Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.4133.485ON1037102251050.0
Skud_7.4363.485ON1036102247540.0
Smik_6.2213.485ON1036102246510.0
YGR125W3.485ON1036102246490.0
NCAS0E009503.485ON1052104333310.0
NDAI0G009903.485ON1054106233110.0
CAGL0I10626g3.485ON1070104331730.0
KNAG0B008603.485ON1088107831400.0
ZYRO0C07986g3.485ON1024105831100.0
TDEL0D055303.485ON1031104630940.0
KAFR0C019103.485ON1020103830870.0
SAKL0F02926g3.485ON1050107529810.0
Kpol_480.183.485ON1057105429510.0
TBLA0C044403.485ON115091129070.0
TPHA0D042103.485ON104998029050.0
Kwal_55.212013.485ON1011101928450.0
KLTH0F14674g3.485ON1010106528340.0
KLLA0E04731g3.485ON106082925930.0
AFR304W3.485ON1015102425070.0
TDEL0C012808.99ON7275311496e-09
SAKL0B03124g8.99ON7445791433e-08
Suva_16.3228.99ON7425561407e-08
Kwal_27.110398.99ON7265961408e-08
CAGL0L09207g8.99ON7255231353e-07
NDAI0B022108.99ON7065211344e-07
Skud_16.2868.99ON7455621344e-07
Smik_16.2418.99ON7445671335e-07
ZYRO0F04796g8.99ON7352881326e-07
NCAS0B048008.99ON7245481301e-06
TBLA0C052708.99ON7765281282e-06
SAKL0H08800gna 1ON6202821253e-06
KLTH0G16764g8.99ON7105561246e-06
YPR003C8.99ON7545571238e-06
AGR213Cna 1ON6892901202e-05
Ecym_7084na 1ON6892041192e-05
KLLA0E14059g8.99ON7062991174e-05
KNAG0D023908.99ON7163971103e-04
Kpol_467.118.99ON7442811067e-04
TPHA0H007208.99ON7871271030.002
Suva_13.258.850ON50230734.8
YML118W (NGL3)8.850ON50530734.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.413
         (1037 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1971   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1835   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1796   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1795   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  1287   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1280   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1226   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...  1214   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...  1202   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...  1196   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1193   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1152   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...  1141   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...  1124   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....  1123   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...  1100   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...  1096   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...  1003   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   970   0.0  
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    62   6e-09
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    60   3e-08
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    59   7e-08
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    59   8e-08
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    57   3e-07
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    56   4e-07
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    56   4e-07
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    56   5e-07
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    55   6e-07
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    55   1e-06
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    54   2e-06
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    53   3e-06
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    52   6e-06
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    52   8e-06
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    51   2e-05
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    50   2e-05
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    50   4e-05
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    47   3e-04
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    45   7e-04
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...    44   0.002
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...    33   4.8  
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...    33   4.9  

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1971 bits (5105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 975/1022 (95%), Positives = 975/1022 (95%)

Query: 16   EAITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPKLPFSN 75
            EAITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPKLPFSN
Sbjct: 16   EAITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPKLPFSN 75

Query: 76   KQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXXXXXXXXXXXTIEEN 135
            KQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTI                   TIEEN
Sbjct: 76   KQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSDDRKDDQSMRTIEEN 135

Query: 136  IDEEYADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGYQSVHPSHDLRFGPRS 195
            IDEEYADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGYQSVHPSHDLRFGPRS
Sbjct: 136  IDEEYADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGYQSVHPSHDLRFGPRS 195

Query: 196  VWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST 255
            VWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
Sbjct: 196  VWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST 255

Query: 256  IISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSM 315
            IISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSM
Sbjct: 256  IISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSM 315

Query: 316  LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSG 375
            LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSG
Sbjct: 316  LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSG 375

Query: 376  LFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTL 435
            LFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTL
Sbjct: 376  LFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTL 435

Query: 436  RDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAM 495
            RDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAM
Sbjct: 436  RDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAM 495

Query: 496  SLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTV 555
            SLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTV
Sbjct: 496  SLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTV 555

Query: 556  CIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFD 615
            CIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFD
Sbjct: 556  CIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFD 615

Query: 616  FVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK 675
            FVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK
Sbjct: 616  FVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK 675

Query: 676  LQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIK 735
            LQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIK
Sbjct: 676  LQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIK 735

Query: 736  RFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYXXXXX 795
            RFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQY     
Sbjct: 736  RFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYKQLRE 795

Query: 796  XXXXXXXXXXXNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQML 855
                       NNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQML
Sbjct: 796  KAKKRLEERKQNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQML 855

Query: 856  SVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQL 915
            SVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQL
Sbjct: 856  SVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQL 915

Query: 916  CPYFXXXXXXXXXXXXHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNT 975
            CPYF            HADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNT
Sbjct: 916  CPYFSRRRLASQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNT 975

Query: 976  MPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLV 1035
            MPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLV
Sbjct: 976  MPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLV 1035

Query: 1036 SA 1037
            SA
Sbjct: 1036 SA 1037

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1835 bits (4754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 890/1022 (87%), Positives = 934/1022 (91%), Gaps = 1/1022 (0%)

Query: 16   EAITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPKLPFSN 75
            EAI+VSLGIN QDSSKNK+HRAS S MSPPLCRSYMSGFFTGGSSPM  NMSD KLPFSN
Sbjct: 16   EAISVSLGIN-QDSSKNKMHRASVSAMSPPLCRSYMSGFFTGGSSPMVKNMSDSKLPFSN 74

Query: 76   KQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXXXXXXXXXXXTIEEN 135
            KQHP VIHGSENLHRQTAQLSNEFCSSSVEENSPTI                   TI EN
Sbjct: 75   KQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSDDRKDDQSMRTIVEN 134

Query: 136  IDEEYADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGYQSVHPSHDLRFGPRS 195
            IDEEY+DEYSRLLLSPASSNVDDERNRALQ  P S+LED +GGGYQS+ PSH+LRF PR+
Sbjct: 135  IDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQSLRPSHNLRFRPRN 194

Query: 196  VWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST 255
            +WQW TSFP KFA YLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
Sbjct: 195  IWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST 254

Query: 256  IISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSM 315
            IISQ+VYSGGWSSFPSG+GSEMIEITPFYHTMAL +K+AL G+DDEIITTTIFCYVISSM
Sbjct: 255  IISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDEIITTTIFCYVISSM 314

Query: 316  LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSG 375
            LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPF SG
Sbjct: 315  LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSG 374

Query: 376  LFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTL 435
            LFTNYDTLAKWLLPVLLTV+LIGTQR FKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTL
Sbjct: 375  LFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTL 434

Query: 436  RDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAM 495
            R++GWIFPIA+SDSKWYDHYKLFN+HKVHW+LVLQQIPTMMALTFFGILHVPINVPALAM
Sbjct: 435  REAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAM 494

Query: 496  SLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTV 555
            SLQMDKYDVD+ELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLL+ALT+
Sbjct: 495  SLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTI 554

Query: 556  CIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFD 615
            C+M+IGPVIISFIPICIVGSLIFLLGYELLVEALVDTW+KLNRFEYLTVVIIVFTMG+FD
Sbjct: 555  CVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFD 614

Query: 616  FVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK 675
            FVLGIIVGILIACFSFLVDSTKLQT+NGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK
Sbjct: 615  FVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK 674

Query: 676  LQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIK 735
            LQNVLFFGTIISIEEKIE+LL+ISNKD+ KRRIKYLILDFKNINADNIDYSAAEGFNRIK
Sbjct: 675  LQNVLFFGTIISIEEKIEKLLQISNKDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIK 734

Query: 736  RFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYXXXXX 795
            RFT TKRIKLIISSIKERD IYNAFNNVGLLNDVELFADLN ALEWCENEFLFQY     
Sbjct: 735  RFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRE 794

Query: 796  XXXXXXXXXXXNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQML 855
                       ++V SAIMAATQNKKID  G  L+ G NRD AR+LMSLPTNTPRN+QML
Sbjct: 795  KAKKRLEERKQSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNLMSLPTNTPRNYQML 854

Query: 856  SVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQL 915
            SVAQNVF NDEQAVKN K EYK DEP+LPILLFALKQYRPDI+SE+Q VREKEIKFWAQL
Sbjct: 855  SVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQL 914

Query: 916  CPYFXXXXXXXXXXXXHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNT 975
            CPYF            HADN+FFL+ETGMLKA YELPQG+LYEI SNGTCFGKIIAPGN 
Sbjct: 915  CPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNA 974

Query: 976  MPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLV 1035
            MPREQKLTIETETDS+LWVIDSSSLKKMKEENLALYVEVTLM+MCIKDTRFKELLGYTLV
Sbjct: 975  MPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLV 1034

Query: 1036 SA 1037
            SA
Sbjct: 1035 SA 1036

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1796 bits (4651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 874/1022 (85%), Positives = 925/1022 (90%), Gaps = 1/1022 (0%)

Query: 16   EAITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPKLPFSN 75
            EAI+VSLGIN QDSS NK+HRAS S MSPPLCRSYMSGFFTGG+SPM  +MSD KLP SN
Sbjct: 16   EAISVSLGIN-QDSSINKMHRASVSAMSPPLCRSYMSGFFTGGNSPMINSMSDSKLPLSN 74

Query: 76   KQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXXXXXXXXXXXTIEEN 135
            KQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTI                   TIEE+
Sbjct: 75   KQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSGDRKDDQSMRTIEED 134

Query: 136  IDEEYADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGYQSVHPSHDLRFGPRS 195
            IDEEY+DEYSRLLLSPASSN++D+RNR LQ   TS+LED + GGYQS+  SH+LR  PR+
Sbjct: 135  IDEEYSDEYSRLLLSPASSNINDDRNRGLQNGLTSELEDDYEGGYQSLRSSHNLRSRPRN 194

Query: 196  VWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST 255
              +  TSFPSKF  YLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
Sbjct: 195  FRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST 254

Query: 256  IISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSM 315
            IISQ+VYSGG SSFPSG+GSEMIEITPFYHTMAL +KEAL G DDEIITTTIFCYVISSM
Sbjct: 255  IISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDEIITTTIFCYVISSM 314

Query: 316  LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSG 375
            LTG VFYVLGKL+LGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPF  G
Sbjct: 315  LTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLG 374

Query: 376  LFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTL 435
            LFTNYDTLAKWLLPV+LTV+LIGTQR FKNSLVLP+FYILTLVLFHFIVAIIPTLSLDTL
Sbjct: 375  LFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTL 434

Query: 436  RDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAM 495
            R +GWIFPIA+SDSKWYDHYKLFN+HKVHW+LVLQQIPTMMALTFFGILHVPINVPALAM
Sbjct: 435  RAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAM 494

Query: 496  SLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTV 555
            SLQMDKYDVD+ELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLL+ALT+
Sbjct: 495  SLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTI 554

Query: 556  CIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFD 615
            CIM+IGPVIISFIPICIVGSLIFLLGYELLVEAL+DTW+KLNRFEYLTVVIIVFTMGIFD
Sbjct: 555  CIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFD 614

Query: 616  FVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK 675
            FVLGIIVGILIACFSFLVDSTKLQT+NGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK
Sbjct: 615  FVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK 674

Query: 676  LQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIK 735
            LQN+LFFGTI+SIEEKIE+LL+ISNKD+TKRRIKYLILDFKNINADNIDYSAAEGFNRIK
Sbjct: 675  LQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIK 734

Query: 736  RFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYXXXXX 795
            RFTETK+IKLIISSI+ERD IYNAFNNVGLLNDVELFADLN ALEWCENEFLFQY     
Sbjct: 735  RFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRI 794

Query: 796  XXXXXXXXXXXNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQML 855
                       NN+VSA+MAATQNK I+  G  LNKG N D  R+LMSLPTNTPRN+QML
Sbjct: 795  KAKERLEERKQNNIVSAVMAATQNKNINALGNGLNKGNNIDPVRNLMSLPTNTPRNYQML 854

Query: 856  SVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQL 915
            SVAQNVF NDEQAVKN KKEYK+DEPVLPILLFALKQYRPDI+SE+QKVREKEIKFWAQL
Sbjct: 855  SVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEIQKVREKEIKFWAQL 914

Query: 916  CPYFXXXXXXXXXXXXHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNT 975
            CPYF            HADNVFFL+ETGMLKA YELPQG+LYEI SNGTCFGKIIAPGN 
Sbjct: 915  CPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNA 974

Query: 976  MPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLV 1035
            MPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEV LM+MCIKDTRFKELLGYTLV
Sbjct: 975  MPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCIKDTRFKELLGYTLV 1034

Query: 1036 SA 1037
            SA
Sbjct: 1035 SA 1036

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1795 bits (4649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 883/1022 (86%), Positives = 931/1022 (91%), Gaps = 1/1022 (0%)

Query: 16   EAITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPKLPFSN 75
            EAI+VSLGIN QDSS NK+HRAS S MSPPLCRSYMSGFFTGG+SPM  N+SD KLP SN
Sbjct: 16   EAISVSLGIN-QDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSPMINNLSDSKLPISN 74

Query: 76   KQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXXXXXXXXXXXTIEEN 135
            KQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTI                   TIEEN
Sbjct: 75   KQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNGDRKDDQSMRTIEEN 134

Query: 136  IDEEYADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGYQSVHPSHDLRFGPRS 195
            IDEEY+DEYSRLLLSPASSNVDD+RNR LQ S   +LEDG+ GGYQS+ PSH+LRF PR+
Sbjct: 135  IDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAGGYQSLRPSHNLRFRPRN 194

Query: 196  VWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST 255
            +W   TSFPSKFA YLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
Sbjct: 195  LWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST 254

Query: 256  IISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSM 315
            IISQ+VYSGGWSSFPSG+GSEMIEITPFYHTMAL IKEAL G+DDEIITTTIFCYVISSM
Sbjct: 255  IISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDEIITTTIFCYVISSM 314

Query: 316  LTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSG 375
            LTGVVFY LGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPF SG
Sbjct: 315  LTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSG 374

Query: 376  LFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTL 435
            LFT+YDTLAKWLLPVLLTVVLIGTQR FKNSLVLP+FYILTLVLFHFIVAIIPTLSLD L
Sbjct: 375  LFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDAL 434

Query: 436  RDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAM 495
            R +GWIFPIA+SDSKWYDHY+LFN+HKVHW+LVLQQIPTMMALTFFGILHVPINVPALAM
Sbjct: 435  RQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAM 494

Query: 496  SLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTV 555
            SLQMDKYDVD+ELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADS FAGFLL+ALT+
Sbjct: 495  SLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTI 554

Query: 556  CIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFD 615
            CIM+IGPVIISFIPICIVGSLIFLLGYELLVEALVDTW+KLNRFEYLTVVIIVFTMGIFD
Sbjct: 555  CIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFD 614

Query: 616  FVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK 675
            FVLGIIVGILIACFSFLVDSTKLQT+NGEYNGNVA+STVYRDYVQTKFLDGIGEQIYVLK
Sbjct: 615  FVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLK 674

Query: 676  LQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIK 735
            LQN+LFFGTIISIEEKIERLL+ISNKD+TKRRIKYLILDFKNINADNIDYSAAEGFNRIK
Sbjct: 675  LQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIK 734

Query: 736  RFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYXXXXX 795
            RFTETKRIKLIISSIKERD IYNAFNNVGLLNDVELFADLN ALEWCENEFLFQY     
Sbjct: 735  RFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRK 794

Query: 796  XXXXXXXXXXXNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQML 855
                       NNVVSA++AAT+NKKID  G  LN+G N D AR+LMSLPTNTPRN+Q+L
Sbjct: 795  KAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNLMSLPTNTPRNYQIL 854

Query: 856  SVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQL 915
            SVAQNVF NDEQAVKN KKEYK+DEPVLPILLFALKQYRPDI+SEVQKVREKEIKFWAQL
Sbjct: 855  SVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEVQKVREKEIKFWAQL 914

Query: 916  CPYFXXXXXXXXXXXXHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNT 975
            CPYF            HADN+FFL+ETGMLKA YELPQG+LYEI SNGTCFGKIIAPGN 
Sbjct: 915  CPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNA 974

Query: 976  MPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLV 1035
            MPREQKLTIETETDS+LWVIDSSSL K+KE+NLALYVEV LM+MCIKDTRFKELLGYTLV
Sbjct: 975  MPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLV 1034

Query: 1036 SA 1037
            SA
Sbjct: 1035 SA 1036

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 1287 bits (3331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/1043 (64%), Positives = 786/1043 (75%), Gaps = 33/1043 (3%)

Query: 17   AITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPK-LPFS- 74
            +I+VSLG+  ++  ++          +  + RSY+SGF +   + M     D + LP + 
Sbjct: 21   SISVSLGLQQEEEPRDDYFDDENVNNNNYMGRSYVSGFLSVSPALMGSMKQDEESLPMAY 80

Query: 75   ---NKQHPKVIHGSENLHRQTAQLSNEFCSS----------SVEENSPTIXXXXXXXXXX 121
                +   + IH SE LH+QTA +S +F             ++ +               
Sbjct: 81   NGGQRLFNRPIHASEKLHKQTAAISEDFEDDEDDTRIKDYITLFQGEDNGLMADKNDSLD 140

Query: 122  XXXXXXXXXTIEENIDEEYA-----DEYSRLLLSPASSNVDDERNRALQGSPTSDLED-- 174
                       EE+  E  A     DE SRLL+SP SSN++   +  L   PT   ED  
Sbjct: 141  QRLGLGQDEEAEEDFIEPVAEAADVDESSRLLISPLSSNINPNIDDLL---PTVTGEDVS 197

Query: 175  GHGGGYQSVHPSHDLRFGPRSVWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFP 234
             +   Y++  PS  L     ++WQ    FP +F  YLPAAVLGLLLNILDALSYGMIIFP
Sbjct: 198  SYQSIYRTATPS--LSRNSETIWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFP 255

Query: 235  ITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEA 294
            ITEP+FSHLGPTG+SMFYISTIISQ++YS GWSSFPSG+GSEMIE+TPF+HTMAL IKE 
Sbjct: 256  ITEPIFSHLGPTGLSMFYISTIISQTIYSSGWSSFPSGIGSEMIEVTPFFHTMALAIKET 315

Query: 295  LVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLII 354
            L G DDEIITTTIFCYVISSMLTG+ FY LGKL LGKIVGFFPRHILIGCIGGVGYFL++
Sbjct: 316  LPGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLV 375

Query: 355  TGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYI 414
            TGIEVTTRVAKFEYS PF++ LF+++ TL KWLLPVLLTV+LI TQRCFKNSLVLP+FYI
Sbjct: 376  TGIEVTTRVAKFEYSIPFLASLFSDWATLWKWLLPVLLTVILIVTQRCFKNSLVLPSFYI 435

Query: 415  LTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPT 474
            LTL+LFHFIVAIIP+L+L+ LRDSGWIFPIA S+SKWYDHYKLF+  KVHWTLV +QIPT
Sbjct: 436  LTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPT 495

Query: 475  MMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSV 534
            M+ALTFFGILHVPINVPALAMSL +DKYDVDKELIAHG SNF SG +GS+QNYLVYTNSV
Sbjct: 496  MLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSV 555

Query: 535  LFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWS 594
            LFIRAGADS+ AG++L+ LT  +M IGPVIISFIPICIVGSLIFLLGYELLVEAL D W 
Sbjct: 556  LFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWG 615

Query: 595  KLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTV 654
            K++ FEY+T+VIIV TMGIFDFVLGIIVGILIACFSFL+DSTKLQT+NGEY+G VAKSTV
Sbjct: 616  KISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTV 675

Query: 655  YRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILD 714
            YRD +QTKFL+GIGEQIYVLKLQN+LFFGTIISIEEKI+ LLEI +KDS++ RIKYLILD
Sbjct: 676  YRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILD 735

Query: 715  FKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFAD 774
            FKNINADNIDYSAAEGFNRIKRFT+TK+I+L+ISSIKERDHIY AF+NVGLL  VELF D
Sbjct: 736  FKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFND 795

Query: 775  LNGALEWCENEFLFQYXXXXXXXXXXXXXXXXNNVVSAIMAATQNKKIDRSGIDLNKGGN 834
            LN ALEWCENEFLF+Y                 ++ ++I   +Q  +        +K  N
Sbjct: 796  LNSALEWCENEFLFKYKQLRDKAKSRLHRKQIIDINASI--GSQKYQFTAGN---DKKSN 850

Query: 835  RDQARHLMSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYR 894
             D  R+LMSLP NTPRNHQ+LSVAQNVF N+EQ VKNLK E K+  P LP+LLF LKQYR
Sbjct: 851  LDIPRNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYR 910

Query: 895  PDIVSEVQKVREKEIKFWAQLCPYFXXXXXXXXXXXXHADNVFFLIETGMLKAVYELPQG 954
            P I+S  + V+E EIKFW+QLCPYF            H +N+FF++ETG+LKA + LPQG
Sbjct: 911  PGIISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQG 970

Query: 955  SLYEIMSNGTCFGKIIAPGNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEV 1014
            ++YE MSN TC+GKI    N     + LTI  E DSILWVIDS SL KM+ EN  L+ E+
Sbjct: 971  NIYETMSNRTCYGKITGQHNESTL-KTLTIRAEIDSILWVIDSGSLIKMRAENAELFTEL 1029

Query: 1015 TLMIMCIKDTRFKELLGYTLVSA 1037
            TL+IM +KD RFKELLGYTLVSA
Sbjct: 1030 TLLIMAVKDNRFKELLGYTLVSA 1052

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1280 bits (3311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1062 (62%), Positives = 798/1062 (75%), Gaps = 60/1062 (5%)

Query: 16   EAITVSLGINYQD-------SSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSD 68
            + I+VSLG+  QD       +    +   + S  S  L RSY+SGF +  S  +N++ ++
Sbjct: 13   DTISVSLGLQNQDPQILQQPNGGPTVTLGNMSDTSNYLGRSYVSGFLSA-SPAINHDNNN 71

Query: 69   PKLPFSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXXXXXXXXX 128
              LP +N+   K IH S+NLHRQTA +S +F +    E+   +                 
Sbjct: 72   NTLPIANQHLNKSIHASQNLHRQTAAISEDFNNDPTFEDDINMKEYISNLEDDATGNNGK 131

Query: 129  XXTI-----EENID----EEY--------ADEYSRLLLSPASSN-----------VDDER 160
              T      E+ ID    EE          DE SRLLLSP  S+           + ++ 
Sbjct: 132  RYTAYYIDNEDRIDNILTEEAEPVTDFYPQDENSRLLLSPIPSDSLLAGENLLPSISEQE 191

Query: 161  NRALQGSPTSDLEDGHGGGYQSV--HPSHDLRFGPRSVWQWFTSFPSKFAQYLPAAVLGL 218
                Q   TS         YQS+    S    +     W+ + + PS+  QYLPA++LGL
Sbjct: 192  QETAQRRRTS--------AYQSIRHRNSESTEYSSIPTWRKYIATPSEIIQYLPASILGL 243

Query: 219  LLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMI 278
            LL ILDALSYGMIIFPITEP+FSHLGPTGISMFYISTIISQS++SGGWSSFP G+GSEMI
Sbjct: 244  LLTILDALSYGMIIFPITEPIFSHLGPTGISMFYISTIISQSIFSGGWSSFPCGIGSEMI 303

Query: 279  EITPFYHTMALGIKEAL-VGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFP 337
            E+TPF+HTMA  IK+AL  GS+D+IITTT+FCYVISSMLTG+ FY LGKL LGKIVGFFP
Sbjct: 304  EVTPFFHTMAFAIKDALPEGSNDDIITTTLFCYVISSMLTGLTFYSLGKLHLGKIVGFFP 363

Query: 338  RHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLI 397
            RHILIGCIGGVGYFLIITGIEV+TRVAKF+Y+ PF++ LFT+  TL +WLLP LLTV+LI
Sbjct: 364  RHILIGCIGGVGYFLIITGIEVSTRVAKFQYTIPFITHLFTDVVTLWQWLLPTLLTVILI 423

Query: 398  GTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKL 457
              Q+C +NSLVLP+FYILTL+LFHF+VAIIP+LSL+ LRDSGWIFP A++DSKWYDHYKL
Sbjct: 424  IAQKCAQNSLVLPSFYILTLILFHFMVAIIPSLSLNQLRDSGWIFPQAATDSKWYDHYKL 483

Query: 458  FNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFF 517
            FN+HKVHWTL+L+QIPTM+ALTFFGILHVPINVPALAMSLQMD+YDVDKELIAHG SNF 
Sbjct: 484  FNLHKVHWTLILKQIPTMLALTFFGILHVPINVPALAMSLQMDRYDVDKELIAHGVSNFV 543

Query: 518  SGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLI 577
            SG+ GS+QNYLVYTNSVLFIRAGADS+ AG +L+ LT+ IM+IGPVIISFIPICIVGSLI
Sbjct: 544  SGMFGSIQNYLVYTNSVLFIRAGADSALAGHILIVLTIIIMIIGPVIISFIPICIVGSLI 603

Query: 578  FLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK 637
            FLLGYELLVEALVD   K+++FEY+T+VIIVFTMGIFDFVLG+IVGILIACFSFL+DSTK
Sbjct: 604  FLLGYELLVEALVDPLGKISKFEYITIVIIVFTMGIFDFVLGVIVGILIACFSFLIDSTK 663

Query: 638  LQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLE 697
            LQT+NGE++G VAKSTVYRD +QTKFL+GIGEQIYVLKLQN+LFFGTIISIEEKI++LLE
Sbjct: 664  LQTINGEFDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDKLLE 723

Query: 698  ISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIY 757
            IS+ DS+K RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TKRI+LIISSI+ERDHIY
Sbjct: 724  ISDMDSSKHRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIRLIISSIRERDHIY 783

Query: 758  NAFNNVGLLNDVELFADLNGALEWCENEFLFQYXXXXXXXXXXXXXXXXNNVVSAIMAAT 817
            NAFNNVGLL  VELF DLN ALEWCENEFLF+Y                 N +   +A T
Sbjct: 784  NAFNNVGLLEGVELFNDLNSALEWCENEFLFKY-----KTLREKTRQKRKNKIDINLAIT 838

Query: 818  QNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYK 877
                 +   + L      +  R++MSLP NTPRN+QMLSVAQNVF N+EQA K LK+++K
Sbjct: 839  NGNPTEERNMHL------EIPRNIMSLPMNTPRNNQMLSVAQNVFRNEEQAAKALKQQFK 892

Query: 878  EDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPYFXXXXXXXXXXXXHADNVF 937
             +  VLP+LLF LKQYRP IVS  + + EKEIKFW+QLCPY             H +N F
Sbjct: 893  NEPSVLPLLLFVLKQYRPRIVSNDKSIEEKEIKFWSQLCPYLSERFLVAQSTLKHNNNFF 952

Query: 938  FLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGN--TMPREQKLTIETETDSILWVI 995
            F++E+G+LKA + LP G+LYE MSN TC+GKI+   N  T+  EQ LTI+TETD  LWVI
Sbjct: 953  FIVESGILKATFTLPSGTLYETMSNRTCYGKILGSNNETTVLNEQDLTIKTETDCNLWVI 1012

Query: 996  DSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037
            D  +L +M+ ENL LY+E+ L+IM I+DTRFKELLGYTLVSA
Sbjct: 1013 DMDALTRMRAENLELYIELVLLIMSIRDTRFKELLGYTLVSA 1054

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1226 bits (3173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/1043 (60%), Positives = 758/1043 (72%), Gaps = 42/1043 (4%)

Query: 21   SLGINYQDSSKN-KIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPKLPFSNKQHP 79
            SL +N + ++KN  I     +T    L RSY+SG   G S P     +   LP SNK   
Sbjct: 44   SLNVNARPNTKNVGIPNNDTNTF---LGRSYVSGIL-GSSLPQGGERN--TLPVSNKFGS 97

Query: 80   KVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXXXXX--------------- 124
            + IH    LHRQTA ++ EF   ++ E+  ++                            
Sbjct: 98   RAIHEQNKLHRQTAAIAEEFDDGTIGESPSSLKEYLNLLDEAQEEELDLRNRRDLDNDLI 157

Query: 125  ---XXXXXXTIEENIDEEYADEYSRLLLSPASSNVDDERNRALQG---SPTSDLEDGHGG 178
                      ++   D E  ++ +  LL+P+SSN D+  + + +    S TS+ E     
Sbjct: 158  TDNKTPVSINLKRATDPEL-EQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYE--QES 214

Query: 179  GYQSVH--PSHDLRFGPRSVW--QWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFP 234
             YQS+   PS   R  P S     W T    +   Y+PAA+LGLLLNILDALSYGMIIFP
Sbjct: 215  TYQSITVVPSAGFRQMPTSTTAKAWMTL--KRVTNYMPAAILGLLLNILDALSYGMIIFP 272

Query: 235  ITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEA 294
            ITEP+F+ LGPTGISMFYISTIISQ +YS GWSSFPSG+GSEMIEITPFYHTMAL I +A
Sbjct: 273  ITEPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQA 332

Query: 295  LVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLII 354
            L G DDEIITTTIFCYVISS++TG+ FY+LGKLRLGKIVGFFPRHILIGCIGGVGYFLII
Sbjct: 333  LPGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLII 392

Query: 355  TGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYI 414
            TG+EVTTR+AKFEYS PF++ LF +   L KWLLP +LT++LI TQ+CFKNSLVLP+FYI
Sbjct: 393  TGLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYI 452

Query: 415  LTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPT 474
            +TL+LFHF+VAI P LSL  LR +GWIFP     SKWYDHY+ F+I K HW+LV++QIPT
Sbjct: 453  ITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPT 512

Query: 475  MMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSV 534
            M+ALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGL GSVQNYLVYTNSV
Sbjct: 513  MLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSV 572

Query: 535  LFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWS 594
            LFIRAGADS+ AG++L+ LT+ +MVIGPVIISFIPICIVGSLIFLLGYELLVEA++D + 
Sbjct: 573  LFIRAGADSAIAGYVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFG 632

Query: 595  KLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTV 654
            K+  FEY T+ IIV TMGIFDFVLGI+VGILIACFSFLVDSTKLQTVNGE++G VAKSTV
Sbjct: 633  KVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTV 692

Query: 655  YRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILD 714
            YRD+ QT+FL  IGEQIYVLKLQN+LFFGTIISIEEKIERLLEIS+ D +K RIK+LILD
Sbjct: 693  YRDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILD 752

Query: 715  FKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFAD 774
            FKNINADNIDYSAAEGFNRIKR+TE KRIKLIIS+I+E D IY+ FN VGLL D+ELF D
Sbjct: 753  FKNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFND 812

Query: 775  LNGALEWCENEFLFQYXXXXXXXXXXXXXXXXNNVVSAIMAATQNKKIDRSGIDLNKGGN 834
            LN ALEWCENEFL+QY                N     I AA  N+       + N+G  
Sbjct: 813  LNSALEWCENEFLYQYKELREKARNKLQRRSKN-----INAAIGNQLRRYDQTNKNQGPT 867

Query: 835  RDQARHLMSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYR 894
                ++LMSL  NTPRN+Q++S AQ  F+N++Q    +  + K  +P+L +LLFALK YR
Sbjct: 868  SSLMQNLMSLSNNTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPLLKVLLFALKLYR 927

Query: 895  PDIVSEVQKVREKEIKFWAQLCPYFXXXXXXXXXXXXHADNVFFLIETGMLKAVYELPQG 954
            P+IVS   + R  E++FW QLCPYF            H +N FFL++ G+LK +Y LP G
Sbjct: 928  PNIVSMDTEKRTDEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPAG 987

Query: 955  SLYEIMSNGTCFGKIIAPGNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEV 1014
            S+YE +SNGTC+GKI++  +     Q L ++ ETD+ILW+ID  S++ MK +N+ LY E+
Sbjct: 988  SVYETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTEL 1047

Query: 1015 TLMIMCIKDTRFKELLGYTLVSA 1037
             L+I+ I+DTRFKELLGYTLVSA
Sbjct: 1048 VLLILAIRDTRFKELLGYTLVSA 1070

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score = 1214 bits (3140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/1078 (59%), Positives = 779/1078 (72%), Gaps = 64/1078 (5%)

Query: 16   EAITVSLGINYQDS--SKNKIHRASASTMSPPLCRSYMSGFF--TGGSSPMNYNMSDPKL 71
            E+I+VSLG+   D+  S N+         S  L RSY+SG +  T  ++   Y++    L
Sbjct: 19   ESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLWSPTQRNNKSGYDL----L 74

Query: 72   PFSNKQ-HPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXXXXXXXXX-- 128
            P SN+Q + K IH S+ LHRQT  +   F  S+ +E S                      
Sbjct: 75   PTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDLVEHNERKTANI 134

Query: 129  -------------XXTIEEN--------IDEEYA--DEYSRLLLSPASS----------- 154
                           T+  N        + +EY   DE SRLLL+P SS           
Sbjct: 135  DNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTPVSSLSVAISDASSL 194

Query: 155  NVDDERNRALQGSPTSDLEDGHGGGYQ--SVHPSHDLRFGP--RSVWQWFTSFPSKFAQY 210
              +D   RA   SP + +   +G      S + S  ++ GP   S W + ++       Y
Sbjct: 195  TPEDYNGRA--RSPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKWDYISALSHDIVHY 252

Query: 211  LPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFP 270
            LPA++LGLLLNILDALSYGMIIFPITEP+FS LGP+G+SMFYIST+ISQ  YS GWSSFP
Sbjct: 253  LPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGLSMFYISTVISQFTYSSGWSSFP 312

Query: 271  SGVGSEMIEITPFYHTMALGIKEALVGSD--DEIITTTIFCYVISSMLTGVVFYVLGKLR 328
             G+GSEMIE+TPF+HTMAL I + L G +  +EIITTTIFCYVISSM TG+ F+ LGKL+
Sbjct: 313  CGIGSEMIEVTPFFHTMALTIMKTL-GEERKNEIITTTIFCYVISSMFTGLTFFTLGKLK 371

Query: 329  LGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLL 388
            LGK+VGFFPRHILIGCIGGVGYFL+ITGIEV TR+AKFEYS PF+  LFT+  TL +WLL
Sbjct: 372  LGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLFTDEKTLFQWLL 431

Query: 389  PVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSD 448
            P +LT++LI TQ  F+NSLVLP+FYILTL+LFHFIVAI+P LSL  LR+SGWIFP+A+S+
Sbjct: 432  PTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNSGWIFPVAASN 491

Query: 449  SKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKEL 508
              WYDHYK FN   VHW LV++QIPTMMALTFFGILHVPINVPALAMSLQMDKYDVD+EL
Sbjct: 492  VTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDREL 551

Query: 509  IAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFI 568
            IAHGYSNFFSGL GS++NYLVYTNSVLFIRAGADS+ AG++L+ LT+ +M+IGPVIISFI
Sbjct: 552  IAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYILIVLTIIVMLIGPVIISFI 611

Query: 569  PICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIAC 628
            PICIVGSLIFLLGYELL+EALVDTW KLN FEY+TV II+ TMGIFDFVLGIIVGILIAC
Sbjct: 612  PICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIVGILIAC 671

Query: 629  FSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISI 688
            F FL+DST LQTVNGE++G VAKSTVYRD +QT FLDG+GEQIYVLKLQN+LFFGTIISI
Sbjct: 672  FKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQNLLFFGTIISI 731

Query: 689  EEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIIS 748
            EEKI++LLEISN DS+KRRIKYLILDFKNIN DNIDYSAAEGFNRI+RFT+TK I+LIIS
Sbjct: 732  EEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRFTQTKGIQLIIS 791

Query: 749  SIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYXXXXXXXXXXXXXX--XX 806
            SI+E+D IY AFNNVGLL DVELF DLN +LEWCENE L  Y                  
Sbjct: 792  SIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKARLRKLNNTA 851

Query: 807  NNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQMLSVAQNVFANDE 866
            N+VVS  +  + +K++D   I       R    +LMSLPTNTPRNHQML+VAQ+VF NDE
Sbjct: 852  NSVVSR-LPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQMLTVAQDVFKNDE 910

Query: 867  QAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPYFXXXXXXX 926
            Q V +L+K+ K  +P+LP+LL  LKQYRPDI S  +  R+KEI  W++LCPYF       
Sbjct: 911  QTVSSLRKQLKTKDPLLPLLLLTLKQYRPDIGSNDKLARDKEIAIWSRLCPYFAKKTMMA 970

Query: 927  XXXXXHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNTM-------PRE 979
                 H + +FFL++TG+LKAV++LPQG +YE M+N TC+GKII  G T+       P  
Sbjct: 971  QTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTVDDADTSNPDF 1030

Query: 980  QKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037
             KL I TETDS LWVID++++ +++ E+  L++++ L++M IKD RFK+LLG+ L+SA
Sbjct: 1031 SKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDLLGHALISA 1088

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score = 1202 bits (3110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1058 (59%), Positives = 749/1058 (70%), Gaps = 88/1058 (8%)

Query: 17   AITVSLGINYQDSSK------------------NKIHRASASTMSPPL-------CRSYM 51
            AI+VSLG+N Q                      N+   +S   +SPP         RSY+
Sbjct: 18   AISVSLGLNRQVHRNSDGEFTNYNNTNNNGGRINQNDSSSIEIVSPPFYNSNNYAGRSYL 77

Query: 52   SGFFTGGSSPMNY---NMSDPKLPFSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENS 108
             G F   S  MN    N     LP  ++   K IHGS+ +HRQTA+LSN F   +     
Sbjct: 78   GGGFLSASPKMNLQQRNDDSSVLPI-DRSRSKSIHGSQIIHRQTAELSNNFSDDTTGM-- 134

Query: 109  PTIXXXXXXXXXXXXXXXXXXXTIEENIDEEYADEYSRLLLSPASSNVDDERNRALQGSP 168
                                         EE  + Y  +          ++ N +L    
Sbjct: 135  -----------------------------EEVRNRYDAM----------EDENSSLHHYM 155

Query: 169  TSDLEDGHGGGYQSVHPSHDLRFGPRSVWQWFTSFPSKFAQYLPAAVLGLLLNILDALSY 228
            T        GG      +++     R+       F      Y P+AVLGLLLNILD LSY
Sbjct: 156  THQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQDVLHYFPSAVLGLLLNILDGLSY 215

Query: 229  GMIIFPITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMA 288
            GMIIFPITEP+FSHLG TG+SMFYISTIISQ +YSGG SSF SG+GSEMIE+TPF+HTMA
Sbjct: 216  GMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIGSEMIEVTPFFHTMA 275

Query: 289  LGIKEALVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGV 348
              I++A+ G DD+IITTTIFCY ISS++TG+ FY+LGKLRLGKIVGFFPRHILIGCIGGV
Sbjct: 276  FAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGV 335

Query: 349  GYFLIITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLV 408
            GYFL+ITG+ VTTR+AK EY+W F+  LF + D L KWLLPV+LT++L+ TQ+CF+NSLV
Sbjct: 336  GYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTILLVNTQKCFQNSLV 395

Query: 409  LPTFYILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLV 468
            LP+FYI+TL+LFHF+VAI+P++SLD LRD GWIFP A+S  +W+DHYKLF+ HKVHW LV
Sbjct: 396  LPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLV 455

Query: 469  LQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYL 528
            L QIPTM+ALTFFGILHVPINVPALA+SL MDK+DVDKELIAHGYSNF SG++GS+QNYL
Sbjct: 456  LAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYL 515

Query: 529  VYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEA 588
            VYTNSVLFIRAGADS FAG++L  LT  +MVIGPVI+SFIPICIVGSLIFLLGYELLVEA
Sbjct: 516  VYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSLIFLLGYELLVEA 575

Query: 589  LVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGN 648
            L+DT  K+  FEY+T+VIIV TMGI+DFVLG+IVGILIACFSFLVDSTKLQT+NGE++G 
Sbjct: 576  LLDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGK 635

Query: 649  VAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEISN-KDSTKRR 707
            VA+STV RDYVQ+ FL+G+GEQIYVLKLQNVLFFGTIISIEEKI++LLEI++ K S+KRR
Sbjct: 636  VARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRR 695

Query: 708  IKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLN 767
            IKYLILDFKNINADNIDYSAAEGFNRIKRFT+TKRIKLIISSIKERDHIYN F+NVGLL+
Sbjct: 696  IKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLD 755

Query: 768  DVELFADLNGALEWCENEFLFQYXXXXXXXXXXXXXXXXNNVVSAIMAA------TQNKK 821
            DVELF DLNGALEWCENEFL +Y                 NV SAI AA      T N +
Sbjct: 756  DVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSY--NVTSAIEAAAAKKVPTDNNQ 813

Query: 822  IDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKED-- 879
            I +  + L         R+L SLP NTPRNHQMLSVAQN+F NDE+ V  L+ E   D  
Sbjct: 814  ISKKNLSLL------NFRNLSSLPMNTPRNHQMLSVAQNMF-NDEEDVDALEDESCNDGQ 866

Query: 880  EPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPYFXXXXXXXXXXXXHADNVFFL 939
            +PVLP+LLFALK YR +I S    +RE+E + W+QL PYF            H  + FF+
Sbjct: 867  QPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHNQDFFFV 926

Query: 940  IETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNTMPREQKLTIETETDSILWVIDSSS 999
            +E+G+LK   +LPQG +YE MSN TC G I+        E K+TI TETD+ LW+ID   
Sbjct: 927  VESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCLWLIDVDG 986

Query: 1000 LKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037
            L+K++ ENL LY E+ L+ + IK  RF++LLGYTLVSA
Sbjct: 987  LQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score = 1196 bits (3094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/1046 (60%), Positives = 777/1046 (74%), Gaps = 58/1046 (5%)

Query: 16   EAITVSLGINYQDSSKNKIHRASAST---------MSPP---LCRSYMSGFFTGGSSPMN 63
            EAI+VSLG+   ++ ++  H  + S          MSP    L RSY+SGF +   SP  
Sbjct: 20   EAISVSLGLQNTNTPRDH-HDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFLS--CSPYG 76

Query: 64   YN-MSDPKLPFSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXXX 122
             N +   +LP + +   K IH ++NLHRQTA+L  +F   +VE+N+              
Sbjct: 77   SNSLESDRLPIA-RMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNN-----IQDYVSATE 130

Query: 123  XXXXXXXXTIEENIDEEYADEYSRLLLSPASSNVDDERNRALQGSPTSDLED-------G 175
                      E   D+E  DE    L +P   N +D  +         D+ED       G
Sbjct: 131  EPRPMEISDAERMYDQE--DE----LRNPVHVNTEDRGD---------DIEDVYESLVTG 175

Query: 176  HGGGYQSV--HPSHDLRFGPRS-VWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMII 232
              GGY+++   P   LR   RS +W+ F S  SK   YLPA +LGLLLN+LD LSYGMII
Sbjct: 176  AHGGYRAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATILGLLLNVLDGLSYGMII 235

Query: 233  FPITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIK 292
            FPITEP+FSHLGP+G+SMFY+STIISQ +YS G+S+FP+GVGSEMIE+TPF+H+MAL IK
Sbjct: 236  FPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIK 295

Query: 293  EALVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFL 352
            +AL G DDEI+TTTIFCYVISS++TG+ FYVLGK++LGKIVGFFPRHILIGCIGGVGYFL
Sbjct: 296  DALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFL 355

Query: 353  IITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTF 412
            ++TG+EVTTRVAK EY+WPF+S +FT+  TL KW+LPVLLTV+LI TQR F+NSLVLPTF
Sbjct: 356  VVTGLEVTTRVAKLEYTWPFISHMFTDVSTLVKWVLPVLLTVLLIVTQRHFQNSLVLPTF 415

Query: 413  YILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQI 472
            YI TLV FHF+VAIIP +SL  LR+ GWIFP+A+S  +WYDHYKLF  H+VHW L+ +Q 
Sbjct: 416  YIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQA 475

Query: 473  PTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTN 532
            PTM+AL+FFGILHVPINVPALA+SLQMDKYDVDKELIAHGYSN  SG LGS+QNYLVYTN
Sbjct: 476  PTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTN 535

Query: 533  SVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDT 592
            S+LFIRAGADS+ AG+LL  LT  +MVIGPVIIS+IPICIVGSLIFLLGYELL EAL++T
Sbjct: 536  SLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIET 595

Query: 593  WSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKS 652
              K+  FEY+T+ IIV TMGIFDFVLG+IVGILIACFSFLVDSTKLQT+NGEY+G +AKS
Sbjct: 596  RGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKS 655

Query: 653  TVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEIS-NKDSTKRRIKYL 711
            TVYRDYVQ++FLDGIGEQIYVLKLQ++LFFGTIISIEEKI +LLEIS ++ ++KRRIK L
Sbjct: 656  TVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCL 715

Query: 712  ILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVEL 771
            ILD KNINADNIDYSAAEGFNRIKRFT++K I+LIISSI E DHIY AF+ V LL+DVEL
Sbjct: 716  ILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVEL 775

Query: 772  FADLNGALEWCENEFLFQYXXXXXXXXXXXXXXXXNNVVSAIMAATQNKKIDRSGIDLNK 831
            F DLNGALEWCENE LF+Y                N +  A +AA  + K       ++ 
Sbjct: 776  FGDLNGALEWCENELLFKY----KELRAKARDRLQNKMQMANLAANNDTKA------IDG 825

Query: 832  GGNRDQARHLMSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALK 891
                   ++LMSLP NTPRN QMLSVAQ VF N+++ V +LK  YKE  PVLP+LLFALK
Sbjct: 826  VPKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKELPPVLPLLLFALK 885

Query: 892  QYRPDIVSEVQKVREKEIKFWAQLCPYFXXXXXXXXXXXXHADNVFFLIETGMLKAVYEL 951
             YRP I+SE   V+  E++ W++LCPYF            H  ++FF++ETG+LK VY+L
Sbjct: 886  PYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDL 945

Query: 952  PQGSLYEIMSNGTCFGKIIAPGNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALY 1011
            PQG +YE +SN TC+G ++ PG     E K+TI+TET+ +LWVIDSS L ++K+ENL+LY
Sbjct: 946  PQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLY 1005

Query: 1012 VEVTLMIMCIKDTRFKELLGYTLVSA 1037
             E+ L+I  +K+ R++++LGYTLVSA
Sbjct: 1006 TELILLIATVKEQRYRQILGYTLVSA 1031

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1193 bits (3087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1038 (60%), Positives = 754/1038 (72%), Gaps = 53/1038 (5%)

Query: 16   EAITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPKLPFSN 75
            ++I+ SLG+  Q+S+        +++ S  L RSYM G     ++P+   +    LP SN
Sbjct: 20   DSISRSLGLQDQESNIAGTDNELSNSKSNYLSRSYMYGLLPS-ATPVE-ELETNTLPLSN 77

Query: 76   KQHPKVIHGSENLHRQTAQLSNEFCSS---SVEENSPTIXXXXXXXXXXXXXXXXXXXTI 132
                K IH S  LH+QTA +  +F  S   S+++    I                    +
Sbjct: 78   DLRNKSIHQSRILHKQTAAICEDFNESDEGSMKDYLDFIENTDRDNINEHKESLPVTVVL 137

Query: 133  EENIDE-EYADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGYQSVHPSHDLRF 191
                DE E  DE SRLLL+P+SSN +            S + +G    Y S+  + D   
Sbjct: 138  STPADEVEEQDESSRLLLTPSSSNAE-----------VSSIAEGLRHHYSSIESTKDNNM 186

Query: 192  -----GPRSVWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPT 246
                    ++ +  ++F     QY PA+VLGLLLNILDALSYGMIIFPI+EP+FSHLGPT
Sbjct: 187  PIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPT 246

Query: 247  GISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSD--DEIIT 304
            G+SMFYISTII Q +YS GWSSFPS +GSEMIEITPF+HTMA  I  +L G +  D IIT
Sbjct: 247  GMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIIT 306

Query: 305  TTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVA 364
            TTIFCYVISSM TG+ F  LGKLRLGKIVGFFPRHILIGCIGGVGYFL+ITGIEVTTR+A
Sbjct: 307  TTIFCYVISSMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIA 366

Query: 365  KFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIV 424
            KFEYS P +  LFT+   L KWL P LLTVVLI TQ+CFK SLVLP+FYI TL+LFHFIV
Sbjct: 367  KFEYSLPLIKELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPSFYIATLILFHFIV 426

Query: 425  AIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGIL 484
            AIIP LSL  LR++GWIF   + +S WYDHYKLF+ HKVHW LV +QIPTM+ALTFFGIL
Sbjct: 427  AIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGIL 486

Query: 485  HVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSS 544
            HVPINVPALAMS+QMDKYDVDKELIAHG SN  SG+ GS+QNYLVYTNSVLFIRAGADS 
Sbjct: 487  HVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSP 546

Query: 545  FAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTV 604
            FAG+LL+ LT+ +M+IGPVIISFIPICIVGSLIFLLGYELLVEAL+DTW KL  FEY+TV
Sbjct: 547  FAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWDKLTTFEYVTV 606

Query: 605  VIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFL 664
            V+IV TMGI DFVLGIIVGILIACF FL+DS+KLQT+NGE++G VAKSTV RD +Q+KFL
Sbjct: 607  VVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFL 666

Query: 665  DGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNID 724
            +GIG+QIYVLKLQN+LFFGTIISIEEKI++LLE+S+++S+KR+IKYLILDF+NINADNID
Sbjct: 667  NGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNID 726

Query: 725  YSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCEN 784
            YSAAEGFNRIKR TE+K I+LIISSIK RD IYN+FN VGLL  VELF DLNGALEWCEN
Sbjct: 727  YSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCEN 786

Query: 785  EFLFQYXXXXXXXXXXXXXXXXNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSL 844
            EFL+QY                 NV +A  ++  N         L+K          M+L
Sbjct: 787  EFLYQY-------KMIRERIKIKNVKTATHSSDGN---------LSKPSA-------MTL 823

Query: 845  PTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKV 904
              NTPRN+Q+ SVAQN+F N+EQ V  LK  +++  PVLP+LLFALKQYRPDIVS V KV
Sbjct: 824  SINTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVS-VDKV 882

Query: 905  RE-KEIKFWAQLCPYFXXXXXXXXXXXXHADNVFFLIETGMLKAVYELPQGSLYEIMSNG 963
            ++ KEI+FW+QL PYF            H +N+FFL+E G+LK  ++LPQG +YE MS  
Sbjct: 883  KKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKR 942

Query: 964  TCFGKIIAP----GNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIM 1019
             C+GKI+          P  Q + I+TE D+++W+IDSS+LKKMK+EN+ LY+E+ L++M
Sbjct: 943  ACYGKIMGKIPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVM 1002

Query: 1020 CIKDTRFKELLGYTLVSA 1037
             IKD RFK LLG+ LVS 
Sbjct: 1003 TIKDIRFKSLLGHALVST 1020

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1152 bits (2981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/1075 (57%), Positives = 765/1075 (71%), Gaps = 89/1075 (8%)

Query: 16   EAITVSLGINYQDSSKNKIHRASASTMSPP------LCRSYMSGFFTGGSSPMNYNMSDP 69
            EAIT+SLG+ + D+ K        S+M+P       L RSY+ G F+  S     + +D 
Sbjct: 12   EAITISLGL-HSDNIKQPSQANRRSSMNPENSSNYYLGRSYV-GSFSSPSFLQRESSADT 69

Query: 70   KLPFS-NKQHPKVIHGSENLHRQTAQLSNEF------------CSSSVE------ENSPT 110
                S +K   K IH S  LHRQTA LSN F             ++S E      +   +
Sbjct: 70   GHILSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDEIDVAASQEFQNEALQRELS 129

Query: 111  IXXXXXXXXXXXXXXXXXXXTIEENIDEEYA--DEYSRLL------------------LS 150
            +                     E+ I +E    +E +RLL                  LS
Sbjct: 130  LENGSYSNSNNNNNNNNQIAYSEDAITQENNGLNECTRLLSPTSAAATDLEYGTSPTNLS 189

Query: 151  PASSNVDDERNRAL--QGSPTSDLED-GHGGGYQSVHPSHDLRFGP--RSVWQWFTSFPS 205
            P SS  + E+  +L    SP+S + D   G G  + +  H LR  P  RS + +   +  
Sbjct: 190  PPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLR-QPVVRSYYDYAKGWSI 248

Query: 206  KFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQSVYSGG 265
            K   Y+PA +LGLLLN+LDALSYGMIIFPITEPVFSHLGPTG+SMFY+STI+SQ VYS G
Sbjct: 249  KTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQLVYSCG 308

Query: 266  WSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSMLTGVVFYVLG 325
            +S+F +G+GSEMIEITPF+HTMAL I  +L G DDEII+TTI CY +SS+ TG+ F++LG
Sbjct: 309  FSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLAFFLLG 368

Query: 326  KLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAK 385
            KLRLGKIVGFFPRHILIGC+GGVGYFL+ITGIEV TRV+KFEYSWPF+  LF N + L K
Sbjct: 369  KLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNTEVLGK 428

Query: 386  WLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIA 445
            W+LP++LT+ LI TQ  F NSLVLP+FYI+TL LFHF+VAI+P LSL++LR+SGWIFP+A
Sbjct: 429  WMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGWIFPMA 488

Query: 446  SSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVD 505
             S + WYD YKL++   VHWTLVL+Q+PTM+ALTFFGILHVPINVPALAMS+ MDK+DVD
Sbjct: 489  GSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMDKFDVD 548

Query: 506  KELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVII 565
            KELIAHGYSN  SG  GS+QNYLVYTNS LFIRAG+DSS+AGFLL   T  +M+IGPVII
Sbjct: 549  KELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMIIGPVII 608

Query: 566  SFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGIL 625
            SFIPICIVGSLIFLLGYEL+ EAL DTW KLNRFEY+T+VIIVFTMG+FDFVLGIIVGIL
Sbjct: 609  SFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGIIVGIL 668

Query: 626  IACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTI 685
            IACFSFLVDSTKLQT+NGE+NG VA+STVYRDY+QTKFL+ +GEQI+VLKLQN+LFFGTI
Sbjct: 669  IACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLLFFGTI 728

Query: 686  ISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKL 745
            ISIEEKI+ LLEIS+KDS+++RIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRI+L
Sbjct: 729  ISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIQL 788

Query: 746  IISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYXXXXXXXXXXXXXXX 805
            IISSI E+D IYNAFN VGLL DVELFADLN ALEWCENEFL QY               
Sbjct: 789  IISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQY--------------- 833

Query: 806  XNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMS--LPTNTPRNHQMLSVAQNVFA 863
                          K+I R+         + Q +HL    LP NTPRN+Q+++VAQ +F 
Sbjct: 834  --------------KQI-RTRTKAKLQAQKKQEKHLSKSLLPINTPRNNQIVTVAQKIFP 878

Query: 864  NDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPYFXXXX 923
             DEQ V +L+ +Y++ EPVLP+LL ALK++RP I+S  + V++ E  FW++LCPYF    
Sbjct: 879  -DEQNVTHLRTQYQKREPVLPLLLVALKKFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKR 937

Query: 924  XXXXXXXXHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNT-MPREQKL 982
                    H +N+FFL+E+GMLK  Y+L QG  YE MS+ TC+G+I   GN        +
Sbjct: 938  FAPGSLLLHNNNLFFLVESGMLKITYDLHQGQFYETMSSKTCYGRI--SGNAEFTTNLYV 995

Query: 983  TIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037
             I+TETD  +W+ID+++L  +KE+NLALY E+ L++M I   R KELLGY+LVS+
Sbjct: 996  NIKTETDCAVWIIDATNLANLKEKNLALYAELLLVVMSINQYRSKELLGYSLVSS 1050

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score = 1141 bits (2951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/1054 (57%), Positives = 756/1054 (71%), Gaps = 51/1054 (4%)

Query: 16   EAITVSLGINYQD------------SSKNKIHRASASTMS----PPLCRSYMSGFFTGGS 59
            EA++VSLG++ Q             +S +  +  + S++S      + RSY     +   
Sbjct: 23   EALSVSLGLHEQGIGAGRTRSNLAPNSYSGYNDNTTSSVSNREFGRIGRSYAGSISSNSP 82

Query: 60   SP-MNYNMSDPKLPFSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXX 118
            S  +N + +D  LP   K   K I G + LHRQTA++SN+F  +S++E            
Sbjct: 83   SLYLNTSRTDELLPI-RKMPSKSILGPDALHRQTAEISNDFNDTSMDEAKIKRYIELLNR 141

Query: 119  XXXXXXXXXXXXTIEENIDEEYADEYSRLLLSP---ASSNVDDERNRALQGSPTS----- 170
                         +       +     +  LSP   ++S +D    RAL    +S     
Sbjct: 142  KQIEAEEEGEESAVHL---RPHTFIEGKSFLSPIGSSASQLDGLEQRALLTPSSSIVGNE 198

Query: 171  -DLE---DGHGGGYQSVHPSHDLRFGPRSVWQWFTSFPSK---FAQYLPAAVLGLLLNIL 223
             DLE   D     Y S+     LR   R +    +SF +K      YLPAA+LGLLLNIL
Sbjct: 199  FDLESTYDEINNDYNSI-----LRIQSRELTS--SSFATKGLELLNYLPAAILGLLLNIL 251

Query: 224  DALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPF 283
            DALSYGMIIFPITEP+FS LGPTGISMFYISTI+ Q V SGG+SSFP G+GSEMIEITPF
Sbjct: 252  DALSYGMIIFPITEPLFSGLGPTGISMFYISTIVCQLVLSGGFSSFPCGIGSEMIEITPF 311

Query: 284  YHTMALGIKEALVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIG 343
            YHTMA  IK+AL   D+E+ITTTIFCYVISS++TG+VF++LGKL++GKIVGFFPRHILIG
Sbjct: 312  YHTMAFAIKDALPNQDNEVITTTIFCYVISSVVTGLVFFMLGKLKMGKIVGFFPRHILIG 371

Query: 344  CIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCF 403
            CIGGVGYFLIITGIEV+TR+ KFEY+W F+  L TN DTL KWLLP LLT+ LI  QR  
Sbjct: 372  CIGGVGYFLIITGIEVSTRIGKFEYNWEFLLSLLTNLDTLGKWLLPTLLTLSLILIQRQV 431

Query: 404  KNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKV 463
            +NSLVLP+FYILT++LFHFIVAI+P LSLD LR++GWIFP+  S + WYDHYK FN+H +
Sbjct: 432  QNSLVLPSFYILTIILFHFIVAILPNLSLDHLRENGWIFPVTDSKNSWYDHYKYFNLHDI 491

Query: 464  HWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGS 523
            HW LVL+QIPTM+ALTFFGILHVPINVPALAMSL MDKYDVD+ELIAHGYSN  SGLLGS
Sbjct: 492  HWGLVLKQIPTMLALTFFGILHVPINVPALAMSLHMDKYDVDRELIAHGYSNLISGLLGS 551

Query: 524  VQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYE 583
            VQNYLVYTNSVLFIRAGADSS AGFLLVALTV +MV G VI+SFIP+CIVGSLIFLLGYE
Sbjct: 552  VQNYLVYTNSVLFIRAGADSSSAGFLLVALTVVVMVAGSVIVSFIPVCIVGSLIFLLGYE 611

Query: 584  LLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNG 643
            L+VEALVDT   +  FEY+T++IIVF MGI+DFVLGIIVGILIAC SF+VD TKL+T+NG
Sbjct: 612  LMVEALVDTIGTVTSFEYITILIIVFIMGIYDFVLGIIVGILIACLSFMVDGTKLETING 671

Query: 644  EYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEISNKDS 703
            EY+G VAKSTVYRDY+QTKFL+GI +QIY+LKLQNVLFFGTIISIEEKI++LLEIS+KD 
Sbjct: 672  EYDGQVAKSTVYRDYIQTKFLNGIRQQIYLLKLQNVLFFGTIISIEEKIDKLLEISDKDP 731

Query: 704  TKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNV 763
            +KRRIKYLILDFKNINADNIDYSAAEGFNRIKRFT+ KRI+LIISSIKE+D IY+ FN V
Sbjct: 732  SKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQGKRIQLIISSIKEKDKIYSVFNMV 791

Query: 764  GLLNDVELFADLNGALEWCENEFLFQYXXXXXXXXXXXXXXXXNNVVSAIMAATQNKKID 823
             LL DVELF DLN ALEWCENEFL+QY                 +  S     ++N+   
Sbjct: 792  RLLEDVELFDDLNSALEWCENEFLYQYMQLHEKAKDRIHKRISISKDSGSTYFSRNRS-- 849

Query: 824  RSGIDLNKGGNRDQARHLMSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVL 883
                  + G +    + LMSLP NTPRN+Q+LSVA+ VF N+ Q     K   + D+PVL
Sbjct: 850  ------DSGLSAADQQMLMSLPINTPRNNQVLSVARKVFKNEAQTASKFKTHNETDKPVL 903

Query: 884  PILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPYFXXXXXXXXXXXXHADNVFFLIETG 943
             +LL++++ +RPD+ SE   +REKEI FW QL PYF            ++ N FF++E+G
Sbjct: 904  SLLLYSIRLFRPDVFSEDVSIREKEINFWGQLSPYFRRSLFPTGSTLVNSSNFFFVVESG 963

Query: 944  MLKAVYELPQGSLYEIMSNGTCFGKIIAPGNTMPREQKLTIETETDSILWVIDSSSLKKM 1003
            +++  ++LPQG + E MSN TC+GK++    T+    K+  +TET+SI+W+ID  ++ ++
Sbjct: 964  VVRVTHDLPQGIVSETMSNRTCYGKVVGHRGTVTNLPKIIFKTETESIIWMIDDDTMSRI 1023

Query: 1004 KEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037
            K+ENL LY E+ L++M I++ R+K L+GYTLVSA
Sbjct: 1024 KKENLNLYTELLLLVMTIREYRYKGLIGYTLVSA 1057

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score = 1124 bits (2907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/911 (61%), Positives = 685/911 (75%), Gaps = 19/911 (2%)

Query: 134  ENIDEEY--ADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGY--QSVHPSHDL 189
            + +DE+    DEYSRLL +P+ S  DDE       S   D  D     Y   S+  + D+
Sbjct: 252  QELDEDIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYISSSIPTTTDV 311

Query: 190  -RFGPRSVWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGI 248
             +    S     T    +    +PA +LGLLLNILDALSYGMI+FPIT+ VF HLGPTG+
Sbjct: 312  TQSTSLSFKDMLTKHSLQILHDIPACILGLLLNILDALSYGMILFPITDSVFGHLGPTGL 371

Query: 249  SMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSD-DEIITTTI 307
            SMFYISTIISQ VYSGG+S+FPSG+G EMIEI PF+HTMAL +K ++   D +EIITTTI
Sbjct: 372  SMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTTI 431

Query: 308  FCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFE 367
            FCYVIS + TG+VF+ LGK +LGK+VGFFPRHILIGCIGGVGYFLI+TGIEVTTRV K E
Sbjct: 432  FCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLE 491

Query: 368  YSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAII 427
            YS  F+  + TN  TL K +LP+ L+V+L   Q+ + +SL+LP+FYI+T + FHFIVA++
Sbjct: 492  YSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALV 551

Query: 428  PTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVP 487
            P LSLD+LR +GWIFP+A S   WY HYK FN    HW LV +QIPTM ALTFFGILHVP
Sbjct: 552  PNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVP 611

Query: 488  INVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAG 547
            INVPALAMS+QMDKYDVDKELIAHGYSN  SGL GSVQNYLVYTNSVLFIRAG +++ AG
Sbjct: 612  INVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAG 671

Query: 548  FLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVII 607
             +L   T  I+ IGPVIISFIP+CIVGSLIFLLG+EL+VEAL+DTW K+ +FEY+T++II
Sbjct: 672  LVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMII 731

Query: 608  VFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGI 667
            VFTMGI+DFVLGI+VGILIACFSFLVDSTKLQTVNGE+NG VAKSTVYRDYVQ++FL GI
Sbjct: 732  VFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGI 791

Query: 668  GEQIYVLKLQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSA 727
             EQIYVLKLQNVLFFGTIISIEEKI+ LLEIS+ DS+KRRIKYLILD KN+N+DNIDYSA
Sbjct: 792  AEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNSDNIDYSA 851

Query: 728  AEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFL 787
            AEGFNRIKRFT++KRI+LIISSIK+ D IY  FNNV LL +VELF+DLNGALEWCENEFL
Sbjct: 852  AEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDLNGALEWCENEFL 911

Query: 788  FQYXXXXXXXXXXXXXXXXNNVVSAIMAATQNKKIDRSG-IDLNKGGNRDQARHLMSLPT 846
            +QY                N   +       ++ + R+G +  +     +  +   +LP 
Sbjct: 912  YQY------------RQVKNKARARAKRKATSRDVVRTGYLSTSVSNTLNDRKSSGNLPI 959

Query: 847  NTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVRE 906
            NTPRNHQM+SVA+N+F N EQ V++      +  PVL +L+FALKQYR DI S+  KVR+
Sbjct: 960  NTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRD 1019

Query: 907  KEIKFWAQLCPYFXXXXXXXXXXXXHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCF 966
            KE++FW+QLCPYF            H +NVFF++E+G+LK  + LPQGS+YE MSN TC+
Sbjct: 1020 KEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCY 1079

Query: 967  GKIIAPGNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRF 1026
            G+I+  G        L I+ ETD I+W+I+S  L KMK ENL LY E+TL++M +KD RF
Sbjct: 1080 GRILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLLVMSVKDDRF 1139

Query: 1027 KELLGYTLVSA 1037
              LLGY L+SA
Sbjct: 1140 NNLLGYALISA 1150

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (54%), Gaps = 11/62 (17%)

Query: 49  SYMSGFFTGGSSPMNYNMSDPKLPFSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENS 108
           S  + +FT G      N ++  LP  N      IHGS+NLH++TA++SNEF       NS
Sbjct: 105 SNSNNYFTHG-----LNSNNDHLPVINPFPKSSIHGSDNLHKRTAEISNEF------NNS 153

Query: 109 PT 110
           PT
Sbjct: 154 PT 155

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score = 1123 bits (2905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/980 (58%), Positives = 718/980 (73%), Gaps = 25/980 (2%)

Query: 67   SDPKLPFSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXXXXXXXXXXX 126
            +D   P  NK   K I  ++ LHRQTA+LS  F  S+  +                    
Sbjct: 86   NDSIYPPENKTSMKSITVADILHRQTAELSKTFYDSNFTDKDVKDYIDIIDNDVATSNES 145

Query: 127  XXXXTIEENIDEEYADEYSRLLLSPASSNV-DDERNRALQGSPTSDL---EDGHGGGYQS 182
                T E  + +EY D++   + +  S N+ DDE++R L  +P+S +   E      Y  
Sbjct: 146  DSNSTPEPYLGDEY-DQHRLAIRTQKSPNIADDEQSRLL--TPSSSIIGAELDLEAHYDE 202

Query: 183  VHPSHDLRFGPRSVWQWFTSFPSKFAQ---YLPAAVLGLLLNILDALSYGMIIFPITEPV 239
              P   +R    S+ +   S    F+Q   Y PAAVLGLLLNILDALSYGMIIFPITEP+
Sbjct: 203  FEP---VRMDASSINRQNESKLIDFSQILHYFPAAVLGLLLNILDALSYGMIIFPITEPI 259

Query: 240  FSHLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSD 299
            F+++G  GISMFYIS+II Q + SGG+SSFP+G+GSEMIEITPFYHTMAL IK +L    
Sbjct: 260  FANMGTAGISMFYISSIICQYILSGGFSSFPTGIGSEMIEITPFYHTMALAIKNSL-DVQ 318

Query: 300  DEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEV 359
            +EII+TTIFCYVISS++TG+VFY LGKL+LGKIV FFPRHILIGCIGGVGYFL++TG+EV
Sbjct: 319  EEIISTTIFCYVISSLVTGLVFYSLGKLKLGKIVAFFPRHILIGCIGGVGYFLVVTGLEV 378

Query: 360  TTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVL 419
            TTRVAK EYSW F+S L ++++ + KWL P+LLT +LI TQ  F+NSLVLP+FYI+T++L
Sbjct: 379  TTRVAKVEYSWEFLSYLLSDFNIIGKWLTPILLTTILIFTQHHFQNSLVLPSFYIITIIL 438

Query: 420  FHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALT 479
            FHFIVA++P LSL+ LRDSGWIFP+ +S+ KW+DHYK FN++ V W L+L+Q+PTM+ALT
Sbjct: 439  FHFIVALVPMLSLNKLRDSGWIFPLTNSNDKWFDHYKYFNVYNVSWVLILKQMPTMLALT 498

Query: 480  FFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRA 539
            FFGILHVPINVPALAMSL +DK+DVD+E IAHGYSNF SGL GSVQNYLVYTNSVLFIRA
Sbjct: 499  FFGILHVPINVPALAMSLNIDKFDVDREFIAHGYSNFLSGLFGSVQNYLVYTNSVLFIRA 558

Query: 540  GADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRF 599
            GADS  AG+LL+ LT  +M+IGPVIISFIPICIVGSLIFLLGYELL+EAL+DT  K+  F
Sbjct: 559  GADSPIAGYLLIVLTAIVMLIGPVIISFIPICIVGSLIFLLGYELLIEALLDTVGKVTFF 618

Query: 600  EYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYV 659
            EY T++IIVFTMGI+DFVLGIIVGIL+AC  F+VD TKLQT+N EY+G +AKSTVYRD++
Sbjct: 619  EYTTIIIIVFTMGIYDFVLGIIVGILLACIKFMVDGTKLQTINTEYDGTIAKSTVYRDFI 678

Query: 660  QTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNIN 719
            Q+KFLDGIGEQIY++KLQNVLFFGTIISIEEKI+ LL++S+ DS+K RI+YLILDFKNIN
Sbjct: 679  QSKFLDGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQLSDSDSSKHRIRYLILDFKNIN 738

Query: 720  ADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGAL 779
             DNIDYSAAEGFNRIKRFT  + IKLIISSI   D IY AFN +GLL D+ELF+DLN  L
Sbjct: 739  DDNIDYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIYKAFNKIGLLQDIELFSDLNNGL 798

Query: 780  EWCENEFLFQYXXXXXXXXXXXXXXXXNNVVSAIMAATQNKKIDRSGID-LNKGGNRDQ- 837
            EWCEN++L +Y                   + + M+  Q+K I    I+  +  GN  Q 
Sbjct: 799  EWCENKYLEKYRELHEKAKKR---------LHSRMSILQDKNISSRQINSTSSDGNEYQS 849

Query: 838  ARHLMSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDI 897
            ++ LMSLP NTPRNHQ+LSVA+NVF N+ QAV   K     ++    +LL +++++RPD+
Sbjct: 850  SQRLMSLPLNTPRNHQLLSVARNVFKNETQAVSRFKNLDNGEDAFTQLLLQSIRRFRPDV 909

Query: 898  VSEVQKVREKEIKFWAQLCPYFXXXXXXXXXXXXHADNVFFLIETGMLKAVYELPQGSLY 957
             SE + +R +EIKFW QL PYF            + +N FFL+++G++K  ++L  G L 
Sbjct: 910  FSESKDIRAQEIKFWTQLAPYFNKIFVETNSTFLNENNFFFLLDSGVIKVTHDLAPGKLS 969

Query: 958  EIMSNGTCFGKIIAPGNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLM 1017
            E M + T +G + +  N   +  K+T   ET S++W+IDS  LKKM++ENL LY E+TL+
Sbjct: 970  ETMLSRTSYGILSSKNNRTYKTHKVTFIPETKSVIWLIDSEGLKKMEKENLKLYSELTLL 1029

Query: 1018 IMCIKDTRFKELLGYTLVSA 1037
            IM I D RFK LLGYTLV+A
Sbjct: 1030 IMSISDYRFKALLGYTLVNA 1049

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score = 1100 bits (2845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/1019 (56%), Positives = 706/1019 (69%), Gaps = 79/1019 (7%)

Query: 36   RASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPKLPFSNKQHPKVIHGSENLHRQTAQL 95
            R+  + +SPP       G    G  P++Y            +  + IH S +L RQTA L
Sbjct: 55   RSYVANLSPPPLARLPGGL--PGELPLSYR----------PEQSQSIHQSVSLRRQTAAL 102

Query: 96   SNEFCSSSVEENSPTIXXXXXXXXXXXXXXXXXXXTIEENIDEEYADEYSR--LLLSPAS 153
            SNEF  +   E+                         E++     A+E S    L+SP S
Sbjct: 103  SNEFEDTFEFEDQ-------------------LAGVSEDDGHSTTAEEPSMNGTLISPVS 143

Query: 154  S------NVDDERNRALQGSPTSDLEDGHGGGYQSVHPSHDLR--------FGPRSVWQW 199
            S      ++++  N  L  +   DLE G   GY+  + S   R         GP +  + 
Sbjct: 144  SVPDTPIDINEPSNALLPPNAEHDLEYGSIDGYEHQYVSLQSRRSGANTHNIGPDASLRE 203

Query: 200  FTSFPSK-FAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIIS 258
               F ++    Y+PA +LGLLLNILDALSYGMIIFPITEP+FSHLGPTG+SMFY+S+IIS
Sbjct: 204  KMMFTARRMVNYMPAVILGLLLNILDALSYGMIIFPITEPLFSHLGPTGMSMFYVSSIIS 263

Query: 259  QSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSMLTG 318
            Q +YSGG+S+F + VGSEMIEITPFYH MA  I   L G  D +++TTI CY +SS++TG
Sbjct: 264  QLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGEKDRVLSTTIVCYALSSIITG 323

Query: 319  VVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFT 378
            +VF++LG+LRLGKIVGFFPRHILIGCIGGVGYFL+ITG+EVTTRVAKFEYS+ F+S LFT
Sbjct: 324  LVFFLLGRLRLGKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKFEYSFEFLSSLFT 383

Query: 379  NYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDS 438
            N + L KW LP L+ V+L+  Q  F NSLVLP FYI  L+LFHFIVA+IP+LSLD LRDS
Sbjct: 384  NIEVLGKWGLPALMAVLLVVVQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILRDS 443

Query: 439  GWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQ 498
            GWIFP   S   W+D Y L+N   V W ++L+QIPTM+ALTFFGILHVPINVPALAMS+ 
Sbjct: 444  GWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMSIG 503

Query: 499  MDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIM 558
            +DK DVDKELIAHGYSNF SG++GSVQNYLVYTNSVLFIRAG D + AG +L A T  IM
Sbjct: 504  LDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRAGGDDALAGLMLAAATFGIM 563

Query: 559  VIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVL 618
            ++GPVI+++IP+CIVGSLIFLLGYELL EAL DTW KLN FEY TVV IVFTMG FDFVL
Sbjct: 564  IVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVL 623

Query: 619  GIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQN 678
            GIIVGILIACFSFLVDSTKLQTVNGE++G VA+STV RDY+QT+FL+ IGEQI+VLKLQN
Sbjct: 624  GIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQN 683

Query: 679  VLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFT 738
            +LFFGTI+SIEEKI++LLE+S+KDS+K+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT
Sbjct: 684  LLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFT 743

Query: 739  ETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYXXXXXXXX 798
             +KRI LIISSIK  D IY AFN VG+L  VELF DLN ALEWCENEFL Q+        
Sbjct: 744  SSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQF-------- 795

Query: 799  XXXXXXXXNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQMLSVA 858
                                  K  R+   L  G  +D+    + LP NTPRN+Q +SVA
Sbjct: 796  ----------------------KDLRNKTKLKAGKKQDRRMSKVPLPFNTPRNNQFVSVA 833

Query: 859  QNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPY 918
            Q +F  DEQ++ +LK  Y+E  PVLP+LL AL+++RP I+S  + V+E E + W+ LC Y
Sbjct: 834  QKLF-TDEQSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKY 892

Query: 919  FXXXXXXXXXXXXHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNTMPR 978
            F            H DN+FF+IETGM+K  Y L QG LYE MS  TC+G++  P N    
Sbjct: 893  FYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMSIPNNNNNP 952

Query: 979  EQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037
               + +E ETD  LW+ID + L K+K ENL LY EV L+ +CI   R KELLG+ LVS+
Sbjct: 953  ISCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score = 1096 bits (2834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/1065 (54%), Positives = 729/1065 (68%), Gaps = 111/1065 (10%)

Query: 16   EAITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNY-------NMSD 68
            EAI+VSLG+  Q  S+         T+S P    + +G      SP  Y       N+S 
Sbjct: 14   EAISVSLGLQSQPGSET-------DTLSVPRGNPFSNG---ADGSPHYYLGRSYVANLSP 63

Query: 69   PKLPF-----------SNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIXXXXXX 117
            P L             S  +  + IH S +L RQTA LSNEF  +   E+          
Sbjct: 64   PPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQ--------- 114

Query: 118  XXXXXXXXXXXXXTIEENIDEEYADE--YSRLLLSPASSNVD-------DERNRALQGSP 168
                          + EN +    DE   +   +SP SS  +       D  N  L  + 
Sbjct: 115  -----------LEDLAENGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNT 163

Query: 169  TSDLEDGH----------------GGGYQSVHPSHDLRFGPRSVWQWFTSFPSKFAQYLP 212
              DLE G                 G   +++ P+  +R   ++++ +      +   Y+P
Sbjct: 164  QRDLEYGSIDEFDHQYVSLQSQRAGSNSRAIDPNASMR--DKTLFTF-----RRLGNYVP 216

Query: 213  AAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFPSG 272
            A +LGLLLNILDALSYGMIIFPITEP+FSHLGP+G+SMFY+S+++SQ VYS G+S+F + 
Sbjct: 217  AVILGLLLNILDALSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNA 276

Query: 273  VGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKI 332
            VGSEMIEITPFYH+MA  I  ++ G  D ++TTTI CY +SS++TG+VF++LG+L+LGKI
Sbjct: 277  VGSEMIEITPFYHSMAASIMASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKI 336

Query: 333  VGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLL 392
            VGFFPRHILIGCIGGVGYFL+ITG EVTTR +KFEYS+ F+S L T+ + L KW LP L+
Sbjct: 337  VGFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALM 396

Query: 393  TVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWY 452
             V+L+  QR  KNSLVLPTFYI  L+LFHFIVA+IP+LSL +LRDSGW+FP  ++   W+
Sbjct: 397  AVLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWF 456

Query: 453  DHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHG 512
            D YKL+N   V W LVL+Q+PTM+ALTFFGILHVPINVPALAMS+ +DK DVDKELIAHG
Sbjct: 457  DFYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHG 516

Query: 513  YSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICI 572
            YSNF SG++GSVQNYLVYTNS+LFI+AGAD S AG +L A T  IMVIGPVI+++IP+CI
Sbjct: 517  YSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCI 576

Query: 573  VGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFL 632
            VGSLIFLLGYELL EALVDTW KLN FEY TVV IVFTMG FDFVLGIIVGILIACFSFL
Sbjct: 577  VGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFL 636

Query: 633  VDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKI 692
            VDSTKLQT+NGE++G VA+STV RDY+QT+FL+ IGEQI+VLKLQN+LFFGTIISIEEKI
Sbjct: 637  VDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKI 696

Query: 693  ERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKE 752
            ++LLE+S+KD++K+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISSIK 
Sbjct: 697  DKLLELSDKDASKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKT 756

Query: 753  RDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYXXXXXXXXXXXXXXXXNNVVSA 812
             D IY AFN VG L+ VELF DLN ALEWCENEFL Q+                      
Sbjct: 757  TDRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFRD-------------------- 796

Query: 813  IMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQMLSVAQNVFANDEQAVKNL 872
            +   T+ K + +    L+KG          +LP NTPRN+  +SVAQ +F  DEQ++ +L
Sbjct: 797  LRNKTKLKAVRKQERQLSKG----------ALPFNTPRNNHFVSVAQKLF-TDEQSMPHL 845

Query: 873  KKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPYFXXXXXXXXXXXXH 932
            K  YKE  PVL +LL AL++YRP+I+S  + V+E E K W++L  +F            H
Sbjct: 846  KTHYKEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPH 905

Query: 933  ADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNTMPREQKLTIETETDSIL 992
             +N+F ++E+GM+K  Y L QG LYEI+S  TC+G+I AP ++      + I+ ETD  L
Sbjct: 906  KNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDCAL 965

Query: 993  WVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037
            W++D ++L K+K+ENLALY E+ L+ +C+   R KELLG+ LVS+
Sbjct: 966  WILDEANLAKLKKENLALYTELLLVTLCMNQDRLKELLGHCLVSS 1010

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/829 (60%), Positives = 622/829 (75%), Gaps = 34/829 (4%)

Query: 209  QYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQSVYSGGWSS 268
            QY PA  LGLLLNILDALSYGMIIFPITEP+FSHLGPTG+SMFY+ST+I Q  +S G SS
Sbjct: 264  QYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGPTGLSMFYVSTVICQLCFSLGLSS 323

Query: 269  FPSGVGSEMIEITPFYHTMALGIKEALV-GSDDEIITTTIFCYVISSMLTGVVFYVLGKL 327
            FPS +GSEMIEITPF+HTMAL I  ++  G+D+++I+TTI CY +SS++TG+ F++LGK+
Sbjct: 324  FPSAIGSEMIEITPFFHTMALSIMNSIPEGNDNKVISTTIVCYALSSIITGLTFFLLGKM 383

Query: 328  RLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWL 387
            RLGKIVGFFPRHILIGCIGGVGYFLIITG+EV TRV +F+YSW F+S LFT++D L KWL
Sbjct: 384  RLGKIVGFFPRHILIGCIGGVGYFLIITGLEVCTRVPEFKYSWQFLSSLFTDFDILLKWL 443

Query: 388  LPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASS 447
             PV+LT++LI  Q    NSLVLP+FYI+TL+LFHF+VA++P+LSLD LRD GWIF   ++
Sbjct: 444  TPVILTLILISVQSRIHNSLVLPSFYIITLLLFHFVVALVPSLSLDKLRDFGWIFAKVNA 503

Query: 448  DSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKE 507
               WYD YKL++   V W+L+ +Q+PTM+ALTFFGILHVPINVPALAMSL +DKYDVDKE
Sbjct: 504  KENWYDFYKLYDFKNVQWSLIPKQVPTMLALTFFGILHVPINVPALAMSLNVDKYDVDKE 563

Query: 508  LIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISF 567
            LIAHGYSN  SG LGS+QNYLVYTNSVLFIRAGADS  AG +L   T  +MVIGPVIISF
Sbjct: 564  LIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFIVMVIGPVIISF 623

Query: 568  IPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIA 627
            IPICIVGSLIFLLGYEL+ EA++DTW KL  FEYLT+ IIV TMG+ DFV+GIIVGIL+A
Sbjct: 624  IPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIWIIVITMGVVDFVIGIIVGILLA 683

Query: 628  CFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIIS 687
            CFSFLV+ST+LQT+NGEY+G VAKSTVYRDY+Q+KFL  IGEQIYVLKLQN+LFFGTIIS
Sbjct: 684  CFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIYVLKLQNILFFGTIIS 743

Query: 688  IEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLII 747
            IEEK+  LLEI   DS+K+RIKYLILDFKNI A +IDYSAAEGFNRIKRF E +RI LII
Sbjct: 744  IEEKVNSLLEICESDSSKKRIKYLILDFKNIRAKSIDYSAAEGFNRIKRFLEKERIHLII 803

Query: 748  SSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYXXXXXXXXXXXXXXXXN 807
            SSI + D IY AF+ V L  +VELF+DLNGALEWCENEFL +Y                 
Sbjct: 804  SSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCENEFLMRY----------------- 846

Query: 808  NVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQMLSVAQNVFANDEQ 867
                 I   T+ +K+ +    L K  NR     +  LP NTPRNHQ +S  +N++  +E 
Sbjct: 847  ---KRIRTKTRARKLAQ----LKKSQNR-----MSKLPVNTPRNHQFVSEVRNIYT-EEM 893

Query: 868  AVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPYFXXXXXXXX 927
             ++ L  E KE +  LPI L +++++R  I S  +  R  E+  W +L  YF        
Sbjct: 894  EIQKLSNELKERQQFLPIFLMSIRKFRNAIQSPNELKRTNELDLWKRLISYFQQKKFPPN 953

Query: 928  XXXXHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNTMPREQKLTIETE 987
                H +N+F ++E+G+L   + L QG  YE MS  T +G +I+  N+ P    ++I T+
Sbjct: 954  TEIRHRNNMFIVVESGVLNLTHHLIQGEFYETMSPKTAYG-VISNVNSDPL--AVSITTD 1010

Query: 988  TDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVS 1036
            T+ +L  ID+ SL  +K  +  L+ E+ +++M I   RF+ELLGY+L+S
Sbjct: 1011 TECVLRYIDAESLADLKLTDPELFTELLILVMAIHRDRFRELLGYSLIS 1059

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 43/86 (50%), Gaps = 19/86 (22%)

Query: 29 SSKNKIHRASASTMSPPLCRSYMSGFFTGGSSPMNYN--------------MSDP-KLPF 73
          ++KN+ +     T S  L RSY+  F    S PM Y               + DP K PF
Sbjct: 17 TAKNRKYSFQMPTTSTYLGRSYVGSFI---SPPMEYRSNSNTTSNNNNNSNVGDPFKSPF 73

Query: 74 SNKQHPKVIHGSENLHRQTAQLSNEF 99
          S+ +  K+IH S NLH+QTA LSN F
Sbjct: 74 SS-EGSKLIHESGNLHKQTAFLSNTF 98

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/1024 (51%), Positives = 660/1024 (64%), Gaps = 94/1024 (9%)

Query: 46   LCRSYMSGFFTGGS----SPMNYNMSDPKLPFSNKQHPKVIHGSENLHRQTAQL---SNE 98
            L RSY+  F   GS             P LP    Q    +H   +LHRQTA L   S  
Sbjct: 54   LGRSYVGSFSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDSRA 113

Query: 99   FCSSSVEENS--------------PTIXXXXXXXXXXXXXXXXXXXTIEENIDEEYADEY 144
            +     EE +              P                      ++E +D+  +D+ 
Sbjct: 114  YDGGPEEEEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQE 173

Query: 145  S--RLLLSPASSN-------VDDERNRALQGSPTSDLEDGHGGGYQSVHPSHDLRFGPRS 195
            +  RL LSP +++       +++E++ +   S                        GP  
Sbjct: 174  AGTRLFLSPITTDYIHSYGAINEEQSASETASRAET--------------------GPSP 213

Query: 196  VWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST 255
            +  W T    +  +Y+PA +LGLLLNILDALSYGMIIFPI EP+FSHLGP G+SMFY+ST
Sbjct: 214  LRLWGT----RTVRYIPAVILGLLLNILDALSYGMIIFPIAEPIFSHLGPHGLSMFYVST 269

Query: 256  IISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGS-DDEIITTTIFCYVISS 314
            IISQ VYSGG+SSF  G GSEMIE+TPF+HTMAL IK +L     D+IITTTI CY +S+
Sbjct: 270  IISQLVYSGGFSSFGYGTGSEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALST 329

Query: 315  MLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVS 374
            ++TG VF  LGKLRLGK+V FFP HILIGCIGGV YFLIITGIEV+TRV KFEYS  F+ 
Sbjct: 330  IITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLR 389

Query: 375  GLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDT 434
             LF + D LAKWL+P LL V +I  QR   NS++LP FY+    LFHFIVA+IP+LSLDT
Sbjct: 390  NLFMDPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDT 449

Query: 435  LRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALA 494
            LRD GWIFP+  S  +WYD+ +L+N  ++HW LVL +IPTM+ALTFFGILHVPINVPALA
Sbjct: 450  LRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALA 509

Query: 495  MSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALT 554
            +S  +DK DVDKELIAHGYSN FSG  GS+QNYLVYTNSVLFIRAGADS +AGFLL   T
Sbjct: 510  ISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIAT 569

Query: 555  VCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIF 614
               M  GP IIS IP+CIV SLIFLLGYELL E L D++++L+ FEY+TVVII+ TMGIF
Sbjct: 570  FMTMTAGPWIISIIPVCIVSSLIFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIF 629

Query: 615  DFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVL 674
            DFVLGIIVG+L+ACFSFLV+ST+ +T++ E++G VAKS  +RDY+Q+ FL+ + EQIYVL
Sbjct: 630  DFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVL 689

Query: 675  KLQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRI 734
            KLQN LFFGTIISIEEKI  LLE  N    K+ IKYLILDFK+IN DNIDYSAAEGFNRI
Sbjct: 690  KLQNNLFFGTIISIEEKIGNLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRI 748

Query: 735  KRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYXXXX 794
            KR  E KRIKLI+SSI E D IY  F+ +GLL DVELF DLN ALEWCENE L +Y    
Sbjct: 749  KRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEY---- 804

Query: 795  XXXXXXXXXXXXNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLP-TNTPRNHQ 853
                             ++++     K+ R   D+              +P  NTPRN Q
Sbjct: 805  ----------------RSLLSRAHRVKVRRRSKDIVPKAQ---------IPLENTPRNAQ 839

Query: 854  MLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWA 913
            +++ AQ V++ ++Q  K L K YK   P L +LL ALK YR    S       KEI+ W 
Sbjct: 840  IMTAAQAVYSGEQQLNKTLSK-YKASHPALALLLVALKTYR----SGHAYKETKEIRLWK 894

Query: 914  QLCPYFXXXXXXXXXXXXHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPG 973
             LCPYF               ++FF++E+G+LK  Y LPQGSL E +++ TC+G I  PG
Sbjct: 895  HLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPG 954

Query: 974  NTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYT 1033
            +         + TET+ +LW+ID+  L+K++EENL LY E+ ++ + +   RFKELLG++
Sbjct: 955  SL---SYSSVVRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHS 1011

Query: 1034 LVSA 1037
            L++ 
Sbjct: 1012 LING 1015

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 112/531 (21%), Positives = 202/531 (38%), Gaps = 84/531 (15%)

Query: 293 EALVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFL 352
           E L   + EI T +I   V+ + ++G+  +V G  R G +     R +L G I  VG  +
Sbjct: 166 EKLRAHNHEISTMSI--SVLVTFISGMFLFVFGICRFGFLGNVLSRALLRGFISSVGVVM 223

Query: 353 IITGI------EVTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPV----LLTVVLIGTQRC 402
           I+  +             K  +  PF    F      A + +P     L   +++ T R 
Sbjct: 224 IVNSLISELKLHKLLLETKGHFHTPFQKIRFIIKYAPANYHIPTAVLSLTCFIILVTARV 283

Query: 403 FKNSLVL----PTFYILTLVLF--------------HFIVAIIPTLSLDTLRDSGWIFPI 444
            K  L+     P F    L+L               H+ ++I+     D L +  +  PI
Sbjct: 284 IKKKLMRRRRWPVFVPEILILIITTIILSHKFKFKKHYEISIVGDFDTDGLVN--FYNPI 341

Query: 445 ASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTF----FGILHVPINVPALAMSLQMD 500
           + S+ +                      P +M   F     G         +L  + +  
Sbjct: 342 SKSNREL--------------------APNLMNAGFIVAILGFFESTTAAKSLGSAYEF- 380

Query: 501 KYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVI 560
               ++EL+A G  N  + +LG++  +  Y  S +   +GA +  +G  +  + +  +  
Sbjct: 381 AISSNRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKF 440

Query: 561 GPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEY---LTVVIIVFTMGIFDFV 617
               I +IP+CI+  +  ++G  LL EA  D     N   Y   L   + V T   +   
Sbjct: 441 FLSQIRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLE 500

Query: 618 LGIIVGILIACFSFLVDSTKLQT---VNGEYNGNVAKSTVY-------RDYVQTKFLDGI 667
           +G+ +G   +  S +  S K +       E  G    S  Y        D    + L+G 
Sbjct: 501 MGVCIGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPDDLPNIEELEG- 559

Query: 668 GEQIYVLKLQNVLFFGTIISIEEKIERLLEISN-------KDSTKRR-IKYLILDFKNIN 719
                V+K+   L F  +  ++E++ RL    +       K S +R  IKYL+ D   + 
Sbjct: 560 ---CLVVKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMT 616

Query: 720 ADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVE 770
              +D SAA+    I +    +R+K+ ++ +   + + +      +LN VE
Sbjct: 617 F--MDSSAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVE 665

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 115/579 (19%), Positives = 221/579 (38%), Gaps = 106/579 (18%)

Query: 274 GSEMIEITPFYHTMALGIKEALVGSDDEI-----------------ITTTIFCYVISSML 316
           G   +  TPF++ +   + + +VG +  I                 +++   C +I+  +
Sbjct: 144 GLYALAFTPFFYAIFGSVPQMIVGPESAISLVVGQAIEPMIRHDPSLSSLDLCVIIT-FI 202

Query: 317 TGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF------EYSW 370
           +GVV +  G  R G +     R  L G I  VG  ++I  + V  ++ K        Y  
Sbjct: 203 SGVVLFTFGVFRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYHS 262

Query: 371 PFVSGLF------TNYDTLAKWLLPVLLTVVLIGTQRC-------FKNSLVLPT--FYIL 415
           PF   LF       NY  L   LL +   ++L+  +         F++ +  P     ++
Sbjct: 263 PFEKVLFLIKYAPANYH-LPTSLLSLCCFLILMSLRLIKKKLLKRFRSLVFFPEILLVVV 321

Query: 416 TLVLFHF-----------IVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVH 464
           T++ F +           +V  I     D LR+     P++ +   +Y    LF+     
Sbjct: 322 TVIFFSYNFDLKHRYNIEVVGDIEASVFDKLRN-----PLSKNKRPFYG--DLFS----- 369

Query: 465 WTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSV 524
                        +   G         +L  +  +     ++EL+A G  N    L G++
Sbjct: 370 ---------AGFMVAMLGFFESTTASKSLGTAYDL-AVSSNRELVALGSLNLIGSLFGAL 419

Query: 525 QNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYEL 584
            ++  Y  S +   +GA +  +G  +  +T+  +      I +IP+C++  +  ++G  L
Sbjct: 420 PSFGGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSL 479

Query: 585 LVEALVDTWSKLNRFEY---LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQT- 640
           L EA  D    +    Y   ++ +I V T   +    GI VG   +    +  STK +  
Sbjct: 480 LEEAPADLRFHIRCRGYNELISFIITVLTTFFYSVEAGITVGCGYSIIRVIKHSTKSRIQ 539

Query: 641 -----------VNG-EYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISI 688
                      VN  EY G  + S   R   Q + ++G      ++++   L F     +
Sbjct: 540 ILGKLAGTNKFVNADEYEGKNSTSE-RRVNPQLEEIEG----CLIVRIPEPLTFTNTDDL 594

Query: 689 EEKIERL--------LEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTET 740
           + ++ RL           + +   +   KY+I D   +    ID SA +    I    + 
Sbjct: 595 KTRLNRLELYGSTKTHPAAPRSRDQEMTKYVIFDLHGMT--TIDSSAIQILQEIISSYKR 652

Query: 741 KRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGAL 779
           + + + +  +     + N F N G+L  VE  +D++ +L
Sbjct: 653 RHVHVFLVRVPSARKVRNRFVNSGILEMVE--SDIHRSL 689

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 108/556 (19%), Positives = 219/556 (39%), Gaps = 52/556 (9%)

Query: 262 YSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEI----------IT------T 305
           Y+   +  P   G   + I+PF + +   + + +VG +  I          IT      +
Sbjct: 130 YTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKDNVS 189

Query: 306 TIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 365
            I   ++ + ++G +    G  R G +     + +L G I  VG  +II  +    ++ K
Sbjct: 190 LIDISIVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDK 249

Query: 366 F------EYSWPFVSGLFTNYDTLAKWLLPVLL----TVVLIGTQRCFKNSLVL--PTFY 413
           F       Y  PF   LF      A++  P  +      +++   R  K  L+    +  
Sbjct: 250 FLVSLPQHYHTPFEKVLFLIDYAPAQYHKPTAIFSGCCFIILIVMRLLKKKLMKRHKSAV 309

Query: 414 ILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIP 473
               +L   IV I+ ++ L +L+    I  +       +D  K    H     L+     
Sbjct: 310 FFPDILLVVIVTILISMKL-SLKQRYGISIVGDFSMDNFDKLKNPLTHS-RRKLMPDLFS 367

Query: 474 TMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNS 533
             + +   G         +L  +  +     ++EL+A G  N F  L G++ ++  Y  S
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGCINMFISLFGALPSFGGYGRS 426

Query: 534 VLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTW 593
            +   +GA S  +G  +  +T+  M +    + +IP C++  +  ++G  LL E   D  
Sbjct: 427 KINALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIK 486

Query: 594 SKLNRFEYLTVVIIVFTMGI---FDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVA 650
             L    Y  + +   T G+   +    GI +G + +  + +  S K +          +
Sbjct: 487 FHLQCGGYSELFVFAVTFGVTIFYSIESGICIGCVYSILNIIKHSAKSRIQILARIAGTS 546

Query: 651 KSTVYRDYVQTK-----FLDGIGEQI---YVLKLQNVLFFGTIISIEEKIERLLEISNKD 702
             T   DY++T       ++G  E+I    ++++   L F     ++++++R+    +  
Sbjct: 547 NFTNLDDYLRTTKKNPPAVEGRIEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIERFGSSK 606

Query: 703 --------STKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERD 754
                    +K  IKY+I D   + +  ID SAA+  + I    + + + + ++++   D
Sbjct: 607 IHPGRKSFRSKDSIKYVIFDLGGMTS--IDSSAAQVLDEIISCYKRRNVFIYLANVSIND 664

Query: 755 HIYNAFNNVGLLNDVE 770
            I       G+  +VE
Sbjct: 665 KIRTRLLKAGVTPNVE 680

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 124/596 (20%), Positives = 219/596 (36%), Gaps = 103/596 (17%)

Query: 262 YSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSD-----------------DEIIT 304
           YS   +  P   G   +  TP  + +   +   +VG +                 D  + 
Sbjct: 120 YSTSVAHVPPICGLNALAFTPLVYAVFGSVPHMIVGPESAISLVVGQAIEKLTKHDASLN 179

Query: 305 TTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGI------E 358
            T  C V++  ++G + +  G +R G +     R +L G I  VG  ++I  +      +
Sbjct: 180 VTNLCVVLT-FISGSILFSFGLMRFGFLDSVLSRALLRGFISAVGLIMVINSLISELKLK 238

Query: 359 VTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVL----IGTQRC------------ 402
            T + A   Y  PF   +F  +   A + LP  L  ++    +G  +             
Sbjct: 239 DTFKNAPGHYHAPFQKVVFLVHYAPANYHLPTALVSLVCFAALGALKVIKKKLVKRFKKV 298

Query: 403 --FKNSLVLPTFYILTLVLFHF-------IVAIIPTLSLDTLRDSGWIFPIASSDSKWYD 453
             F + LV+  F  L    + F       IV  I T S +T+++     PI+       D
Sbjct: 299 IFFPDILVVVAFATLVSYCYDFKVRYNIDIVGDIETGSSNTIKN-----PISK------D 347

Query: 454 HYKLFN--IHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAH 511
           + KLFN   H      +L    +  A    G  +       LA+S        ++EL+A 
Sbjct: 348 NLKLFNDLFHAGFLVALLGFFESTTASKSLGTNY------DLAIS-------SNRELVAL 394

Query: 512 GYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPIC 571
           G  N    L G++ ++  Y  S +   +GA +  +G  +  +T+         I  IPIC
Sbjct: 395 GSLNLVGSLFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITLITSKFLLNAIRHIPIC 454

Query: 572 IVGSLIFLLGYELLVEALVDT---WSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIAC 628
           ++  +  ++G  L  EA  D    +      E LT  I V T   +    GI +G   + 
Sbjct: 455 VLSVITTMVGISLFEEAPADLKFHFRCRGYNELLTFAITVLTTFFYSVEAGITLGCGYSI 514

Query: 629 FSFLVDST--------KLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVL 680
              + +ST        ++   N   N +   S    D      LD + E   V ++   L
Sbjct: 515 IRAIKNSTQSGIQILGRISGTNRFVNADEFYSASSLDSEFGPRLDHM-EGCLVARIAEPL 573

Query: 681 FFGTIISIEEKIERLLE--------ISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFN 732
            F     ++ ++ RL           S +   K   + +I D + +    ID SA++   
Sbjct: 574 TFTNTEDLKSRLNRLENHGSVKTHPASPRSRDKDLTRNMIFDLEGMT--QIDSSASQILC 631

Query: 733 RIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGAL------EWC 782
            I +    +++++ ++ +    H+       G+   VE    LN A        WC
Sbjct: 632 EIVKSLTKRKVRVYLARVPRALHVRERLVASGVAGMVENNIPLNTASMGQPGDSWC 687

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 110/523 (21%), Positives = 212/523 (40%), Gaps = 67/523 (12%)

Query: 293 EALVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFL 352
           E     D EI T TI   +  + ++GVV + LG +RLG +     + +L G I  VG  +
Sbjct: 158 EKFSAHDSEISTVTITMMI--TFISGVVLFFLGSVRLGFLGNILSKALLRGFISSVGLVM 215

Query: 353 IITGIEVTTRV------AKFEYSWPFVSGLF-----TNYDTLAKWLLPVLLTVVLIGTQR 401
           II  + +  ++          Y  P    +F     + Y      +L ++  +VLI T R
Sbjct: 216 IINSLIIELKLNHKLADVAGHYHTPVGKIMFLFRYASEYYHKPTAILSLICFLVLIST-R 274

Query: 402 CFKNSLVLPTFYILTLVLFHFIVAIIPTLSLD-TLRDSGWIFPIASSDSKWYDHY--KLF 458
             K  L+    +++ +     +V++   LSL    + S  I  I   ++  +      L 
Sbjct: 275 IAKKKLMNRYRFLIFVPEILLVVSVTILLSLKYDFKHSYGISTIGEFNADGFGSIGNPLS 334

Query: 459 NIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMD---KYDVDKELIAHGYSN 515
           N ++  ++ +  +   +  L FF            + SL  D    Y  ++ELIA G+ N
Sbjct: 335 NENRALYSSLWNEGLAVAMLGFF-------ESTTASKSLGSDYNLTYSSNRELIALGFMN 387

Query: 516 FFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGS 575
               L G++ ++  Y  S + + +G  +  +G ++  +T+    +   +I + P C++  
Sbjct: 388 IVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSV 447

Query: 576 LIFLLGYELLVEALVDTWSKLNRFEY--LTVVIIVFTMGIFDFV-LGIIVG-----ILIA 627
           +  ++G  LL E   D    ++   Y  LTV  + F   +   V LG+ VG     ILI 
Sbjct: 448 ITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTLTFIATLSQSVELGVTVGCIYSLILIV 507

Query: 628 CFSFLVDSTKLQTVNGE------------YNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK 675
             S L     L  + G             YNG   ++     +          E  Y++K
Sbjct: 508 KHSALSRIQILAKLEGSDEFVNVDDYIKNYNGRDFENITLEQF----------EHCYIVK 557

Query: 676 LQNVLFFGTIISIEEKIERLLEISNKD--------STKRRIKYLILDFKNINADNIDYSA 727
           +   L F     +  ++ RL    + +         ++  ++Y+I D + + +  +D  +
Sbjct: 558 IPEPLTFTNGEDLRSRLSRLERFGSTNVHPGSTSIVSQDDMEYIIFDLEGMTS--MDSGS 615

Query: 728 AEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVE 770
           A+    I R    + +++ ++ +     I     + G+L+ VE
Sbjct: 616 AQILLEIIRSYVHRDVRVYLTRVSLDREIRIRLKSAGILDLVE 658

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 110/521 (21%), Positives = 208/521 (39%), Gaps = 68/521 (13%)

Query: 293 EALVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFL 352
           E +V  D+ I T +I   ++ + ++G     LG  RLG +     R +L G I  VG+ +
Sbjct: 144 EPMVNHDERISTISI--SIVVTFISGSFLLFLGIFRLGFLGNILSRALLRGFICSVGFVM 201

Query: 353 IITGIEVTTRVAKF------EYSWPFVSGLFT------NYD------TLAKWLLPVLLTV 394
           II  +    ++ K        Y  PF   LF       NY       +L  +++ +L+ V
Sbjct: 202 IINSLISELKLDKVLATSPEHYHTPFEKILFLIKYGQHNYHAPTAILSLYSFIILMLMKV 261

Query: 395 VLIGTQRCFKNSLVLPTFYILTL--VLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWY 452
           +     + FK  + +P   I+ +  ++F F   I     +  + D    F +   DS   
Sbjct: 262 MKKRLMKRFKWVIFVPEILIVIVGTIMFSFHFDIKHKFDISIIGD----FKVNGFDS--- 314

Query: 453 DHYKLFN-IHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAH 511
               L N + K +  L+   +   +     G         AL  +  +     ++EL+A 
Sbjct: 315 ----LHNPLDKTNRLLLKPLLDAGIVCAVLGFFESTTASKALGTTYDL-TVSSNRELVAL 369

Query: 512 GYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPIC 571
           G  N    L G++  +  Y  S +   +G  +  +G  L ++T+  +     ++   P C
Sbjct: 370 GSMNIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTC 429

Query: 572 IVGSLIFLLGYELLVEALVDT--WSKLNRFEYLTVVIIVFTMGIFDFV-LGIIVGILIAC 628
           ++  +  ++G  LL EA  D   + + + +  L V+ + F   IF  V +GI VG   + 
Sbjct: 430 VLSVVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTFITTIFYSVEVGICVGCCYSI 489

Query: 629 FSFLVDS--TKLQTVN--------------GEYNGNVAKSTVYRDYVQTKFLDGIGEQIY 672
            S +  S  +++Q +               G ++G    +  + +      L+ + E   
Sbjct: 490 ISIIKHSAQSRIQILAKRKGDNRFSNADELGIFDGENNNNNTFFE----PLLEDLDEDRL 545

Query: 673 VLKLQNVLFFGTIISIEEKIERL-------LEISNKDSTKR-RIKYLILDFKNINADNID 724
           V+K+   L F     ++E++ RL       +    +D   R + KY+I D   +    ID
Sbjct: 546 VVKIPEPLTFTNTEDLKERLSRLERFGSVRVHPGRRDLRSRDKTKYIIFDLHGMTY--ID 603

Query: 725 YSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGL 765
            SAA+    I      +++ +    +  R  +   F   GL
Sbjct: 604 ASAAQILLEIILAYNRRQVFVFFVRVPMRREVRQRFERSGL 644

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 113/562 (20%), Positives = 220/562 (39%), Gaps = 64/562 (11%)

Query: 262 YSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEI----------IT------T 305
           Y+   +  P   G   + I+PF + +   + + +VG +  I          IT      +
Sbjct: 130 YTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKDNVS 189

Query: 306 TIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 365
            I   V+ + ++G +    G  R G +     + +L G I  VG  +II  +    ++ K
Sbjct: 190 LIDISVVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDK 249

Query: 366 F------EYSWPFVSGLFTNYDTLAKWLLPVLL----TVVLIGTQRCFKNSLVLPTFYIL 415
           F       Y  PF   LF      A++  P  +     ++++ + R  K  LV      +
Sbjct: 250 FLLSLPQHYHTPFEKVLFLIDYAPAQYHKPTAIFSGCCLIVLFSMRLLKKKLVKHHKSAI 309

Query: 416 TL--VLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIP 473
               +L   IVAI  ++   +L+    I  I       +D  K    H     L+     
Sbjct: 310 FFPDILLVVIVAIFISMKF-SLKHRYGITIIGDFSMDNFDKLKNPFTHS-RRKLIPDLFS 367

Query: 474 TMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNS 533
             + +   G         +L  +  +     ++EL+A G+ N    L G++ ++  Y  S
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPSFGGYGRS 426

Query: 534 VLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTW 593
            +   +GA S  +G  +  +T+  M +    + +IP C++  +  ++G  LL E   D  
Sbjct: 427 KINALSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIK 486

Query: 594 SKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK---------LQTVNGE 644
             L    Y  + +   T G+   +  I  GI I C   +++  K         L  V G 
Sbjct: 487 FHLRCGGYSELFVFAVTFGV-TILCSIEAGICIGCVYSILNIIKHSAKSRIQILARVAGT 545

Query: 645 YNGNVAKSTVYRDYVQTKFLDGIG--------EQIYVLKLQNVLFFGTIISIEEKIERLL 696
            N      T   DY++T   + +G        E   ++++   L F     ++++++R+ 
Sbjct: 546 SN-----FTNLDDYLRTMKKNPLGGENRLEEVEGCMIVRIPEPLTFTNSEDLKQRLDRIE 600

Query: 697 EISNKD--------STKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIIS 748
              +           +K  IKY+I D   + +  ID SAA+  + I    + + + + ++
Sbjct: 601 RFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--IDSSAAQVLDEIITSYKRRNVFIYVA 658

Query: 749 SIKERDHIYNAFNNVGLLNDVE 770
           ++   D I       G++ ++E
Sbjct: 659 NVSINDKIRTRLLKAGVIPNLE 680

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 109/567 (19%), Positives = 219/567 (38%), Gaps = 75/567 (13%)

Query: 262 YSGGWSSFPSGVGSEMIEITPFYH-------TMALGIKEAL---VGSDDEIIT------T 305
           Y+   +  P   G   + I+PF +        M +G + A+   VG   E IT      +
Sbjct: 130 YTTSIAHVPPLCGLYSLAISPFVYGVFGSVPQMIVGPESAISLVVGQAVESITLHKDNVS 189

Query: 306 TIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 365
            I   ++ + ++G +    G  R G +     + +L G I  VG  +II  +    ++ K
Sbjct: 190 LIDISIVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDK 249

Query: 366 F------EYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCF---------------- 403
           F       Y  PF   LF      A++ +P   T +  G   C                 
Sbjct: 250 FLVSLPQHYHTPFEKILFLIDYAPAQYHMP---TAIFSGC--CLIILFLMRLLKRKLLKY 304

Query: 404 -KNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFN-IH 461
            K ++  P       +L   IV I+ ++  D L+    I  +       +D  KL N + 
Sbjct: 305 HKGAIFFPD------ILLVVIVTILISMKFD-LKHRYGITIVGDFSMDNFD--KLKNPLT 355

Query: 462 KVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLL 521
           +    L+       + +   G         +L  +  +     ++EL+A G+ N    L 
Sbjct: 356 RSRRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLF 414

Query: 522 GSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLG 581
           G++ ++  Y  S +   +GA S  +G  +  +T+  M +    + +IP C++  +  ++G
Sbjct: 415 GALPSFGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIG 474

Query: 582 YELLVEALVDTWSKLNRFEYLTVVIIVFTMGI---FDFVLGIIVGILIACFSFLVDSTKL 638
             LL E   D    L    Y  + +   T G+   +    GI +G + +  + +  S K 
Sbjct: 475 ISLLEEVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGICIGCVYSILNIIKHSAKS 534

Query: 639 QTVNGEYNGNVAKSTVYRDYVQTKFLDGIG-------EQIYVLKLQNVLFFGTIISIEEK 691
           +          +  T   DY+     + +        E   ++++   L F     ++++
Sbjct: 535 RIQILARVAGTSNFTNLDDYLMNMKRNPLSIENTEEIEGCMIVRIPEPLTFTNSEDLKQR 594

Query: 692 IERLLEISNKD--------STKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRI 743
           ++R+    +           +K  IKY+I D   + +  +D SAA+  + I    + + +
Sbjct: 595 LDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--LDSSAAQVLDEIITSYKRRNV 652

Query: 744 KLIISSIKERDHIYNAFNNVGLLNDVE 770
            + ++++   D I    +  G++ +VE
Sbjct: 653 FIYLANVSINDKIRTRLSKAGVIPNVE 679

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 123/288 (42%), Gaps = 27/288 (9%)

Query: 505 DKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGF---LLVALTVCIMVIG 561
           ++EL+A G  N FS +LGS+  +  Y  S +   +GA +  +G    LLV LT+  ++  
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLL-- 450

Query: 562 PVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEY---LTVVIIVFTMGIFDFVL 618
             +I +IPIC++  +  ++G  LL EA  D       F Y   L   + V T   +   +
Sbjct: 451 -PMIHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEV 509

Query: 619 GIIVGILIACFSFLVDSTK-----LQTVNGE---YNGNVAKSTVYRDYVQTKFLDGIGEQ 670
           GI +G   +  S +  S K     L  V G     N +       R++          E 
Sbjct: 510 GICIGCGYSVISIIKHSAKSRIQILARVQGTSRFVNSDDYLKQTNREHANENLELEELEG 569

Query: 671 IYVLKLQNVLFFGTIISIEEKIERLLEISNKD--------STKRRIKYLILDFKNINADN 722
             ++K+   L F     ++E++ RL +  +           ++   +Y+I+D   +   +
Sbjct: 570 CLIVKIPEPLTFTNTEDLKERLNRLEKFGSTRVHPGARGRRSRSSTRYVIIDLHGMT--H 627

Query: 723 IDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVE 770
           +D SAA+    I      + +++ ++ +     +       G+++ VE
Sbjct: 628 MDSSAAQILLEIVSSYRKRDVRVFLARVTIDARVRERLEKSGVVDLVE 675

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 110/548 (20%), Positives = 221/548 (40%), Gaps = 77/548 (14%)

Query: 278 IEITPFYHTMALGIKEALVGSD-----------DEIIT-----TTIFCYVISSMLTGVVF 321
           + ITPF + +   + + +VG +           ++++T      TI   V+ + L+G + 
Sbjct: 132 LAITPFVYCVFGSVPQMIVGPESAISLVVGQAVEKLVTHNEKVGTINISVVVTFLSGAIL 191

Query: 322 YVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF------EYSWPF--V 373
            + G  RLG +     R +L G I  VG  ++I  +    ++ K        Y  PF  V
Sbjct: 192 LIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEKV 251

Query: 374 SGLF----------TNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFI 423
             LF          T   +L  +++ + L  +     + +K+ +  P   IL +V+   I
Sbjct: 252 QFLFKYGPENLHKPTAILSLCSFIILMTLRFLKKKLMKRYKSVIFFPE--ILLIVISSLI 309

Query: 424 VAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFN-IHKVHWTLVLQQIPTMMALTFFG 482
           +++   L  D       I  +    +  +D  KL N + K + +L  + +   +     G
Sbjct: 310 ISVNFNLKKDF-----DISMLGDFSTSGFD--KLNNPLGKDNRSLCHELLSVGLMCAILG 362

Query: 483 ILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGAD 542
                    +L     +     ++EL+A G  N    L G++ ++  Y  S +   +GA 
Sbjct: 363 FFESTTASKSLGTIYDL-TISSNRELVALGSMNLVGSLFGALPSFGGYGRSKINALSGAQ 421

Query: 543 SSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEY- 601
           +  +G  +  +T+  +     +I + P+CI+  +  ++G  LL EA  D    +    Y 
Sbjct: 422 TVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAPSDIRFHIRCHGYN 481

Query: 602 -LTVVIIVFTMGIFDFV-LGIIVGIL--------------IACFSFLVDSTKLQTVNGEY 645
            L +  ++F   I   V  GI VG +              I   + ++ + +   V+G Y
Sbjct: 482 ELIIFTLIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRIQILTRVIGTNQFVPVDGYY 541

Query: 646 NGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEI-SNKDST 704
            G     T+  D  ++  L+ + +   ++K+   L F     ++E++ RL    S +   
Sbjct: 542 PG---LKTI--DLRESSALEELDDSTLIVKIPEPLTFTNTEDLKERLNRLERFRSVRIHP 596

Query: 705 KRR-------IKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIY 757
            RR       IKY+I +   + +  +D SAA+    I +  + + + +    +     I 
Sbjct: 597 GRRPLHNRENIKYVIFELGGMTS--MDSSAAQILKEIIKTYKKRSVNVYFCKVSSNLQIR 654

Query: 758 NAFNNVGL 765
              ++ G+
Sbjct: 655 TRLHDAGI 662

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 108/528 (20%), Positives = 212/528 (40%), Gaps = 80/528 (15%)

Query: 307 IFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF 366
           I   +  ++++G +  + G  RLG +     + +L G IG VG+ +II  +    ++   
Sbjct: 206 ILIVIAVTLISGTILLISGIFRLGYLGNILNKALLHGFIGSVGFVMIIDSLINELKLGDI 265

Query: 367 ------EYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQ----RCFKNSLV-------- 408
                  Y+ PF+  +F        + +P  L   +        R FK  L+        
Sbjct: 266 LADTPEHYNTPFLKIVFLWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHRHRWLIF 325

Query: 409 LPTFYIL--TLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHK--VH 464
           +P   I+  T+++  + +    T  +D L D        S+++  + H  L N ++  +H
Sbjct: 326 IPEILIVLTTVLILSYKLDFADTYDIDILGD------FKSNENSIF-HNPLSNKNRGLIH 378

Query: 465 WTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSV 524
              V+  I  + A+  FG         AL  S +      ++EL+A G SN     LG++
Sbjct: 379 ---VVFNIGIITAI--FGFFESTTASKALGASSER-SVSSNRELVALGLSNIVISTLGAL 432

Query: 525 QNYLVYTNSVLFIRAGADSSFAG-FLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYE 583
            ++  Y  S +   +G  +  +G F+ +   + I+ + PVI  +IP+CI+  +  ++G+ 
Sbjct: 433 PSFGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPVI-HYIPVCILSVITTVIGFT 491

Query: 584 LLVEALVDT---WSKLNRFEYLTVVIIVFTMGIFDFV-LGIIVGILIACFSFLVDSTKLQ 639
           LL E   +    W +   +  L ++++ F   IF  V   + +G + +  + +  S K +
Sbjct: 492 LLEEIPKEVSFHW-RCRGYNELFLIVLTFMTSIFYSVETSMYIGCVYSILNIIKHSAKSR 550

Query: 640 ----------------------TVNGEYNGNVAKSTVYRDYVQTKFLDGI------GEQI 671
                                  +N   N    +S+ YR   +    D         EQ 
Sbjct: 551 IQIYTDAPLITSISNPPSIDNSNINSNNNIKSTRSSDYRPESRRNSADECFRCSLTNEQT 610

Query: 672 YVLKLQNVLFFGTIISIEEKIERLLEISNKDSTKRRI--------KYLILDFKNINADNI 723
            ++K+   L F     ++EK+ R   +    +   +I        KY+I D + +    +
Sbjct: 611 LIVKIPEPLTFTNCEDLKEKLNRFERLGTHTAHPGKILKDTLFQPKYIIFDLQGMTL--M 668

Query: 724 DYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVEL 771
           D SA E    I          +   ++  R++I N     G+++ +EL
Sbjct: 669 DSSATEILKEIVLSYRRSGSHIFFVNVSFRENIRNRIQASGIIDLIEL 716

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/282 (21%), Positives = 116/282 (41%), Gaps = 25/282 (8%)

Query: 505 DKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVI 564
           ++EL++ G  N  S +  ++  +  Y  S + I  GA + F+G  +  L +  M      
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNA 331

Query: 565 ISFIPICIVGSLIFLLGYELLVEALVDT---WSKLNRFEYLTVVIIVFTMGIFDFVLGII 621
              +PICI+  +I  + + LL EA  D    WS     E    +IIV T  ++    G+ 
Sbjct: 332 FHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVT 391

Query: 622 VGILIACFSFLVDSTKLQT-VNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVL 680
           +G+ +     L  ST+ +  + G          +  D      L+ I E++ V+K+   L
Sbjct: 392 MGMCLTMIRLLKHSTRSRVQILGRDPITYTFKNIDDDENSDIPLEEI-EKVMVVKIPEPL 450

Query: 681 FFGTIISIEEKIERLLE-----------------ISNKDSTKRRIKYLILDFKNINADNI 723
            F  +  +   ++R+ +                 +S   S +  +KYL++D   +    I
Sbjct: 451 IFSNVSDLRTSLKRMEKYGSLKVHPSYPLPLRQMLSPTTSGQVSLKYLVIDLFGMT--YI 508

Query: 724 DYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGL 765
           D SA +    I      + I ++ +  K  D + + F   G+
Sbjct: 509 DISALQALREIVDAYSRRNICVMFTRPKIPD-LRHKFRKSGI 549

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 105/556 (18%), Positives = 210/556 (37%), Gaps = 81/556 (14%)

Query: 262 YSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSD-----------------DEIIT 304
           YS   +  P   G   +  TPF + +   +   +VG +                 D+ + 
Sbjct: 105 YSTSVAHVPPICGLNALAFTPFVYAVFGSVPHMIVGPESAISLVVGQAIEKQMKHDKSLD 164

Query: 305 TTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVA 364
               C +++  ++G + +  G +R G +     R +L G I  VG  +++  +    ++ 
Sbjct: 165 VVNLCLILT-FISGAILFCFGIMRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLK 223

Query: 365 KF------EYSWPFVSGLFTNYDTLAKWLLPVLLT------------VVLIGTQRCFKNS 406
           K        Y  PF   +F  +     + +P  L             +V     R +K  
Sbjct: 224 KVFNDAPGHYHAPFQKLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKV 283

Query: 407 LVLPTFYIL----TLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHK 462
           + +P   I+    TL  +HF   +    ++D + D      I   D+  + +     + K
Sbjct: 284 IFVPEILIVVALVTLGSYHFSFKL--RYNIDIVGD------IEVGDTSKFRN----PLSK 331

Query: 463 VHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLG 522
            + +L  +       +   G         +L  S ++     ++EL+A G  N    + G
Sbjct: 332 KNLSLFSELFHAGFMVALLGFFESTTASKSLGSSYELS-VSSNRELVALGSLNLVGSIFG 390

Query: 523 SVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGY 582
           ++ ++  Y  S +   +GA +  +G  +  +T    +     I  IP+C++  +  ++G 
Sbjct: 391 ALPSFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGI 450

Query: 583 ELLVEALVDT---WSKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK-- 637
            L  EA  D    +      E L   + V T   +    GI +G   +    + +STK  
Sbjct: 451 TLFEEAPADLRYHFRCRGYNELLIFALTVLTTFFYSVEAGITLGCGYSVIRVIKNSTKSK 510

Query: 638 ---LQTVNGE---YNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEK 691
              L+ V+G     N +   S+     V    LD I E   ++K+   L F     ++ +
Sbjct: 511 IQILRRVSGTDQFVNADDFNSSTNTCVVIPPRLDDI-EGSLIVKIPERLTFMNTEDLKTR 569

Query: 692 IERLLE--------ISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRI 743
           + RL +         S K   + + K++I D   +    ID SA++    I      + +
Sbjct: 570 LYRLEKYGSVKTHPASPKPRNRNQTKHMIFDMNGMT--EIDSSASQILQEIVLSLRKRGV 627

Query: 744 KL------IISSIKER 753
           ++      +I+ ++ER
Sbjct: 628 RVYLARVPLIAGVRER 643

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 110/557 (19%), Positives = 213/557 (38%), Gaps = 55/557 (9%)

Query: 262 YSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEI----------IT------T 305
           Y+   +  P   G   + I+PF + +   + + +VG +  I          IT      +
Sbjct: 140 YTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKENVS 199

Query: 306 TIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 365
            I    + + ++G +    G  R G +     + +L G I  VG  +II  +    ++ K
Sbjct: 200 LIDISTVITFVSGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDK 259

Query: 366 F------EYSWPFVSGLFTNYDTLAKWLLPVLL----TVVLIGTQRCFKNSLVL--PTFY 413
           F       Y  PF   LF      A++ +P  +     ++++   R  K  L+    +  
Sbjct: 260 FLVSLPQHYHTPFEKILFLIDYAPAQYHIPTAIFSGCCLIVLFLTRLLKRKLMKYHKSAI 319

Query: 414 ILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIP 473
               +L   IV I+ ++  + L+    I  I       +D  K   + +    L+     
Sbjct: 320 FFPDILLVVIVTILISMKFN-LKHRYGISIIGDFSMDNFDELK-NPLTRPRRKLIPDLFS 377

Query: 474 TMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNS 533
             + +   G         +L  +  +     ++EL+A G+ N    L G++  +  Y  S
Sbjct: 378 ASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPAFGGYGRS 436

Query: 534 VLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTW 593
            +   +GA S  +G  +  +T+  M +    + +IP C++  +  ++G  LL E   D  
Sbjct: 437 KINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGDIK 496

Query: 594 SKLN--RFEYLTVVIIVFTMGIF-DFVLGIIVGILIACFSFLVDSTK-----LQTVNGEY 645
             L    F  L V  + F   IF     GI +G + +  + +  S K     L  V G  
Sbjct: 497 FHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILARVAG-- 554

Query: 646 NGNVAKSTVYRDYVQTKFLDGIG----EQIYVLKLQNVLFFGTIISIEEKIERLLEISNK 701
             N      Y   ++   LD  G    E   ++++   L F     ++++++R+    + 
Sbjct: 555 TSNFTNLDDYMMNMKRNSLDVEGTEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIERYGSS 614

Query: 702 D--------STKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKER 753
                     +K  IKY+I D   + +  ID SAA+    I    + + + + + ++   
Sbjct: 615 KIHPGRKSLRSKDSIKYVIFDLGGMTS--IDSSAAQVLEEIITSYKRRNVFIYLVNVSIN 672

Query: 754 DHIYNAFNNVGLLNDVE 770
           D +       G+   VE
Sbjct: 673 DKVRRRLFKAGVAASVE 689

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 122/290 (42%), Gaps = 30/290 (10%)

Query: 502 YDVD----KELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCI 557
           +D+D    +EL++ G  N    +  S+  +  Y  S L I  GA +  AG  +    +  
Sbjct: 343 FDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFC 402

Query: 558 MVIGPVIISFIPICIVGSLIFLLGYELLVEALVDT---WSKLNRFEYLTVVIIVFTMGIF 614
           M     +  ++P+CI+  +I  + Y LL E   D    WS     E +T   +V +  I+
Sbjct: 403 MRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLIW 462

Query: 615 DFVLGIIVGILIACFSFLVDSTKLQ-TVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYV 673
               G+++G+ +     L  +T+ +  + G+         +Y ++ +   L+ I E+  V
Sbjct: 463 SPQFGLVMGLGLTMIRLLKHTTQSRIQILGKDPITKKFRNIYSEHNEEIPLEEI-EKTMV 521

Query: 674 LKLQNVLFFGTIISIEEKIERL-----LEISNKDSTKRR-------------IKYLILDF 715
           +K+   L F  +  + +K++RL     L +     T  R             +KY+I+D 
Sbjct: 522 IKVPEPLVFWNVPDLMKKVKRLEKYGSLYVHPSYPTSLRPVSGVTTLKDNVYVKYIIMDL 581

Query: 716 KNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGL 765
             +    ID SA +    +      + I +I      RD + N F+  G+
Sbjct: 582 --LGMTYIDMSALQALVDMVVNYHKRGIYVIFCRSSIRD-LKNKFDKSGI 628

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 92/204 (45%), Gaps = 9/204 (4%)

Query: 500 DKYDVD----KELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTV 555
           +K+D+D    +EL++ G  N  S +  ++  +  Y  S L I   A +  AG ++    +
Sbjct: 341 EKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAI 400

Query: 556 CIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDT---WSKLNRFEYLTVVIIVFTMG 612
             M        ++P+C++  +I  + Y LL E   D    WS     E LT V +V T  
Sbjct: 401 FCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTL 460

Query: 613 IFDFVLGIIVGILIACFSFLVDSTKLQT-VNGEYNGNVAKSTVYRDYVQTKFLDGIGEQI 671
           ++    G+ +G+ +     L  +T+ +  + G          +Y +  +   L+ I E+ 
Sbjct: 461 VWSPQFGVSIGVGLTMIRLLKHTTQSRVQILGRDPVTKKFQNIYAEQSEQIPLEEI-EKT 519

Query: 672 YVLKLQNVLFFGTIISIEEKIERL 695
            V+K+   L F  +  +++++ RL
Sbjct: 520 MVIKIPEPLIFSNVSDLKKRLSRL 543

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 126/299 (42%), Gaps = 36/299 (12%)

Query: 505 DKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVI 564
           ++ELIA G  N    +   +  +  Y  S +   +GA ++ +GF +  +T+  +     I
Sbjct: 377 NRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPI 436

Query: 565 ISFIPICIVGSLIFLLGYELLVEALVDT---WSKLNRFEYLTVVIIVFTMGIF-DFVLGI 620
           I +IP+CI+  +  ++G  LL EA  D    W +   +  LTV  +     +F     GI
Sbjct: 437 IRYIPVCILSVITTVVGLTLLEEAPHDLKFHW-RCKGYSELTVFTVTLLATLFYSLEAGI 495

Query: 621 IVGILIACFSFLVDSTKLQ-TVNGEYNGNVA--KSTVYRDYVQTKFLDGIGEQI---YVL 674
            +G   +  + +  S K +  + G   G      +  Y+      F++   E+I    ++
Sbjct: 496 YIGCACSIINVIKHSAKSRIQILGRVPGTETFINADDYQANAAGYFINPQIEEIEGFLIV 555

Query: 675 KLQNVLFFGTIISIEEKIERLLE----ISNKDSTKRRIKYL----ILDFKNINADNIDYS 726
           K+   L F     ++ ++ RL +    +++  + + R K +    I D K +   +ID S
Sbjct: 556 KIAEPLTFTNADDLKMRLHRLEKHGSAVTHPAAPRSRRKEMTENVIFDMKGMT--HIDSS 613

Query: 727 AAEGFNRIKRFTETKRIKLIISSIKERD-HIYNAFNNVGLLNDVELFADLNGALEWCEN 784
           AA+                I+S+   RD H++    NV L   V      +G  E CE 
Sbjct: 614 AAQTLEE------------ILSAYNRRDVHVF--LTNVPLTEKVRERLVTSGVAELCER 658

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 87/397 (21%), Positives = 164/397 (41%), Gaps = 50/397 (12%)

Query: 278 IEITPFYHT-------MALGIKEAL---VGSDDEIITT------TIFCYVISSMLTGVVF 321
           + +TPF +        M +G + A+   VG   E +T+      T+    + S ++G+  
Sbjct: 123 LAVTPFIYALFGSVPHMIVGPESAISLVVGQAVETLTSHDLSLETVDIATMISFMSGLTL 182

Query: 322 YVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF------EYSWPFVSG 375
              G  RLG +     + +L G I  +G+ +I+  +    ++ K        Y  PF   
Sbjct: 183 LFGGIFRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKI 242

Query: 376 LF------TNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTL--VLFHFIVAII 427
           LF      +NY     +L   + T ++  T R FK  ++    +I+ +  +L   I +I+
Sbjct: 243 LFLVRYGPSNYHLPTSFLSLAVFTTLM--TIRIFKKKMMRRIKWIVFIPEILSVVIFSIV 300

Query: 428 PTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLV--LQQIPTMMALTFFGILH 485
            +   D L+    I  I   ++  +D ++   + K +  L+  L+ +  + AL  F    
Sbjct: 301 LSYMCD-LKKKYDISVIGDFNTDGFDDFR-NPLSKCNRGLIPALRDVSLVSALLGF---- 354

Query: 486 VPINVPALAMSLQMDKY-----DVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAG 540
               + ++  S  +  Y       ++EL+A G  N      G +  +  Y  S +   +G
Sbjct: 355 ----LESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGGYGRSKINAFSG 410

Query: 541 ADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFE 600
           A +  AG  + ++T+  +     +I +IP C++  +   +G  LL EA  D    +    
Sbjct: 411 AQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEAPHDIKFHIRCKG 470

Query: 601 YLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK 637
           Y  +++ V T     F   I  GIL  C   L+   K
Sbjct: 471 YDELIMFVLTFLCTCF-YSIEFGILAGCTYSLISIVK 506

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 119/281 (42%), Gaps = 22/281 (7%)

Query: 505 DKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVI 564
           ++EL+A G  N  + L G++ ++  Y  S +   +G+ +  +G  + ++T+  +     +
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPL 451

Query: 565 ISFIPICIVGSLIFLLGYELLVEA---LVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGII 621
           I +IP+CI+  +  ++G  LL EA   L   +      E     I V    ++   +GI 
Sbjct: 452 IHYIPLCILSVITSIVGISLLEEAPSELKFHFRCKGYDELFVFAITVLATLLYSVEMGIC 511

Query: 622 VGILIACFSFLVDSTK-----LQTVNGEYN-GNVAK---STVYRDYVQTKFLDGIGEQIY 672
           +G   +  S +  S K     L  V G     N+ +   S    D    KF+    E   
Sbjct: 512 IGCGYSIISIVKHSAKSRIQILGRVQGTREFANIDEYLDSDPIGDIETNKFVLEEIEGCL 571

Query: 673 VLKLQNVLFFGTIISIEEKIERLLEISNKDS--------TKRRIKYLILDFKNINADNID 724
           ++K+   L F     ++E++ RL    +  +        +K   K +I D   + +  ID
Sbjct: 572 IVKIPEPLTFTNTDDLKERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFDLHGMTS--ID 629

Query: 725 YSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGL 765
            SA + F  I    + +++K+ ++ + +   I       G+
Sbjct: 630 SSATQIFFDIVATYKKRKVKVFLARVLQSKQIRERLEKSGV 670

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 60/127 (47%), Gaps = 7/127 (5%)

Query: 505 DKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVIGPVI 564
           ++EL+A G  N  + LLG + ++  Y  S +   +GA +  +G ++  +TV  +      
Sbjct: 428 NRELVALGVMNLTASLLGGLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNY 487

Query: 565 ISFIPICIVGSLIFLLGYELLVEALVDT---WSKLNRFEYLTVVIIVFTMGIFDFVLGII 621
           I FIP C++  +  ++G  L+ EA  +    W    R +    +II F          + 
Sbjct: 488 IHFIPTCVLSVITTIVGLSLIEEAPGEVKFHW----RCKGYNELIIFFMTACGTIFFSVE 543

Query: 622 VGILIAC 628
           VGI+I C
Sbjct: 544 VGIIIGC 550

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 885 ILLFALKQYRPDIVSEVQKVREKEIKFWAQ 914
           +L+  LK Y+PDIVS +Q+V   E+KFW +
Sbjct: 140 VLVHELKTYKPDIVS-LQEVDYNELKFWQE 168

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score = 32.7 bits (73), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 885 ILLFALKQYRPDIVSEVQKVREKEIKFWAQ 914
           +L+  LK+YRPD+VS +Q+V   E+ FW +
Sbjct: 142 VLVHELKKYRPDVVS-LQEVDYNELNFWQE 170

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,819,815
Number of extensions: 4507461
Number of successful extensions: 13069
Number of sequences better than 10.0: 57
Number of HSP's gapped: 13342
Number of HSP's successfully gapped: 71
Length of query: 1037
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 917
Effective length of database: 39,721,479
Effective search space: 36424596243
Effective search space used: 36424596243
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)