  E RY +IDSLG+T  +     +     Y+VISN    K H  
Sbjct: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGK----GYLVISNNIHDKLHLQ 176

Query: 173 S---SISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKP-DLL 228
           S   +   + W K+K  +  +E  +  N    +E +I NCF+LAS + + D   +  DL+
Sbjct: 177 SQDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLV 236

Query: 229 QMLVDPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVL 288
           + L    VT  TIYV PL  PP +++G+ +  G YYGTRSQIVLLV K  +K TFIER++
Sbjct: 237 KSL---GVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERII 293

Query: 289 YSSDEDVSHYSASAPKEEKRFEFEL 313
           YSSD+D+S YS S PKEE R+E+++
Sbjct: 294 YSSDQDISLYSTSNPKEELRYEYDI 318

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  303 bits (775), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 158/339 (46%), Positives = 219/339 (64%), Gaps = 35/339 (10%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSM--EKQIFGT 58
           MCIL+AT AHP YELILISNRDEFL+RKTH +CWHNDDFILSPYD+AK     +K++FGT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 59  WSGINKEGKLATILNLKMDDQRSCTK---SKSRGMLPFTFLTSH-KARFQDWDDYNKFEK 114
           W GINK+GK+AT+LNLK++   S  +    KSRGMLPF +L+   +  F +WD Y+ F K
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120

Query: 115 HYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSS 174
            Y GL++TGDFN FYGDV  K+Y+++DS+G+T   L S C+     Y+V+SN  +  +  
Sbjct: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQ-----YLVVSNDVFTCNGQ 175

Query: 175 ISE------------------QAWEKVKIARDSLETLILDNI--ESDEETLISNCFQLAS 214
           + E                  + W KVK+    L++L+  +I  + DE+T+IS CF+L+S
Sbjct: 176 LGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSS 235

Query: 215 KSSLPDTGLKPDLLQMLVDPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLV 274
             S+       D  +   +  +   TI VPPLR    DD+G S+P G+YYGTRSQIV+L+
Sbjct: 236 TCSVT----VEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILI 291

Query: 275 SKDSSKVTFIERVLYSSDEDVSHYSASAPKEEKRFEFEL 313
            + + +V F E V+Y+SD D+  +S + PKE  RF+F L
Sbjct: 292 KRGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  287 bits (734), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 148/323 (45%), Positives = 212/323 (65%), Gaps = 21/323 (6%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSME-KQIFGTW 59
           MCIL ATR+H  YELILISNRDE+L RKTH TCWHND+FILSPYD+++      +IFGTW
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60

Query: 60  SGINKEGKLATILNLKM---DDQRSCTKSKSRGMLPFTFLTS---HKARFQDWDDYNKFE 113
            G+NK+GK+ATILNL+     D +   K +SRG++PFTFL S   ++  F++W+ + KF+
Sbjct: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120

Query: 114 KHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKY-HNS 172
             Y  L+++GDFNFFYGD+ E  Y++IDSLG+TF VL +  R      M+ISN  Y H  
Sbjct: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRN-----MIISNDLYQHKD 175

Query: 173 SSISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLV 232
               +  W K+KI  + L   + +   S+E+ +++ CF+LAS  S+  +  + +      
Sbjct: 176 EYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREE------ 229

Query: 233 DPN--VTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYS 290
           +PN  +   TIYVPPL+  P +D+G +  +G YYGTR+QIV+LV KD   VT +E  +++
Sbjct: 230 NPNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHN 289

Query: 291 SDEDVSHYSASAPKEEKRFEFEL 313
           SDE++  YS   PKE +R +F +
Sbjct: 290 SDEEIYKYSGLNPKEVQRLDFTI 312

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  282 bits (722), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 144/316 (45%), Positives = 201/316 (63%), Gaps = 21/316 (6%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60
           MCIL+ T AHP Y LILISNRDEF ER+TH TC H+DDFI+SP+D++ T+  +  FGTW 
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRN-FGTWC 59

Query: 61  GINKEGKLATILNLKM---DDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYD 117
           G+NK+GK+A ILNL++    + ++    +SRG++P  FL      F +WD Y KF  HY 
Sbjct: 60  GVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYP 119

Query: 118 GLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISE 177
           G+  TG+FN FYGD  +  YK+I SL  T D       ++ D YMV+SN         S+
Sbjct: 120 GIEKTGNFNLFYGDCSKGEYKLISSLSETTDGF-----QNDDGYMVVSNDLIS-----SK 169

Query: 178 QAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVT 237
           + W K+ +A++ L  L+  +++  +++++  CF+LAS S+  +         ++   +VT
Sbjct: 170 KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEK-------IVVKHESVT 222

Query: 238 MNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSH 297
             TIYVPPL    G DL  S+P G YYGTRSQIV+LVSKD  K+TF+ERVLY+ DEDV  
Sbjct: 223 NETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLK 282

Query: 298 YSASAPKEEKRFEFEL 313
           Y    PKE+  FEF++
Sbjct: 283 YGPKNPKEQIEFEFDI 298

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  263 bits (671), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 151/324 (46%), Positives = 210/324 (64%), Gaps = 25/324 (7%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDF--ILSPYDVAKTSMEKQI--F 56
           MCIL+A+R HP Y+LILISNRDEFL+R+TH TCW+  ++  IL PYD++K S EK +   
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSK-SNEKNVNKI 59

Query: 57  GTWSGINKEGKLATILNLKMDD--QRSC-TKSKSRGMLPFTFLTSHKA-RFQDWDDYNKF 112
           GTW GIN+ G+++TILNLK DD  Q S  +  KSRG LP  FL + +     +WD Y KF
Sbjct: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119

Query: 113 EKHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNS 172
            K Y  ++ TGDFNFFYGDV   +Y VIDS+G T +VL        + Y+VISN K+  S
Sbjct: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTV-----DNPYLVISNDKFGKS 174

Query: 173 SSISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLV 232
           +  S + WEK+ +A++ L+ L L   E D   LI  CF +AS ++L +     DL++ + 
Sbjct: 175 NGKSTKEWEKITLAKNLLKHLPLCETEDD---LIHKCFDIASTNTLNE-----DLIKDVD 226

Query: 233 DPNVTMNTIYVPPLR---RPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLY 289
              +   TI VPPL    +   + +GAS+P G YYGTRSQIV+LV+K+ +KV FIER+LY
Sbjct: 227 VRELMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILY 286

Query: 290 SSDEDVSHYSASAPKEEKRFEFEL 313
           +SD+DV+    S+P ++  + F +
Sbjct: 287 NSDDDVTTQKLSSPIQDLTYNFTI 310

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  257 bits (657), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 135/316 (42%), Positives = 195/316 (61%), Gaps = 11/316 (3%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60
           MCIL+AT  HP Y+L+L+SNRDE+  RK     W  D+F+L P D    S  + + GTW 
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDL-GTWI 59

Query: 61  GINKEGKLATILNLKM---DDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYD 117
           G N++GK+ T+LNLK+      R     +SRG +P +FL+S  A F+DWD Y+KF   + 
Sbjct: 60  GANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQ 119

Query: 118 GLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISE 177
           GL  T DFNFFYGD     Y+VIDSLG+T  VLG T  +    Y+V+SN  +   S+   
Sbjct: 120 GLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEK----YIVVSNDIFQGESN-KN 174

Query: 178 QAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVT 237
           + W+K+ +A  +L  L+ +  ++DE+  I  CF +AS +         +     V+  ++
Sbjct: 175 RVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVE--LS 232

Query: 238 MNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSH 297
           M T++VPPL+    D LGAS+P G+YYGTRSQ V+LVSKD S +T++ER+++ SD D   
Sbjct: 233 MQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQ 292

Query: 298 YSASAPKEEKRFEFEL 313
           YS    KE+KR++F+L
Sbjct: 293 YSRDHYKEQKRYDFDL 308

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  255 bits (651), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 142/323 (43%), Positives = 197/323 (60%), Gaps = 22/323 (6%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSME--KQIFGT 58
           MCIL+ TR HP Y+L+LISNRDEF ER TH T WH+ D+ILSPYD+ K   +  K + GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 59  WSGINKEGKLATILNLKMDDQ------RSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKF 112
           W G+N+ G+++T+LNLK++ +      ++  K +SRG++PF FL S +     WD + KF
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFL-SDRGFIDQWDSFEKF 119

Query: 113 EKHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYH-- 170
              Y  L  +GDFN F GD+ ++ YKV+DS G+TF VL  T   +    MV+SN  Y   
Sbjct: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMN----MVVSNDTYKEF 175

Query: 171 NSSSISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQM 230
           N + ISE  W KVK+ +  L  L+   +  D+ + I  CF  AS  S+  +    D+ + 
Sbjct: 176 NENDISE--WNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKS--HEDISKT 231

Query: 231 LVDPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYS 290
              P V  NTI+VPPL+  P  D+G +   G Y+GTRSQ+V LVSKD  +VT  ER+L++
Sbjct: 232 ---PEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHT 288

Query: 291 SDEDVSHYSASAPKEEKRFEFEL 313
           SD D    S   PKE K+F F+L
Sbjct: 289 SDLDRDFNSPHNPKEVKQFTFDL 311

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  251 bits (642), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 190/321 (59%), Gaps = 25/321 (7%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60
           MCIL ATRAHP Y+LIL+SNRDEF ERKTHATCW++D FILSPYD+A    + Q +GTW 
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMA-IEKKGQGYGTWL 59

Query: 61  GINKEGKLATILNLKMD---DQRSC---TKSKSRGMLPFTFLTSH-KARFQDWDDYNKFE 113
           GIN+ G++A ILNLK+D   D  S     + +SRG++P  FL     A F +WD + KF 
Sbjct: 60  GINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119

Query: 114 KHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSS 173
             +  LR TG F  FYGD     Y VID L H      ST   +   +MVISN  +H + 
Sbjct: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKH------STNPFEKMEHMVISNDIFHCAV 173

Query: 174 SISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVD 233
                 W K +     L+ L  +     +E L+  CF+L S  +  + G   D       
Sbjct: 174 GEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTF-NEGEDVD------- 225

Query: 234 PNVTMNTIYVPPLRRPPG-DDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSD 292
            +VT ++IYVPPLR   G D +G S+P GDYYGTRSQIV+LV KD ++VT+ E V+Y SD
Sbjct: 226 -SVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKD-NRVTYEEHVIYESD 283

Query: 293 EDVSHYSASAPKEEKRFEFEL 313
           ED   YS   PKE  +F+F +
Sbjct: 284 EDCETYSFMDPKEVIQFQFNM 304

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  240 bits (612), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 133/324 (41%), Positives = 198/324 (61%), Gaps = 22/324 (6%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWH--NDDFILSPYDVAKTSMEKQIFGT 58
           MCIL  TR+HP YELILISNRDEFL+RKT  +CW+  ++  +L PYD+++   +   FGT
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60

Query: 59  WSGINKEGKLATILNLKMDDQR---SCTKSKSRGMLPFTFLTSHKAR-FQDWDDYNKFEK 114
           W GIN+ G+++++LNLKMD+ +      + KSRG LP  FL + K   F DW+ Y+KF K
Sbjct: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120

Query: 115 HYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSS 174
            Y  L  TG FN F GDV ++ Y +IDS G T  +L      +  S +VISN ++    S
Sbjct: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGK-DENGKSSVVISNSEF---IS 176

Query: 175 ISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKP--DLLQMLV 232
             ++ W K+      ++  +  +I  DE ++I +CF++AS S L +  L    D+L ++ 
Sbjct: 177 NDKERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSELTNEYLHSHDDILDLMT 235

Query: 233 DPNVTMNTIYVPPLRRP---PGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLY 289
           +      T++VPP++       D++GAS+P G +YGTRSQIV+LV+K+ + V ++ERVLY
Sbjct: 236 E------TVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLY 289

Query: 290 SSDEDVSHYSASAPKEEKRFEFEL 313
             D+DVS      P  E  FE+ +
Sbjct: 290 ECDDDVSKAGIEKPINELNFEYNI 313

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  233 bits (593), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 125/261 (47%), Positives = 167/261 (63%), Gaps = 11/261 (4%)

Query: 56  FGTWSGINKEGKLATILNLKMDD--QRSCT-KSKSRGMLPFTFLTSHKARFQDWDDYNKF 112
           FGTW GINK+G++ T+LNLK+D   QR       SRG +P  FL+ H   ++ W+ YNKF
Sbjct: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKF 82

Query: 113 EKHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNS 172
              +  L  TGDFNFFYGD    +YK+IDSL  T DVL +   +D  SYMV+SN  Y   
Sbjct: 83  ANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRYQ 142

Query: 173 SSISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLV 232
               E+ W KV++A+ +L  LI DN+  D+++ IS CFQ+AS S     GL     ++L 
Sbjct: 143 ---GEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSP----GLDWQSEELLK 195

Query: 233 DPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSD 292
             +VT  +I+VPPL+ PP  +LG +   G +YGTRSQIVLLVSKD  KVTF+ERVL++SD
Sbjct: 196 SSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHNSD 254

Query: 293 EDVSHYSASAPKEEKRFEFEL 313
           E VS  S   P E+ +F+F+L
Sbjct: 255 EQVSQRSPDHPAEQLKFQFDL 275

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  232 bits (591), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 128/309 (41%), Positives = 182/309 (58%), Gaps = 25/309 (8%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60
           MCIL+A+ AHP Y LILISNRDEF+ER+T  TC ++DD+++SP D+      +   GTW 
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60

Query: 61  GINKEGKLATILNLKMDDQRSCTKSK---SRGMLPFTFLTSHKARFQDWDDYNKFEKHYD 117
           G N+ G++A ILNL+  +    TK+K   SRG +   +LT  K    DW+ Y KF     
Sbjct: 61  GANRNGRIAVILNLRTGNTNQ-TKTKRIVSRGNVTMRYLTD-KQPASDWNSYAKFASKCP 118

Query: 118 GLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISE 177
            +++  +FN FYGD     Y  IDS GH+F+VL     R  + Y+VISN         S 
Sbjct: 119 DIKSC-EFNMFYGDCKSGDYTAIDSSGHSFEVL-----RSQNPYLVISNDSIE-----SA 167

Query: 178 QAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDL-LQMLVDPNV 236
             W K+++A   +  L+ D++   E+ L++ CF LAS         K D  +  +    V
Sbjct: 168 TKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH--------KQDYNVDHMDKEKV 219

Query: 237 TMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVS 296
           T + I+VPPL  P  +DLGAS+P G +YGTRSQIV+LVSK+   + F+E VLY SD + +
Sbjct: 220 TSSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETT 279

Query: 297 HYSASAPKE 305
           H+ A+ PK+
Sbjct: 280 HFCAANPKK 288

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  220 bits (560), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 130/316 (41%), Positives = 182/316 (57%), Gaps = 22/316 (6%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60
           MCILMA+ AHP Y LI ISNRDEF ERKT  TC ++DD+ILSP D A  S  K   GTW 
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60

Query: 61  GINKEGKLATILNLKMDD--QRSCTKSK-SRGMLPFTFLTSHKARFQDWDDYNKFEKHYD 117
           G+N++G++A ILNL+  +  +R   KS  SRG +P  +L   +    DW+ + KF   Y 
Sbjct: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMD-RGPSTDWNSFEKFVSKYP 119

Query: 118 GLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISE 177
            + T  +FN FYGD I   Y  IDSLG++ + L +     P+  +V+SN    +SS    
Sbjct: 120 QI-TECEFNMFYGDCIAGEYTCIDSLGYSSEALTAN---KPN--LVLSNDHIDSSSR--- 170

Query: 178 QAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVT 237
             W KV+ A   L+ L+  +    EE LI  CF LAS +       +P  +        T
Sbjct: 171 --WPKVQKADILLQELVQSSQHDSEEELIEKCFALASNT-------EPAEIDNSDKEEFT 221

Query: 238 MNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSH 297
            ++I++PP+  P   D+GAS+P G +YGTRSQIV+LV +    ++F ERVL+ SD +V  
Sbjct: 222 CSSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPL 281

Query: 298 YSASAPKEEKRFEFEL 313
           +S   PKE+ +F   +
Sbjct: 282 HSEKHPKEKLQFNLHV 297

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  207 bits (527), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/321 (38%), Positives = 182/321 (56%), Gaps = 37/321 (11%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSME-------- 52
           MCIL+ T AHP Y+LILISNRDE  ER+TH+TCW+++  IL PYD++K            
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 53  KQIFGTWSGINKEGKLATILN-LKMDDQR---SCTKS-KSRGMLPFTFLTSHKARFQDWD 107
           K   GTW G+NK+GK+ T+LN LK ++ R    C  S +SRG++P  +L      FQDW+
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDWN 120

Query: 108 DYNKFEKHYDGL-RTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISN 166
            Y+KF +    +    G FN F GD+    Y +I+S+G +  VL      + + YMV+SN
Sbjct: 121 TYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLD-----EENPYMVVSN 175

Query: 167 GKYHNSSSISEQAWEKVKIARDSLETLI---LDNIESDEETLISNCFQLASKSSLPDTGL 223
             + +   + E  W K+K     LETLI   LDN   DE  ++ +CFQ++S  +L    +
Sbjct: 176 INWGDPKKMGE--WSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKI 233

Query: 224 KPDLLQMLVDPNVTMNTIYVPPLRRPPGD---------DLGASIPDGDYYGTRSQIVLLV 274
             ++ ++      T + I+VPPL+R  G+            A      YYGTRSQIV+L 
Sbjct: 234 DGNIERL----EQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLC 289

Query: 275 SKDSSKVTFIERVLYSSDEDV 295
            + S+KVTF+ER+L+  +ED 
Sbjct: 290 ERKSNKVTFVERILHCKNEDA 310

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  199 bits (505), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 118/323 (36%), Positives = 174/323 (53%), Gaps = 23/323 (7%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKT------SMEKQ 54
           MCIL+AT  HP Y+LILISNRDEF ER+TH TCWH D  IL+PYD++ +      S  + 
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 55  IFGTWSGINKEGKLATILNLKMDDQR---SCTKSKSRGMLPFTFLTS-HKARFQDWDDYN 110
            +GTW GIN+ G ++ +LNLK   +         KSRG +   FL       +  W++Y 
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120

Query: 111 KFEKHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYH 170
           KF +H+  L  T  F  FYGD+    + +IDS   + +   S   + P  Y+VISN + +
Sbjct: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSS---KQP--YVVISNSRVN 175

Query: 171 NSSSISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQM 230
                    W+KV      L+ L+  N+   +E L+  CF+LA  S     G     +  
Sbjct: 176 CED--EGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNG-----VIQ 228

Query: 231 LVDPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYS 290
           + D ++   TI+VP L+      +G S   G+YYGTR+ IV+LV  + + VT  E V++ 
Sbjct: 229 VTDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHD 287

Query: 291 SDEDVSHYSASAPKEEKRFEFEL 313
           SD+D+   SA  PK +  +EF++
Sbjct: 288 SDKDIGLSSAMNPKTKVAYEFDI 310

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  196 bits (498), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 169/321 (52%), Gaps = 23/321 (7%)

Query: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSME----KQIF 56
           MCIL AT AHP Y+L+LISNRDE+  RKTH TCW ++D IL+PYD+A    +        
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 57  GTWSGINKEGKLATILNLK---MDDQRSCTKSKSRGMLPFTFLTSHKARFQD-WDDYNKF 112
           GTW GIN+ G ++ +LNL     D     +   SRG +   +L        D W+ Y KF
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120

Query: 113 EKHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNS 172
             H+  L  T  F  FYGDV+  ++ VI+SLG T D    +       Y V+SNG    +
Sbjct: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQS------PYYVVSNGPSDGA 174

Query: 173 SSISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLV 232
            ++ +  W KV       + +I ++++  EE L+  CF LAS S       +P  +    
Sbjct: 175 KALGQ--WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSN--QPIGVH--- 227

Query: 233 DPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSD 292
           D ++   TI+VP L    G     S   G YYGTRS IV+LVS+D + VT  E V++ SD
Sbjct: 228 DDSIPKRTIFVPALYNLSG-QANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSD 285

Query: 293 EDVSHYSASAPKEEKRFEFEL 313
           +D+  YS   PKE+    F L
Sbjct: 286 QDLDSYSILNPKEQVTHRFSL 306

>TPHA0M00440 Chr13 (85489..86445) [957 bp, 318 aa] {ON} Anc_3.146
           YDL045C
          Length = 318

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 147 FDVLGSTCRRDPDSYMVISNGKYHNSSSISEQAWEKVKIARDSLETLILDNIESDEETL 205
           F  LG     DP+ Y++I N K HN S  +   WE+    ++  E L  +NIESD E +
Sbjct: 215 FTSLGKVTETDPNPYLMIENDKDHNRS--NRFNWEEEHAFQNQKE-LNKENIESDYELV 270

>KNAG0D00560 Chr4 (78466..81108) [2643 bp, 880 aa] {ON} Anc_6.306
           YNR011C
          Length = 880

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 194 ILDNIESDEETLI-----SNCFQLASKSSLPDTGLKPDLLQMLVDPNVTMNTIYVP 244
           I  N+  D++ LI      NC +L   +++ +T L  D ++ ++DP       YVP
Sbjct: 485 IYANLPQDQQALIFEPTPENCRKLVIATNIAETSLTIDGIKYVIDPGYVKENSYVP 540

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 9/69 (13%)

Query: 245 PLRRPPGDDLGASIPDGDYYGTRSQIV------LLVSKDSSKVTFIERVLYSSDEDVSHY 298
           P+ R PG  LG+ +P      TR +++      L   K+ SKV+F +++ + +DE+  H 
Sbjct: 549 PISRFPG--LGSHVPSSGVRDTRDKLMKSFYEKLEKGKNHSKVSFSDKIAFQNDEN-DHS 605

Query: 299 SASAPKEEK 307
           + S+  ++K
Sbjct: 606 ATSSDNDDK 614

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,771,531
Number of extensions: 1608989
Number of successful extensions: 4646
Number of sequences better than 10.0: 40
Number of HSP's gapped: 4721
Number of HSP's successfully gapped: 40
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)