Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.4103.483ON57257228660.0
YGR124W (ASN2)3.483ON57257227540.0
Smik_6.2203.483ON57257227510.0
Skud_7.4353.483ON57257227440.0
Suva_16.4743.483ON57257225700.0
CAGL0I10648g3.483ON57457425620.0
YPR145W (ASN1)3.483ON57257225620.0
Smik_16.3963.483ON57257225500.0
Skud_16.4393.483ON57257225380.0
Kpol_480.193.483ON57457225300.0
NDAI0B058103.483ON57757725050.0
NCAS0F035103.483ON57557425050.0
KLLA0B10868g3.483ON57457224960.0
KAFR0G036703.483ON57257224910.0
TDEL0D055203.483ON57357124810.0
SAKL0F02970g3.483ON57357224570.0
KNAG0A079203.483ON57857624550.0
Kwal_55.211873.483ON57357224430.0
TBLA0C044303.483ON58058024340.0
KLTH0F14630g3.483ON57357224290.0
TPHA0D042003.483ON57457324270.0
AFR303W3.483ON57157223900.0
ZYRO0B04136g3.483ON57257223390.0
Ecym_12443.483ON57357223380.0
ZYRO0A00528g8.875ON5121031376e-08
Kpol_455.78.875ON5181051252e-06
TPHA0C049508.875ON525991233e-06
KAFR0L021108.875ON514951214e-06
Skud_7.311singletonON81901095e-06
ADL350C8.875ON508891199e-06
NDAI0K001808.875ON522941181e-05
Skud_13.468.875ON519991181e-05
TDEL0B004408.875ON516941181e-05
KNAG0J002008.875ON5151021171e-05
Suva_13.528.875ON519991134e-05
YML096W8.875ON525951134e-05
SAKL0D00352g8.875ON515871134e-05
NCAS0C001908.875ON5171051117e-05
KLLA0D10285g8.875ON5151131118e-05
TBLA0C063008.875ON518941101e-04
Smik_13.398.875ON521961091e-04
Kwal_27.97058.875ON515991020.001
CAGL0H06963g8.875ON51793990.002
Ecym_81558.875ON513112990.002
KLTH0E16412g8.875ON51595940.009
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.410
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...  1108   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...  1065   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...  1064   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...  1061   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...   994   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...   991   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...   991   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...   986   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...   982   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...   979   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   969   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...   969   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...   966   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...   964   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...   960   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...   951   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...   950   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   945   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   942   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   940   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   939   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   925   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   905   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   905   0.0  
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    57   6e-08
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    53   2e-06
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    52   3e-06
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    51   4e-06
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    47   5e-06
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    50   9e-06
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    50   1e-05
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    50   1e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    50   1e-05
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    50   1e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    48   4e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    48   4e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    48   4e-05
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    47   7e-05
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    47   8e-05
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    47   1e-04
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    47   1e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    44   0.001
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    43   0.002
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    43   0.002
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    41   0.009

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1108 bits (2866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/572 (93%), Positives = 534/572 (93%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300
                                       LAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ
Sbjct: 241 SLIAAIAARETETANVEANEEASAEKSKLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARV 420

Query: 421 PFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480
           PFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ
Sbjct: 421 PFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480

Query: 481 FSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTAA
Sbjct: 481 FSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 541 DTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572
           DTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA
Sbjct: 541 DTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1065 bits (2754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/572 (88%), Positives = 524/572 (91%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHEDI +FKPKALQLSK+IRHRGPDWSGNA+MNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS+DG+YMLGVNGEIYNHIQLRE CSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           AFCLYDSKKDR++AARDPIGVVTLYMGR S+SP+TVYFASELKCLTDVCDSII+FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYFTPDWLDEKR+P+TPVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300
                                       LAGIDDQGHLHTSGWSRLHSFA+GLPNAPDLQ
Sbjct: 241 SLIAAIAARETEKANADANEDNNVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST+AWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420

Query: 421 PFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480
           PFLDKDFLQLCMNIDP +KMI  KEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ
Sbjct: 421 PFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480

Query: 481 FSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWID LRDTAER ISDAMFANPKA WGDDIPTTKEAYWYRLKFDAWFPQKTAA
Sbjct: 481 FSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 541 DTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572
           DTVMRW+PKADWGCAEDPSGRYA+IHEKHV+A
Sbjct: 541 DTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1064 bits (2751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/572 (88%), Positives = 524/572 (91%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKH+DI  FKPKALQLSKRIRHRGPDWSGNA+MNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS+DG+YMLGVNGEIYNHIQLRE+CSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           AFC+YD+KKDR++AARDPIGVVTLYMGR SKSPKTVYFASELKCLTDVCDSIIAFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKR+P+TPVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300
                                       LAGIDDQGHLHTSGWSRLHSFA+GLPNAPDLQ
Sbjct: 241 SLIAAIAARETEKANADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST+AWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420

Query: 421 PFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480
           PFLDKDFLQLCMNIDPKDKMI  KEG+IEKYILRKAFDTT+EPDVKPYLPEEILWRQKEQ
Sbjct: 421 PFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKEQ 480

Query: 481 FSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWID LRDTAERVISD MFANPKA WGDDIPTTKEAYWYRLKFDAWFPQKTAA
Sbjct: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 541 DTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572
           +TVMRWVPKADWGCAEDPSGRYA+IHEKHV A
Sbjct: 541 NTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1061 bits (2744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/572 (88%), Positives = 523/572 (91%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHEDI  FKPKALQLSKRIRHRGPDWSGNA+MNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PI S+DG+YMLGVNGEIYNHIQLRE+CS YKFQTFSDCEPIIPLYLEHDIDAPK+LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           AFCLYD+KKDRV+AARDPIGVVTLYMGR SKSPKTVYFASELKCLTDVCDSII+FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYFTP+WLDEKR+P+ PVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300
                                       LAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ
Sbjct: 241 SLIAAIAARETEKANADADGDASVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST+AWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420

Query: 421 PFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480
           PFLD+DFLQLCMNIDPKDKMIN KEGRIEKYILRKAFDTTDEP+VKPYLPEEILWRQKEQ
Sbjct: 421 PFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKEQ 480

Query: 481 FSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWID LRDTAERVISD MFANPKA WG+DIPTTKEAYWYRLKFDAWFPQKTAA
Sbjct: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 541 DTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572
           DTVMRWVPKADWGCAEDPSGRYA+IHEKHV+A
Sbjct: 541 DTVMRWVPKADWGCAEDPSGRYAKIHEKHVSA 572

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/572 (82%), Positives = 506/572 (88%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHED+  +KPKALQLSKRIRHRGPDWSGNA+ NSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS D DYML VNGEIYNHIQLRE+C DY+F+T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ LYD+K+DR+IAARDPIG+ TLYMGR S SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKR+P+TP+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXX-XXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        LAG+DD+G+LHT+GW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST+AWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMNIDP +KMI  KEGRIEKYILRKAFDTTDEP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDSL+DTAE VISD MFANPKA WG+DIPTTKEAYWYRLKFD  FPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           ADTVMRWVPKADWGCAEDPSGRYAQIHEKH++
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score =  991 bits (2562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/574 (81%), Positives = 502/574 (87%), Gaps = 2/574 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KH+D+  FKPKALQLSKRIRHRGPDWSGN + NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS DGDY L VNGEIYNHIQLREQ  DYKF+T SDCEPIIP YLEHDIDAPKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+CLYD+K+DR++AARDP+G+ TLYMGRCS SPKTV+FASELKCLTD CD I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXX--XXX 238
           YDS+TD+ITRYFTPDW+DE R+PTTPV+++ IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 239 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPD 298
                                         LAGID+QGHLHT+GWSRLHSFA+GLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358
           LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEA 418
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESV+RVKNLHLADCLRANKST+AWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 419 RVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQK 478
           RVPFLDK+FLQLCMNIDPKDKMI+   GRIEKYILRKAFDT+DEPDVKPYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 479 EQFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKT 538
           EQFSDGVGYSWID L+DTAERVISD MF+NPK  WG+DIPTTKEAYWYRLKFDA FPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 539 AADTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572
           AA TVMRW+PKADWGCAEDPSGRYA+IHE+HV A
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHVTA 574

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  991 bits (2562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/572 (82%), Positives = 504/572 (88%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+HED+  +KPKALQLSKRIRHRGPDWSGNAI NSTIFVHERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITSSDG+YML VNGEIYNHIQLRE+C+DY+F T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ LYD+K+DR++AARDPIG+ TLYMGR S SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKR+P+TP+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXX-XXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        LAGIDD G LHT+GW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST+AWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMNIDP +KMI  KEGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+DTAE VISD MFA+PKA WG DIPTTKEA+WYRLKFDA FPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           ADTVMRW+PKADWGCAEDPSGRYAQIHEKH+ 
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/572 (81%), Positives = 503/572 (87%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHED+ ++KPKALQLSKRIRHRGPDWSGNAI NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS D DYML VNGEIYNHIQLRE+C +Y+F+T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ LYD+K+DR++AARDPIG+ TLYMGR S SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKR+P+TP+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXX-XXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        LAG+DD G LHT+GW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST+AWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLDK+FLQLCMNIDP +KMI  KEGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+DTAE VISD MFA+PKA WG DIP+TKEA+WYRLKFDA FPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           ADTVMRW+PKADWGCAEDPSGRYAQIHEKH++
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/572 (81%), Positives = 502/572 (87%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KHED+  +K KALQLSKRIRHRGPDWSGNA  NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS D DYML VNGEIYNHIQLRE+C DY+F+T SDCEPIIP+YL+HDI+APKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ LYD+K+DR++AARDPIG+ TLYMGR S SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKR+P+TP+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXX-XXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        LAG+DD G+LHT+GW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST+AWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMNIDPK+KMI +KEGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDSL+D AE VISD MFA+PKA WG DIPTTKEA+WYRLKFDA FPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           ADTVMRWVPKADWGCAEDPSGRYAQIHEKH+ 
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/572 (81%), Positives = 503/572 (87%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KHE+ E FKP+ALQLSKRIRHRGPDWSGN + NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  GDY+L VNGEIYNHIQLRE C DYK++T SDCEPIIPLYL+HDIDAPKYLDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+CLYD+KKDR+IAARDPIG+ TLYMGR SKSPKTV+FASELKCLTD CDSI+AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF+PDW+DE+R+PT PV Y+AIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXX-XXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        L GIDDQG+LHT+GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
            AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKST++WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMNIDP +KMIN+ EGRIEKYILRKAFDT+DEPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+DTAERVISD +F+ PK  WG DIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           A+TVMRW+PKADWGCAEDPSGRYA+IHE+H+ 
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHIG 572

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/577 (79%), Positives = 496/577 (85%), Gaps = 5/577 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHED+  FKP+ALQLSKRIRHRGPDWSGN I N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G+Y L VNGEIYNHIQ+REQ  DY F+T SDCEPIIPLYL+HDID PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+CLYDSK+DR+IAARDPIG+ TLYMGR SK+P+TV+FASELKCLTD CDSIIAFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXX----- 235
           YDS+TD+ITRYFTPDWLDE+R+P   +D  AIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 236 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPN 295
                                            L G+DD+GHLH  GWS+LHSFA+GLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWG 415
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKST+AWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 416 LEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 475
           LEARVPFLD+DFLQLCMNIDPK+KMIN  EGRIEKYILRKAFDT+D+P+ KPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 476 RQKEQFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFP 535
           RQKEQFSDGVGYSWID L+DTAERVISDAMF NPK  WG DIPTTKEAYWYRLKFDA +P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 536 QKTAADTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572
           QKTAADTVMRW+PKADWGCAEDPSGRYA+IHEKHVNA
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/574 (78%), Positives = 504/574 (87%), Gaps = 2/574 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+HED++ +KPKALQL+KRIRHRGPDWSGN + N+TI  HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G+Y L VNGEIYNHIQ+RE+C+DY+F+T SDCEPIIPLYL++D+DAPK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+CLYD+K+DR++AARDPIG+ TLYMGR SK+P+TVYFASELKCLTD CDSI+AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXX--X 238
           YDS TD+ITRYF PDWLDE R+P+TPVD +AIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 239 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPD 298
                                         L G+DD+GHLHT GWSRLHSFA+GLPNAPD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358
           LQAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEA 418
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKST+AWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 419 RVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQK 478
           RVPFLDK+FLQLCMNIDPKDKMI+   G+IEKYILRKAFDTTD+P+ KPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 479 EQFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKT 538
           EQFSDGVGYSWID L+DTAERVISDAMF NPK  WG+D+PTTKEAYWYRLKFDA +PQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 539 AADTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572
           AADTVMRW+PKADWGCAEDPSGRYA+IHEKHV+ 
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDG 574

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/572 (80%), Positives = 495/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA+F++ D++ +KPKALQLSKRIRHRGPDWSGN + NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS DG Y L VNGEIYNHI LRE+C+ Y F+T SDCEPIIPLY ++DIDAPK+LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+CLYDSKKDR+IAARDPIG+ TLYMGR S SPK+V+F+SELKCLTD CD IIAFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDK+TRYFTPDWLDE R+PTTPVD++A+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXX-XXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        LAG+D+QGHLH +GWSRLHSFAVGLPNAPDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD+DFLQLCMNIDP DKMI   EG+IEKYILRKAFDTTDEPD+KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+D AE  ISD  FA PKA WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           A TVMRW+PKADWGCAEDPSGRYA+IHE+HV+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score =  964 bits (2491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/572 (80%), Positives = 493/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+HED+  FK KALQLSKRIRHRGPDWSGN + NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G+Y L VNGEIYNHIQLREQ  DYKF+T SDCEPIIPLYL  DIDAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ LYDSKKDR++AARDPIGV TLYMGR S SPKTV+FASELKCL D CDSI+AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYFTP+W+DE ++PTTPVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXX-XXXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        LAGIDD+GHL TSGWSRLHSFA+GLP APDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
            AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FL LCMNIDP DK+IN KEGRIEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+DTAE+VISD MFANPK+ WG DIPTTKEAYWYRLKFDA FPQ TA
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           A+TVMRW+PKADWGCAEDPSGRYAQIHEKH+ 
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score =  960 bits (2481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/571 (79%), Positives = 502/571 (87%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA KHED++ +K KALQLSKRIRHRGPDWSGN + N+T+ VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G+Y L VNGEIYNHI+LRE+ SDYKF T SDCEPIIPLY ++DID PKYLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+CLYD+K+DR+IAARDP+G+ TLYMGR S SPKTV+FASELKCLTD CD+I+AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDE R+P+ PVDY+AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXX-XXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        LAGIDD G+LH++GWSRLHSFA+GLP APDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           +AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMNIDPKDKMIN +EGR+EKYILRKAFDTTDEPDVKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+DTAERVISD +FA PK++WGDD+PTTKEA+WYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHV 570
           ADTVMRWVPKADWGCAEDPSGR+AQIH++HV
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/572 (78%), Positives = 487/572 (85%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA +KHE +++FKPKALQLSKRIRHRGPDWSGN + N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS DGDY L VNGEIYNHI+LRE+ + Y F+T SDCEPIIPLY ++DID PKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+CLYD+KKDR+IAARDPIG+ TLYMGR S SP TV+FASELKCL D CD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+R+P TP+DY+ IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXX-XXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        LAG+DD+G+LH +GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD+DFL +CMNIDP +KMIN  EGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+D AE  ISD  FA PK  WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           A TVMRW+PKADWGCAEDPSGRYA+IHE+H+ 
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQ 572

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score =  950 bits (2455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/576 (78%), Positives = 498/576 (86%), Gaps = 5/576 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA F+HED++ FKP+ALQLSKRIRHRGPDWSGN I NSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  GDY+L VNGEIYNHIQLRE+C +Y++++ SDCEPIIP+YL++D+DAPK+LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+CLYD+KKDR++AARDPIG+ TLYMGR S  PKTV+FASELKCLTD CD+IIAFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRY+TP+WLDE ++P+TPVD + IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXX-----XXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPN 295
                                            LAGIDD+G+L ++ WSRLHSFA+GLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWG 415
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKST+AWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 416 LEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 475
           LEARVPFLDK+FL LCMNIDPKDK+IN KEGRIEKYILRKAFDT DEPDVKPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 476 RQKEQFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFP 535
           RQKEQFSDGVGYSWID L+DTAE VISD MFA PKA WG D+PTTKEA+WYRLKFDA FP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 536 QKTAADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           Q TAA+TVMRW+PKADWGCAEDPSGR+A+IHE+HV 
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/572 (78%), Positives = 490/572 (85%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIF  F+HED++ FKP ALQL+KRIRHRGPDWSGN I NST+  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           P+ S + DY+L VNGEIYNHIQLRE+ SDY F+T SDCEPIIPLY ++ IDAPKYLDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ LYD+KKDR+IAARDPIG+ TLYMGR SKSPKTVYFASELKCLTD CDSIIAFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRY+TP+WLDE R+P+ P+D   IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXX-XXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        LAG+DD G LH++GWSRLHSFAVGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           +AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FL LCMN+DPK+KMIN  EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+DTAE  ISD  F  PKA WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           A TVMRW+PKADWGCAEDPSGRYA+IH++H++
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHIS 572

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  942 bits (2434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/580 (76%), Positives = 489/580 (84%), Gaps = 8/580 (1%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KH ++  FKP+ALQL+KRIRHRGPDWSGN + N+T+F HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G+YML VNGEIYNHIQLRE+ +DYK++T  DCEPIIP+YL++D+DAP +LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           AF LYDS+KDRVIAARDP+G+ TLYMGR SK+PKTVYFASELKCL D CDSIIAFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYX--------X 232
           YDSETDKI RYF P+W+DE  +PTTPVD + +R +LE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 233 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVG 292
                                               L G+DD G+L T  WS+LHSFA+G
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 293 LPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 352
           LP APDL+AARKVA FIGSIHHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 353 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTL 412
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLAD LRANKST+
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 413 AWGLEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEE 472
           AWGLEARVPFLD+DFL LCMNIDP DKMI  KEG+IEKY+LRKAFDT+DEPDVKPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 473 ILWRQKEQFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDA 532
           ILWRQKEQFSDGVGYSWIDSL+DTAERVISD MFANPK  WG DIPTTKEAYWYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 533 WFPQKTAADTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572
            FPQKTAADTVMRW+PKADWGCAEDPSGRYA+IHE+H++ 
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHIDG 580

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/572 (77%), Positives = 486/572 (84%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIF  F+H+ +E+FKP AL+L KRIRHRGPDWSGN I NST+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           P  S D +Y+LGVNGE+YNHIQLRE+ S Y F+T SDCEPIIPLY ++ IDAPKYLDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ LYD+KKDR++AARDPIG+ TLYMGR SKSPKTVYFASELKCLTD CDSIIAFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF PDW+DE R+P+ P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXX-XXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        LAG+DD G+L ++GWS LHSFA+GLPNAPDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMN+DPK+KMIN+ EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+D AE  ISD  F  PKA WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           A TVMRW+PKADWGCAEDPSGRYA+IHE+H++
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/573 (77%), Positives = 488/573 (85%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIF  +KHE+ E FKP+ALQLSKRIRHRGPDWSGN + NSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS DGD++L VNGEIYNHIQ+REQ  DY+F+T SDCEPIIPLY+++  +APK+LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ LYD+K+DR+IAARDPIG+ TLYMGR SKSPKTVYFASELKCLTD CDSI+AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXX-X 239
           YDS TD+ITRY+TPDW+DE R+   P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 240 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        L GIDD G+L +SGWSRLHSFA+GLP APDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
            AA+KVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKST+AWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FL LCMNIDP +KMIN KEGRIEKYILRKAFDTTDEP+ KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+DTAERVISD +F NP+  WG DIPTTKEAYWYRLKFDA FPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+H+ A
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIGA 573

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  925 bits (2390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/572 (75%), Positives = 487/572 (85%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA ++ +DIE FKP AL+LSKR+RHRGPDWSGN I N TI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PI S DG+Y+L VNGEIYNHI LRE+CSDY+F + SDCEPIIPLYL++D++ P++LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+CLYD ++DR++AARDPIGV TLYMG+ S SP+T YFASELKCL D CD I AFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYF PDW+DE R+P+ PVDY+A+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300
                                       LAG+DD+G LHT GWSRLHSFA+GLPNAPDLQ
Sbjct: 241 SLIASIAARETERANREAGDVYADGKH-LAGMDDRGLLHTGGWSRLHSFAIGLPNAPDLQ 299

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 300 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQGV 359

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKST+AWGLEARV
Sbjct: 360 KMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARV 419

Query: 421 PFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480
           PFLD++FLQLCMNIDP +KMI  ++GRIEKYILRKAFDT+DEP V PYLPEEILWRQKEQ
Sbjct: 420 PFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKEQ 479

Query: 481 FSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWID L+D AER ISD  FANP  +WGDDIPTTKEA+WYRLKFDA FPQ TAA
Sbjct: 480 FSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTAA 539

Query: 541 DTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572
            TVMRWVPKADWGCAEDPSGRYA+IH++H+++
Sbjct: 540 ATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/572 (74%), Positives = 479/572 (83%), Gaps = 2/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+H D+++++P ALQLSKRIRHRGPDWSGN + NSTI VHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PI S  G+Y L VNGEIYNHIQLRE+CSDY FQ+ SDCEPIIPLYL++ +DAPK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+CLYDSK+DR++AARDPIG+ TLYMG+ SKSPKT +FASELKCL D CD I+AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D+ITRYF P WLDE  +P+TP+DY+ +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXX-XXXXXXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        LAGID QG+LHT GWSRLHSFA+GLP APDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
            AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD+DFL LCM +DP +KMI  +EGRIEKYILRKAFDTTDEP+VKPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+D AE  ISD M A P+  WGDD PTTKEAYWYRLKFD +FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           A+TVMRW+PKADWGC  DPSGR+A+IHE+H++
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/572 (73%), Positives = 478/572 (83%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA ++ + IE FKP ALQLSKRIRHRGPDWSGN + N TIFVHERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PI S DG+Y+L VNGEIYNHI LR+ C+DY F T SDCEPIIPL+ ++ ++ P YLDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+CLYD+K DR++AARDPIGV TLYMG+CSKSP+T YFASELKCL + CD II+FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF P WL +   PT PVDY+ +R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXX-XXXXXLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299
                                        L G+DD+ HLH SGWS+LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGSIHHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419
           +KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD+DFL+LCMNIDP++KMI  KEG+IEKYILRKAFDT+DEPDV+PYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID+L+D AE  ISD  FA PK  WGDDIP+TKEAYWYR+KFDA FPQ TA
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571
           A TVMRWVPKA+WGC+EDPSGR+A+IHEKH++
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHIS 572

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 353 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTL 412
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 413 AWGLEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRK 455
           A G+E R PFLD+  ++  M   P    IN K   I K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQSIP----INWK---INKLILRK 471

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 77/174 (44%), Gaps = 32/174 (18%)

Query: 67  GD-YMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHD----IDAPKYLDGMFA 121
           GD Y+L  NGE+YN   L    S             +   LE+D     +   +L+G FA
Sbjct: 85  GDRYILQFNGELYNEEILDNDTS------------FVASLLENDKMSVFEVISFLEGEFA 132

Query: 122 FCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFAS---ELKCLTDVCDSIIAFPPG 178
           + +YD  + ++   RD IG  +L   R  ++   +Y AS   + +  TD    I+     
Sbjct: 133 YTIYDMHEHKLYFGRDDIGKRSLSY-RLDQAIGDIYVASVTGQQEGFTDCLAGIV----- 186

Query: 179 HVYDSETDKITRYFTPDWLDEKRVPTTPV----DYRAIRHSLEKAVRKRLMAEV 228
           ++YD E   + +   P  +  + V +  +    +++ I H+L + ++  ++  V
Sbjct: 187 YIYDVEDKSLNQQMLP--ILNREVSSEIIEDEDEFQRITHALYEQLKSAIVKRV 238

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 7/105 (6%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARVP 421
           ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFANK-SIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 422 FLDKDFLQLCMNIDPKDKMINSKEGR---IEKYILRKAFDTTDEP 463
           FLD++ +Q  ++  P    +N    R   +EK  LR   D   EP
Sbjct: 450 FLDEEVIQYSVSQIPISYKVNKGILRKLALEKLQLR---DIAQEP 491

 Score = 37.7 bits (86), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 77/187 (41%), Gaps = 36/187 (19%)

Query: 60  QPITSS----DGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKY 115
           QP T      D  Y+L  NGE+YN  ++    + Y       C+  +       +   + 
Sbjct: 79  QPFTRQSIVVDERYVLQFNGELYNS-EISGNDTQYIVSLLKSCDGDV-------VSLVRK 130

Query: 116 LDGMFAFCLYDSKKDRVIAARDPIGVVTL------YMGRCSKSPKTVYFASELKCLTDVC 169
           LDG FA+ +YD K+  +   RD IG  +L        G    S  T    + + CL  V 
Sbjct: 131 LDGGFAYTIYDLKEGNIYFGRDTIGKRSLCYSIDENSGELFISSVTGTRGTFVDCLGGVI 190

Query: 170 DSIIAFPPGHVYDSET-----DKITR--YFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRK 222
                    + YD++T      K+ R  Y   D  DE    +  ++   +  +L ++V+K
Sbjct: 191 ---------YTYDTKTHTLDDTKVIRDKYVVTDMTDELENESQYME--LLYGTLYESVKK 239

Query: 223 RLMAEVP 229
           R+++  P
Sbjct: 240 RVLSIHP 246

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (54%), Gaps = 9/99 (9%)

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWG 415
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 416 LEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILR 454
           +E R PFLD    +  +N   K+  IN K   I K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKEIPINYK---INKKILR 477

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 7/77 (9%)

Query: 69  YMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDI-DAPKYLDGMFAFCLYDS 127
           Y+L  NGE+YN+       SD  +  F +C  +     E DI +  + L+G FA+ ++DS
Sbjct: 89  YILQFNGELYNN--EIHGISDTTY--FVNC--LKTALDEKDIINILRTLEGEFAYTIFDS 142

Query: 128 KKDRVIAARDPIGVVTL 144
           KK  V   RD IG  +L
Sbjct: 143 KKKLVYFGRDTIGKRSL 159

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARVP 421
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 422 FLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKA 456
           FLD + +Q      P    IN K   + K ILRK 
Sbjct: 447 FLDHNVVQFSTQEIP----INYK---VNKLILRKV 474

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 65/140 (46%), Gaps = 21/140 (15%)

Query: 27  IRHRGPDWSGNAIMNS--TIFVHERLAIVGLDSGAQPITSSDGDYMLGVNGEIYNHIQLR 84
           I +RGP++S   +     T +    LA+  L    Q +   D  Y+L  NGE+YN  +++
Sbjct: 46  IANRGPNYSSLRLSEKYHTAWFSSVLAL-RLPFTKQSLCVED-RYVLQFNGELYNK-EIK 102

Query: 85  EQCSDYKF--QTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCLYDSKKDRVIAARDPIGVV 142
           +  +D +F     S    +I    +        LDG FA+ +YD ++ ++   RD IG  
Sbjct: 103 QDQNDTQFIASLLSSSTDVIHTLTQ--------LDGEFAYTIYDLRETKIYFGRDSIGKR 154

Query: 143 TLYMGRCSKSPKT--VYFAS 160
           +L    C K   T  +Y AS
Sbjct: 155 SL----CFKMDTTNGLYVAS 170

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 32/90 (35%), Positives = 42/90 (46%), Gaps = 16/90 (17%)

Query: 102 IPLYLEHDIDAPKYLDGMFAFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASE 161
           +P YLE DIDAPK+L+ MFAF     +K              ++ G CS      +F   
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCCCC--------KIFYG-CSFLMHRTFFQVS 51

Query: 162 LKC-------LTDVCDSIIAFPPGHVYDSE 184
             C       LT  CD+  +F PG V+DSE
Sbjct: 52  KDCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 4/89 (4%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARVP 421
           ++ +G G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 422 FLDKDFLQLCMNID---PKDKMINSKEGR 447
           FLD+  ++  + +      DKMI  K  R
Sbjct: 441 FLDEKVIKASVALPISYKNDKMILRKLAR 469

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARVP 421
           ++ SG G+DE++GGY  FA   S  E   E  +++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 422 FLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRK 455
           FLD D ++      P    IN K   I K ILRK
Sbjct: 455 FLDIDVIKFSTEELP----INYK---INKLILRK 481

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 78/170 (45%), Gaps = 23/170 (13%)

Query: 69  YMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCLYDSK 128
           Y++  NGE+YN  +++   + Y  Q   + + II        D  + LDG FA+ +YD +
Sbjct: 91  YVVQFNGELYND-EIQYNDTQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQ 141

Query: 129 KDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHVY------- 181
                  RDPIG   L     +++ + +Y +S   C T   D I     G +Y       
Sbjct: 142 NRMFYFGRDPIGRRCLSFSIDNETGE-LYISSVTGCKTGFQDCI----AGTIYKYDCQLK 196

Query: 182 DSETD-KITR-YFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVP 229
           +  TD KI++ ++  + LD++ +     +   +   L  +V KR+++  P
Sbjct: 197 ELNTDSKISKPFYVSEELDDENLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (54%), Gaps = 9/99 (9%)

Query: 358 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLE 417
           QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 418 ARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKA 456
            R PFLD    +  +N+   +  IN K   + K ILRK 
Sbjct: 448 VRYPFLD----EYVINLSTLEIPINYK---VNKLILRKV 479

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQPITSS----DGDYMLGVNGEIYNHIQ 82
           I  RGP++S   ++ +    H+      + S  +P T      D  Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRVIKA----HQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN--- 99

Query: 83  LREQCSDYKFQTFSDCEPIIPLYLEHDI-DAPKYLDGMFAFCLYDSKKDRVIAARDPIGV 141
             ++ SD+   +      +  L    ++ D  + L+G +A+ +YD K       RDPIG 
Sbjct: 100 --KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 VTL 144
            +L
Sbjct: 158 RSL 160

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARVP 421
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 422 FLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRK 455
           FLD D ++      P    IN K   + K ILR+
Sbjct: 449 FLDHDVIKFSTEEIP----INYK---VNKMILRR 475

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 104/263 (39%), Gaps = 51/263 (19%)

Query: 1   MCGIFA----------AFKHEDIEDFKPKALQLSKR----------IRHRGPDWSGNAIM 40
           MCGI             F  E +ED      Q SK           I+ RGPD+S   + 
Sbjct: 1   MCGILLHYAPLKSDNHCFVDEYVEDIADGHSQRSKTTAFFDSMVPYIKSRGPDYSSLRVS 60

Query: 41  NSTIFVHERLAIVGLDSGAQPITSSD----GDYMLGVNGEIYNHIQLREQCSDYKFQTFS 96
           +     H       + S  +P TS        ++L  NGE+YN  ++    +D +F    
Sbjct: 61  SE----HSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYNQ-EITAHDNDTQF---- 111

Query: 97  DCEPIIPLYLE--HDI-DAPKYLDGMFAFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSP 153
               I+    E  HD+    + L G FA+ LYD ++ +    RD +G  +L     S   
Sbjct: 112 ----IVSKLQEGYHDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDNVGKRSLSY-HLSAIT 166

Query: 154 KTVYFASELKCLTDVCDSIIAFPPGHVYDSETDKI-------TRYFTPDWLDEKRVPTTP 206
             +Y +S    +    D I      +VYD+E+  +       ++YF    LDE+ +    
Sbjct: 167 GELYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLESQYFITKKLDEE-LTCLD 223

Query: 207 VDYRAIRHSLEKAVRKRLMAEVP 229
                +   L  AVRKR+++  P
Sbjct: 224 STVEQLYGMLSLAVRKRVLSIHP 246

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 53/102 (51%), Gaps = 9/102 (8%)

Query: 354 KIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTL 412
           KI  Q   +VL SG G+DE++GGY  FA   S  +   E  +++ N+H  +  R +K   
Sbjct: 380 KIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIA 438

Query: 413 AWGLEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILR 454
           + G+E R PFLD   ++       +D  IN K   I K ILR
Sbjct: 439 SNGVEIRYPFLDSSVVKFST----EDLPINYK---INKLILR 473

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 57/125 (45%), Gaps = 22/125 (17%)

Query: 27  IRHRGPD---WSGNAIMNSTIFVHERLAIVGLDSGAQPITSS----DGDYMLGVNGEIYN 79
           I  RGP+   W G+A  ++  F     +++ L    QP T      DG Y+L  NGE+YN
Sbjct: 47  IAARGPNFASWRGSAEYSTAWFS----SVLSL---RQPFTKQSLVVDGRYVLQFNGELYN 99

Query: 80  HIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCLYDSKKDRVIAARDPI 139
             ++    + Y     +  E  IP       D    LDG FA+ +YD++  +    RD I
Sbjct: 100 D-EIEFNDTQYIADMLARGEASIP-------DIIARLDGEFAYTIYDTEDQKYYFGRDAI 151

Query: 140 GVVTL 144
           G  +L
Sbjct: 152 GKRSL 156

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 51/99 (51%), Gaps = 9/99 (9%)

Query: 358 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLE 417
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 418 ARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKA 456
            R PFLD+  ++        D  IN K   I K ILR  
Sbjct: 448 VRYPFLDEHVIKFSA----VDIPINFK---INKLILRNV 479

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 74/169 (43%), Gaps = 30/169 (17%)

Query: 27  IRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQPIT----SSDGDYMLGVNGEIYNHIQ 82
           I  RGP++S   +  +    ++      + S  QP T    S D  Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRVSKA----YQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYN--- 99

Query: 83  LREQCSDYKFQTFSDCEPIIPLY--LEHD---IDAPKYLDGMFAFCLYDSKKDRVIAARD 137
             ++ SD      +D + I  L   L  D   ID  + L+G +A+ +YD K  +    RD
Sbjct: 100 --KEISDDD----NDSQYIASLLQNLTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRD 153

Query: 138 PIGVVTLYMGRCSKSPKT-VYFASELKCLTDVCDSIIAFPPGHVYDSET 185
           PIG  +L     S +P   +Y AS    +    D I     G VY+ +T
Sbjct: 154 PIGRRSL---SYSVTPNNELYVASATGAIEGFQDCI----GGIVYEYDT 195

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 8/95 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARVP 421
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 422 FLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKA 456
           FLD+  ++L     P    IN K   + K ILRK 
Sbjct: 452 FLDEYVIKLSTAEIP----INFK---VNKLILRKV 479

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 10/90 (11%)

Query: 60  QPIT----SSDGDYMLGVNGEIYN-HIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPK 114
           QP T    + D  Y L  NGE+YN  I   +  S Y      + +  + +     ID  K
Sbjct: 76  QPFTKQSINVDDRYFLQFNGELYNKEISQGDNDSLYIASMLQNLKEGMGV-----IDVIK 130

Query: 115 YLDGMFAFCLYDSKKDRVIAARDPIGVVTL 144
            L+G +A+ +YD    ++   RDPIG  +L
Sbjct: 131 SLEGEYAYTIYDVNSSKLYFGRDPIGRRSL 160

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 3/87 (3%)

Query: 358 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLE 417
           +GV ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 418 ARVPFLDKDFLQLCMNIDPKDKMINSK 444
            R PFLD+  +Q    + P +  +N K
Sbjct: 445 VRYPFLDEKVVQFSTEL-PINYKVNKK 470

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 9/105 (8%)

Query: 351 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKS 410
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +   E  +++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 411 TLAWGLEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRK 455
               G+E R PFLD++ ++      P    IN K   + K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFSTMEIP----INYK---VNKMILRK 475

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 69  YMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCLYDSK 128
           Y+L  NGE+YNH ++    + Y      +  P IP  +       K L+G FA+ +YD +
Sbjct: 90  YVLQFNGELYNH-EIVHNDTQYIVGLLKESAPSIPAII-------KKLNGEFAYSIYDIQ 141

Query: 129 KDRVIAARDPIGVVTL 144
                  RD +G  +L
Sbjct: 142 NGTFYFGRDTVGKRSL 157

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 59/113 (52%), Gaps = 5/113 (4%)

Query: 352 SRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST 411
           S+     G+ M  SG G+DE++GGY  F+   S  E   E  +++  +H  +  R +K  
Sbjct: 381 SKPYNRSGIVM-FSGLGADELYGGYHKFSNK-SNEELVIELQKQIAQIHDRNLNRDDKVI 438

Query: 412 LAWGLEARVPFLDKDFLQLCMNIDPKDKMINSKEGRI-EKYILRKAFDTTDEP 463
              G+E R PFLD+  +Q  +++ P +  +N    R+  K ILR  F  ++EP
Sbjct: 439 SNHGIEVRYPFLDERVVQFSVDL-PLNYKVNKHILRVMAKDILRLDF-ISEEP 489

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 73/171 (42%), Gaps = 39/171 (22%)

Query: 1   MCGIFAAFKH-------EDIEDFKPKAL--------------QLSKRIRHRGPDWSGN-- 37
           MCGI A F         ++ ++   K L              +L   I  RGP+++    
Sbjct: 1   MCGILAYFGKSFGSTLTDEFQELYEKDLTGPIQSCNSNTLFNELIPYIVRRGPNYASLRS 60

Query: 38  -AIMNSTIFVHERLAIVGLDS--GAQPITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQT 94
            + +N+ +F     +++ L +    Q +   D  Y+L  NGE+YN   + E C       
Sbjct: 61  LSEINAMLFS----SVLSLRTPFTKQSVMVQD-RYLLQYNGELYNDDTV-ENCEH----- 109

Query: 95  FSDCEPIIPLYLEHDID-APKYLDGMFAFCLYDSKKDRVIAARDPIGVVTL 144
            SD E I  L  +H ++   +   G FA+ + D ++ +V   RD IG  +L
Sbjct: 110 -SDTEYISSLLEKHSVEEVVRKCYGEFAYAITDLQERKVYFGRDSIGKRSL 159

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARVP 421
           ++ SG G+DE++GGY  F    +  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 422 FLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRK 455
           FLD+  ++   +  P    IN K   I K ILRK
Sbjct: 451 FLDEHVIKYSTHDIP----INYK---INKLILRK 477

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 70/172 (40%), Gaps = 40/172 (23%)

Query: 1   MCGIFA--------AFKHEDIEDFK---PKAL----------QLSKRIRHRGPDWSG-NA 38
           MCGI           F   + ++FK   P AL           L K I  RGP+++    
Sbjct: 1   MCGILLNISPNDNLKFFQNEYKEFKENCPDALLNSNNDYTFSNLMKLISARGPNFASLRT 60

Query: 39  IMNSTIFVHERLAIVGLDSGAQPITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDC 98
           + +  I +   +  +      Q +   D  Y+L  NGE+YN   +            +D 
Sbjct: 61  LKDHRISLFSSVLSLREPFCKQSVLVED-RYVLQFNGELYNDEIIH-----------NDT 108

Query: 99  EPIIPLYLEHD------IDAPKYLDGMFAFCLYDSKKDRVIAARDPIGVVTL 144
           + I+ L L  +      I   K LDG FAF +YD K  R+   RDPIG  +L
Sbjct: 109 QFIVKLLLNTEQNSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRDPIGKRSL 160

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 10/96 (10%)

Query: 362 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARV 420
           ++LSG G+DE++GGY  FA +AP   E   E  +++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 421 PFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKA 456
           PFLD+  ++      P    IN K   + K ILRK 
Sbjct: 451 PFLDEYVIKFSTVEIP----INYK---VNKLILRKV 479

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 90/216 (41%), Gaps = 38/216 (17%)

Query: 27  IRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQPIT----SSDGDYMLGVNGEIYN-HI 81
           I  RGP++S       T+  +       + S  +P T    + D  Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSL----RTVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYNKEV 102

Query: 82  QLREQCSDYKFQTFSDCEPIIPLYLEHD---IDAPKYLDGMFAFCLYDSKKDRVIAARDP 138
                 S Y      D        LE D   ID  K L+G +A+ +YD K  +    RDP
Sbjct: 103 SHWGNDSLYIASLLKD--------LEDDGSVIDVIKSLEGEYAYTVYDVKSAKFYFGRDP 154

Query: 139 IGVVTLYMGRCSKSPKTVYFAS---ELKCLTDVCDSIIAFPPGHVYDSETDKI--TRYFT 193
           IG  +L     + +   +Y AS    ++C  D     +     + YD++T  +   +   
Sbjct: 155 IGRRSLSYSVTANN--ELYVASVTGAVECFHDCIGGTV-----YEYDTQTKSLHDNQRLR 207

Query: 194 PDW-----LDEKRVPTTPVDYRAIRHSLEKAVRKRL 224
           P +     LD + V  + V  + +   L ++V+KR+
Sbjct: 208 PPYEVTPKLDMEFVSLSIVS-KNLYSVLRESVKKRI 242

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 10/99 (10%)

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWG 415
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 416 LEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILR 454
           +E R PFLD   ++    +      IN K   + K ILR
Sbjct: 442 VEVRYPFLDDRVIEFSTQLP-----INYK---VNKMILR 472

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 6/93 (6%)

Query: 353 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTL 412
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 413 AWGLEARVPFLDKDFLQLCMNIDP----KDKMI 441
           + G+E R PFL ++ ++      P    +DKMI
Sbjct: 442 SNGVEVRYPFLAEEVVEFSTASIPLNYKRDKMI 474

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 73/169 (43%), Gaps = 38/169 (22%)

Query: 1   MCGIFA----AFKHED------IEDFKPK------ALQLSKRIRHRGPDWSGNAIMN--S 42
           MCGI      +FK E+       ED  P+         + K +R RGP++     +   +
Sbjct: 1   MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDVN 60

Query: 43  TIFVHERLAIVGLDSGAQPITSSD----GDYMLGVNGEIYNHIQLREQCSDYKFQT--FS 96
           +I++   L++       QP T         Y+L  NGE+YN  ++ E  +D +F +    
Sbjct: 61  SIWISSVLSL------RQPFTKQSIVIGNKYVLQFNGELYND-EIIESGNDTQFLSGLLK 113

Query: 97  DCEPIIPLYLEHDI-DAPKYLDGMFAFCLYDSKKDRVIAARDPIGVVTL 144
            C        E DI +    LDG FAF + D + + +   RD IG  +L
Sbjct: 114 KCIS------EDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSL 156

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 353 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST 411
           + I  Q   +VL SG G+DE++GGY  F    S      E  +++ N++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNNK-SPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 412 LAWGLEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEP 463
              G+E R PFLD++ + L  ++ P +   N    R+      +  D  +EP
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSL-PINYKTNKNILRLLATNKLQLMDIGEEP 485

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 9/95 (9%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARVP 421
           ++ SG G+DE++GGY  F++  +  E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 422 FLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKA 456
           FLD   +     +      IN K   + K ILRK 
Sbjct: 448 FLDDQVVAFSTQLP-----INYK---VNKMILRKV 474

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 15/79 (18%)

Query: 69  YMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAP---KYLDGMFAFCLY 125
           ++L  NGEIYN              + +D + I  + L    D P   + L G FA+ +Y
Sbjct: 91  FVLQYNGEIYN-----------SSISHNDTQYIAEMLLNAK-DIPSVIRTLSGEFAYTIY 138

Query: 126 DSKKDRVIAARDPIGVVTL 144
           D     V   RDPIG  +L
Sbjct: 139 DKLTGEVFFGRDPIGRRSL 157

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,410,839
Number of extensions: 2446125
Number of successful extensions: 5418
Number of sequences better than 10.0: 45
Number of HSP's gapped: 5516
Number of HSP's successfully gapped: 81
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)