Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.3953.454ON45145123410.0
Skud_7.4153.454ON45245120060.0
YGR110W (CLD1)3.454ON44544419830.0
Smik_6.2003.454ON44544419520.0
TDEL0F033903.454ON42440712891e-176
ZYRO0C06270g3.454ON43040412861e-175
Kpol_1035.93.454ON42741112511e-170
Kwal_27.123173.454ON43539511801e-159
NCAS0E008603.454ON44045511751e-158
KAFR0I019703.454ON41141311641e-157
SAKL0B06116g3.454ON43142911661e-157
KNAG0B009503.454ON41841011621e-157
KLTH0E13948g3.454ON43840611641e-157
NDAI0G010903.454ON45640011591e-156
Ecym_24653.454ON43839911541e-155
ABL019W3.454ON43141111411e-153
TPHA0O013103.454ON43838911411e-153
CAGL0L04686g3.454ON45143910771e-143
KLLA0B12914g3.454ON4264059831e-129
TBLA0F034603.454ON4414128601e-111
SAKL0G19074gna 1ON4324134703e-53
KLTH0C01254gna 1ON4344214363e-48
Ecym_5577singletonON4334064232e-46
Kwal_14.985na 1ON4354074051e-43
Skud_12.1678.284ON3943492041e-16
Smik_12.1588.284ON3943352013e-16
YLR099C (ICT1)8.284ON3943491995e-16
Suva_10.1838.284ON3943491942e-15
Skud_4.3868.284ON4463501651e-11
KAFR0B053808.284ON4113391641e-11
Kpol_543.498.284ON4293681641e-11
TDEL0F041008.284ON4343321641e-11
TPHA0A016908.284ON4053671632e-11
Suva_2.2888.284ON4353501605e-11
CAGL0B01969g8.284ON4233331605e-11
NDAI0J01200singletonON4273381589e-11
Smik_4.3718.284ON4353361542e-10
YDR125C (ECM18)8.284ON4533471516e-10
NDAI0J012108.284ON4163431472e-09
Kwal_56.237028.284ON4163331392e-08
SAKL0H16500g8.284ON4193651364e-08
KNAG0G021408.284ON4083481355e-08
KAFR0B028308.284ON3913311311e-07
NCAS0B037108.284ON4303291293e-07
CAGL0M11462g8.284ON3863631258e-07
Ecym_42858.284ON4053531259e-07
NCAS0B051208.284ON3963591232e-06
KLTH0G13178g8.284ON4153341232e-06
ZYRO0D06666g8.284ON3803421222e-06
TBLA0H014008.284ON4213871187e-06
KLLA0F19624g8.284ON4093481178e-06
KNAG0H031208.284ON4343531123e-05
AGR062C8.284ON3841201072e-04
TPHA0L016008.524ON3721261052e-04
NCAS0B022608.524ON3632171025e-04
CAGL0M05467g8.524ON354118960.003
TDEL0B032508.524ON348117950.004
NDAI0C054308.524ON362119930.007
SAKL0H10450g8.524ON392115930.007
ZYRO0F09064g8.524ON349116870.032
KLLA0A10395gna 2ON294161870.035
Skud_14.400na 3ON293165850.056
CAGL0F00275g1.531ON40459800.25
Suva_14.424na 3ON28963790.27
KNAG0A037708.524ON356116800.28
TDEL0G00150singletonON299146790.32
Kwal_27.10170na 2ON293135780.43
NCAS0G035501.531ON40659760.72
NDAI0C025601.531ON42957770.73
TBLA0H035408.524ON378129751.0
Kpol_1018.1871.531ON40759741.4
TBLA0B101001.531ON39693731.8
KAFR0E03110singletonON35684732.0
Kpol_299.68.524ON349120713.3
YNR064Cna 3ON29045703.7
KLLA0C11561gsingletonON355157696.1
ZYRO0C14696g6.140ON64946696.8
Kwal_23.41684.264ON66484688.3
TBLA0D051601.329ON31934679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.395
         (451 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...   906   0.0  
Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W ...   777   0.0  
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...   768   0.0  
Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W ...   756   0.0  
TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.4...   501   e-176
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...   499   e-175
Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON...   486   e-170
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...   459   e-159
NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454    457   e-158
KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON}              452   e-157
SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {...   453   e-157
KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.4...   452   e-157
KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]...   452   e-157
NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454    451   e-156
Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}...   449   e-155
ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...   444   e-153
TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {...   444   e-153
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...   419   e-143
KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} simi...   383   e-129
TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON}              335   e-111
SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON} cons...   185   3e-53
KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {...   172   3e-48
Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar...   167   2e-46
Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON...   160   1e-43
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    83   1e-16
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    82   3e-16
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    81   5e-16
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    79   2e-15
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    68   1e-11
KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON} Anc_8...    68   1e-11
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    68   1e-11
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    68   1e-11
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    67   2e-11
Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON...    66   5e-11
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    66   5e-11
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              65   9e-11
Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON...    64   2e-10
YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}  ...    63   6e-10
NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8....    61   2e-09
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    58   2e-08
SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} simi...    57   4e-08
KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {O...    57   5e-08
KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {O...    55   1e-07
NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284     54   3e-07
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    53   8e-07
Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar t...    53   9e-07
NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {O...    52   2e-06
KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} simi...    52   2e-06
ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} simila...    52   2e-06
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    50   7e-06
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    50   8e-06
KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.2...    48   3e-05
AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON} S...    46   2e-04
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    45   2e-04
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    44   5e-04
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    42   0.003
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    41   0.004
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    40   0.007
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    40   0.007
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    38   0.032
KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {O...    38   0.035
Skud_14.400 Chr14 complement(717609..718490) [882 bp, 293 aa] {O...    37   0.056
CAGL0F00275g Chr6 (33830..35044) [1215 bp, 404 aa] {ON} highly s...    35   0.25 
Suva_14.424 Chr14 complement(736902..737771) [870 bp, 289 aa] {O...    35   0.27 
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    35   0.28 
TDEL0G00150 Chr7 complement(22315..23214) [900 bp, 299 aa] {ON}        35   0.32 
Kwal_27.10170 s27 complement(227197..228078) [882 bp, 293 aa] {O...    35   0.43 
NCAS0G03550 Chr7 complement(664516..665736) [1221 bp, 406 aa] {O...    34   0.72 
NDAI0C02560 Chr3 complement(594150..595439) [1290 bp, 429 aa] {O...    34   0.73 
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    33   1.0  
Kpol_1018.187 s1018 complement(470763..471986) [1224 bp, 407 aa]...    33   1.4  
TBLA0B10100 Chr2 complement(2430756..2431946) [1191 bp, 396 aa] ...    33   1.8  
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               33   2.0  
Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON} (14238..15...    32   3.3  
YNR064C Chr14 complement(749136..750008) [873 bp, 290 aa] {ON} E...    32   3.7  
KLLA0C11561g Chr3 complement(997866..998933) [1068 bp, 355 aa] {...    31   6.1  
ZYRO0C14696g Chr3 (1144384..1146333) [1950 bp, 649 aa] {ON} simi...    31   6.8  
Kwal_23.4168 s23 (600899..602893) [1995 bp, 664 aa] {ON} YLR401C...    31   8.3  
TBLA0D05160 Chr4 complement(1272860..1273819) [960 bp, 319 aa] {...    30   9.7  

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/451 (97%), Positives = 439/451 (97%)

Query: 1   MRTRFLTFKSTLSSIIKGPLKGFQLLTGASSSSTQPESGETSIKDAAEKRILRTPSAPTA 60
           MRTRFLTFKSTLSSIIKGPLKGFQLLTGASSSSTQPESGETSIKDAAEKRILRTPSAPTA
Sbjct: 1   MRTRFLTFKSTLSSIIKGPLKGFQLLTGASSSSTQPESGETSIKDAAEKRILRTPSAPTA 60

Query: 61  IPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPXXXXXXXXXXX 120
           IPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNP           
Sbjct: 61  IPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPSTTKKSKLIKT 120

Query: 121 XVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHA 180
            VDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHA
Sbjct: 121 IVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHA 180

Query: 181 IDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSY 240
           IDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSY
Sbjct: 181 IDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSY 240

Query: 241 LMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFT 300
           LMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFT
Sbjct: 241 LMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFT 300

Query: 301 LVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFAL 360
           LVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFAL
Sbjct: 301 LVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFAL 360

Query: 361 KCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKS 420
           KCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKS
Sbjct: 361 KCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKS 420

Query: 421 SVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451
           SVITVPNAGHHLYLDNHKFFNTIIMNEMQKV
Sbjct: 421 SVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451

>Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W
           (REAL)
          Length = 452

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/451 (81%), Positives = 405/451 (89%)

Query: 1   MRTRFLTFKSTLSSIIKGPLKGFQLLTGASSSSTQPESGETSIKDAAEKRILRTPSAPTA 60
           M+ RFLTFKSTLSSII  PLKG QLLTGA+SS T+ ES E+  +D  E+RILRTPSAPTA
Sbjct: 1   MKVRFLTFKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSAPTA 60

Query: 61  IPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPXXXXXXXXXXX 120
           IPLREIIYKVPGLFPRPLEDSVKDFRDF KNED FQTELL TLPFYPNP           
Sbjct: 61  IPLREIIYKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKT 120

Query: 121 XVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHA 180
            VDDDGNYINEFCIYPQ PSVPE +LKHLVFIHGYGAGLGFFIKN EDIPLL+NEWC+HA
Sbjct: 121 VVDDDGNYINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHA 180

Query: 181 IDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSY 240
           IDLPGYGFSSRPKFPF+YP+D++H+VQDWFHERIHTWF KRNLL+KP+KNIV+AHSLGSY
Sbjct: 181 IDLPGYGFSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSY 240

Query: 241 LMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFT 300
           LMALYLQKY+ SPSFKKL+LCSPAGVS+RDFD+  ++V KWKPPPWWYVKLWD+NISPFT
Sbjct: 241 LMALYLQKYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFT 300

Query: 301 LVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFAL 360
           LVRN+RQ GSKITSGWSYRRFKHILNGDP QS+RFEALHRYAYSIFNKRGSGEYLLSFAL
Sbjct: 301 LVRNARQLGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFAL 360

Query: 361 KCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKS 420
           +CGGEPRLPLEEQLFNG+N+ VLKN+ YEWVWLYG+DDWMDV+GGLRVSK LN+KL QKS
Sbjct: 361 RCGGEPRLPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKS 420

Query: 421 SVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451
           +V  VP+AGHHLYLDN+ FFN I++ EMQ V
Sbjct: 421 NVFIVPHAGHHLYLDNYTFFNKILVKEMQNV 451

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/444 (81%), Positives = 401/444 (90%)

Query: 8   FKSTLSSIIKGPLKGFQLLTGASSSSTQPESGETSIKDAAEKRILRTPSAPTAIPLREII 67
           FKSTL+SII+ PLKGFQLL GA SS+T+P+S   S +D  EK+ILRTPSAPTAIPLREII
Sbjct: 2   FKSTLNSIIRRPLKGFQLLRGADSSNTRPQSPRASARDVTEKQILRTPSAPTAIPLREII 61

Query: 68  YKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPXXXXXXXXXXXXVDDDGN 127
           Y+VP LFPRPLEDSVKDFRDFIKNED+FQTELL TLPFYP P            VDD+GN
Sbjct: 62  YRVPSLFPRPLEDSVKDFRDFIKNEDAFQTELLKTLPFYPTPSESKTARLIRTVVDDEGN 121

Query: 128 YINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYG 187
           YINEFCI P+  SVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLL+NEWC+HAIDLPGYG
Sbjct: 122 YINEFCIRPRKTSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLDNEWCIHAIDLPGYG 181

Query: 188 FSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQ 247
           FSSRPKFPF+YPRD+IHSVQDWFHERIHTWF KRNLLN+PEKNIVMAHSLGSYLMALYLQ
Sbjct: 182 FSSRPKFPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYLQ 241

Query: 248 KYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVRNSRQ 307
           KY+ SPSFKKLILCSPAGVS+RDF++  S+VEKWKPPPWWYVKLWD+NISPFTLVRN RQ
Sbjct: 242 KYKESPSFKKLILCSPAGVSYRDFNNTASEVEKWKPPPWWYVKLWDRNISPFTLVRNFRQ 301

Query: 308 FGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPR 367
            GSKITSGWSYRRFKHILNGDP+QSKRFEALHRYAY+IFNKRGSGEYLLSFALKCGGEPR
Sbjct: 302 LGSKITSGWSYRRFKHILNGDPEQSKRFEALHRYAYAIFNKRGSGEYLLSFALKCGGEPR 361

Query: 368 LPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKSSVITVPN 427
           L LE+QLF+GK +++LKN+  +W+WLYGDDDWMDVNGGLRVS+ L +KLKQKS+VI VP+
Sbjct: 362 LSLEQQLFDGKKSDILKNSNCDWLWLYGDDDWMDVNGGLRVSRFLKEKLKQKSNVIIVPH 421

Query: 428 AGHHLYLDNHKFFNTIIMNEMQKV 451
           +GHHLYLDN+KFFN I+  EMQK+
Sbjct: 422 SGHHLYLDNYKFFNNILTKEMQKI 445

>Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W
           (REAL)
          Length = 445

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/444 (80%), Positives = 395/444 (88%)

Query: 8   FKSTLSSIIKGPLKGFQLLTGASSSSTQPESGETSIKDAAEKRILRTPSAPTAIPLREII 67
           FKSTL SI++ PLK FQLLTGA+ S+TQP+    S++D  EK+I RTPSAPTAIPLREII
Sbjct: 2   FKSTLISIMRRPLKSFQLLTGANPSNTQPQCPRASVRDITEKQISRTPSAPTAIPLREII 61

Query: 68  YKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPXXXXXXXXXXXXVDDDGN 127
           YKVPGLFPRP+ DSVKDFRDFIK+ED FQTELL TLPFYPNP            VDDDGN
Sbjct: 62  YKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVVDDDGN 121

Query: 128 YINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYG 187
           YINEFCI P  PSVPE +LKHL+FIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYG
Sbjct: 122 YINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYG 181

Query: 188 FSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQ 247
           FSSRPKFPF+YPRD++H VQDWFH+R+HTWF KRNLLNKP+KN+VMAHSLGSYLMALY+Q
Sbjct: 182 FSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQ 241

Query: 248 KYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVRNSRQ 307
           KY+  PSFKKLILCSPAGVSHRD ++  S+ EKWKPPPWWYVKLWD+NISPFTLVRNSRQ
Sbjct: 242 KYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSRQ 301

Query: 308 FGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPR 367
           FGSKITSGWSYRRFKHILNGD  QS RFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPR
Sbjct: 302 FGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPR 361

Query: 368 LPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKSSVITVPN 427
           LPLEEQLFN +N N+L+++ YEW+WLYGDDDWMDVNGG+RVSK LN+KL+QKS+VI VP+
Sbjct: 362 LPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVPH 421

Query: 428 AGHHLYLDNHKFFNTIIMNEMQKV 451
           AGHHLYLDN KFFN I++ EM+KV
Sbjct: 422 AGHHLYLDNSKFFNDILVKEMRKV 445

>TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.454
           YGR110W
          Length = 424

 Score =  501 bits (1289), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 244/407 (59%), Positives = 300/407 (73%), Gaps = 10/407 (2%)

Query: 47  AEKRILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDS-FQTELLATLPF 105
           A+   L  P+APTAIPLREII K+P LFPR   DSV+D+RD  ++ D  FQ +LLATLPF
Sbjct: 26  AQSVSLDVPAAPTAIPLREIIVKLPSLFPRSFGDSVRDYRDLCRHTDEKFQRDLLATLPF 85

Query: 106 YPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKN 165
           Y               VDD+GNYINEF I P+  SVP   LKHLVFIHGYGAGLGFF+KN
Sbjct: 86  YGEGDLHRRSEVIRTKVDDEGNYINEFYIMPKNASVPRDRLKHLVFIHGYGAGLGFFLKN 145

Query: 166 FEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLN 225
           FE+IPLLNNEWC+HAIDLPGYGFSSR KFPF+YP+D +  V +WFH+R++ WF +RNLL 
Sbjct: 146 FENIPLLNNEWCIHAIDLPGYGFSSRCKFPFQYPKDTVTDVHEWFHKRLNRWFAERNLLR 205

Query: 226 KPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPP 285
            PE NIVMAHSLG+YLMALY  K   S  FKKL++CSPAG+     +S  +     + PP
Sbjct: 206 NPENNIVMAHSLGAYLMALYASK--NSSHFKKLVMCSPAGIC----ESTTTKAIGNRKPP 259

Query: 286 WWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQS-KRFEALHRYAYS 344
           WWY KLWD+NISPF+LVR S + GSK+TSGWSY+RF  +L     +S ++FEALH+Y YS
Sbjct: 260 WWYSKLWDRNISPFSLVRVSSRLGSKLTSGWSYKRFGKLLRSKSRKSEQQFEALHKYCYS 319

Query: 345 IFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNG 404
           IFNK G GEYLLSFAL+CGG+PR+PLE+ LF   ++ ++ N   EW+WLYG+ DWMD NG
Sbjct: 320 IFNKPGCGEYLLSFALRCGGDPRIPLEDMLFKTNDSGIM-NGNLEWLWLYGERDWMDFNG 378

Query: 405 GLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451
           G RVS+ L  K  QKS V  VPNAGHHLY DN+ +FN++I+ EM+ +
Sbjct: 379 GKRVSEHLK-KSGQKSEVCIVPNAGHHLYFDNYDYFNSLIIREMKSM 424

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score =  499 bits (1286), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 235/404 (58%), Positives = 292/404 (72%), Gaps = 14/404 (3%)

Query: 53  RTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPXXX 112
           R P+APTAIPL +II ++P LFPR ++ S +D++DF  +    Q ELL TLPFYP     
Sbjct: 36  RVPAAPTAIPLHKIIMRLPKLFPRSVDASTRDYKDFCYHTGQLQEELLRTLPFYPYCAES 95

Query: 113 XXXXXXXXXVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLL 172
                    VDD GNYINEFCI P  PSVP   +KHL+ IHGYGAGLGFF+KN E IPLL
Sbjct: 96  KKAEVVKTTVDDQGNYINEFCITPVKPSVPSHKMKHLICIHGYGAGLGFFLKNLEGIPLL 155

Query: 173 NNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIV 232
           +N W +HAIDLPGYGFSSRPKFPFKYP+D +  V  WFH+RIHTWF+KR LL   + N+V
Sbjct: 156 DNSWVIHAIDLPGYGFSSRPKFPFKYPKDSLSQVHSWFHDRIHTWFKKRGLLVNSQNNLV 215

Query: 233 MAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGV--SHRDFDSGNSDVEKWKPPPWWYVK 290
           MAHSLG+YLMALY  KY  +  FKKL++CSPAGV  S    + GN+       PPWWY K
Sbjct: 216 MAHSLGAYLMALYTTKY--TTHFKKLVMCSPAGVCKSTTAKNIGNTT------PPWWYTK 267

Query: 291 LWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQS---KRFEALHRYAYSIFN 347
           LWD NISPF LVRN+   GS +TSGWSYRRF  +L  + + +    +FEALHRYAY+IFN
Sbjct: 268 LWDLNISPFCLVRNAAALGSMVTSGWSYRRFNKLLQSNSNTNLDRLQFEALHRYAYAIFN 327

Query: 348 KRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLR 407
           +RGSGEYLLSFAL CGG+PRLPLE+ +F  K + + + +  EW+W+YG+ DWMDVNGG R
Sbjct: 328 RRGSGEYLLSFALSCGGDPRLPLEDTIFKDKTSGIFR-SNCEWIWIYGERDWMDVNGGER 386

Query: 408 VSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451
           VS+ + ++  +KS V   PN+GHHLY DNHKFFN+ I+ +M+ +
Sbjct: 387 VSRFIENQGGRKSQVHVAPNSGHHLYFDNHKFFNSFIVKQMKDM 430

>Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON}
           complement(19721..21004) [1284 nt, 428 aa]
          Length = 427

 Score =  486 bits (1251), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 226/411 (54%), Positives = 295/411 (71%), Gaps = 8/411 (1%)

Query: 41  TSIKDAAEKRILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELL 100
           TS   + ++++   P+AP AIPL EII K+P LFPR L++S+ D+ DF K+ D FQTELL
Sbjct: 25  TSGVPSRDEKLPTVPAAPAAIPLYEIILKLPNLFPRTLKESLNDYHDFHKDIDKFQTELL 84

Query: 101 ATLPFYPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLG 160
           +TLP+YP              VDD+GNYINEFCI P      + DLKHL+FIHGYGAGLG
Sbjct: 85  STLPYYPMANDGKKAELITTKVDDEGNYINEFCISPIGAEADQRDLKHLIFIHGYGAGLG 144

Query: 161 FFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEK 220
           FF+KNFE +PLL+N+WC+HAIDLPGYG+S R +FPFKYP  DI  VQDWFH+RI TWF+ 
Sbjct: 145 FFLKNFEHLPLLDNKWCIHAIDLPGYGYSKRCEFPFKYPEHDISDVQDWFHKRIRTWFKA 204

Query: 221 RNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEK 280
           R+LL  PE N++MAHSLG+YLMALY+ K+     FKK+++CSPAG+          +++ 
Sbjct: 205 RSLLTTPENNMIMAHSLGAYLMALYIDKFPN--DFKKIVMCSPAGICQSSTSEEIGNIKT 262

Query: 281 WKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHR 340
               PWW+ KLWD+N+SPFTLVRN+   GSK+TSGWSYRRFK +         +FE LHR
Sbjct: 263 ----PWWFNKLWDQNVSPFTLVRNTYYLGSKLTSGWSYRRFKQLKQS--GHLMQFEKLHR 316

Query: 341 YAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWM 400
           YAYSIFN++GSGEY+L FALKCGG+PR+PLE+ LF       +  +  EW+W+YG+ DWM
Sbjct: 317 YAYSIFNQKGSGEYILGFALKCGGDPRIPLEDNLFKSPKTEGIPKSDCEWLWVYGEKDWM 376

Query: 401 DVNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451
           D+ GG RV+  L  +  +KSS   VP++GHHLY DN+KFFN +++ EM+ +
Sbjct: 377 DIGGGKRVTDELVTRFGKKSSTTVVPDSGHHLYFDNYKFFNELLVKEMKNM 427

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score =  459 bits (1180), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 218/395 (55%), Positives = 275/395 (69%), Gaps = 11/395 (2%)

Query: 55  PSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPXXXXX 114
           PS+P+AIPL EII K+P LFPR LE S +DF+DF  N  + Q+ELLATLPF+P       
Sbjct: 51  PSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRT 110

Query: 115 XXXXXXXVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNN 174
                  VD  GNYINEF I P      +  +KHL+ +HGYGAGLGFF+K FE++ L+N 
Sbjct: 111 AEIIRTTVDAQGNYINEFNIRPTAVDTSKT-MKHLILVHGYGAGLGFFLKTFENLNLINE 169

Query: 175 EWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMA 234
            W +HAIDLPGYGFSSRP FPFK        V+ WFH R H W E+R LL  PE N+V+A
Sbjct: 170 NWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVA 229

Query: 235 HSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDK 294
           HS+G+YL ALY  K+ G   FKKL++CSPAGV H      ++   + +PPPWW+ KLWDK
Sbjct: 230 HSMGAYLTALYANKHPGH--FKKLVMCSPAGVCH------SAPEMRKRPPPWWFAKLWDK 281

Query: 295 NISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEY 354
           NISPF+LVRN+   GSK+TSGWSYRR   +L      +++ EALHRYAY+IFN++GSGEY
Sbjct: 282 NISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEY 341

Query: 355 LLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLND 414
           LLSFAL+CGGEPR+PLE +LF+ +      N   EW+WLYGD DW+D  GG RVS+ L  
Sbjct: 342 LLSFALQCGGEPRVPLERRLFHNRGQQFKANC--EWLWLYGDQDWIDRRGGERVSQFLTA 399

Query: 415 KLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQ 449
           ++  +S V  V N+GHHLYLDNH+ FN I+ +EM+
Sbjct: 400 EMGHESCVKIVKNSGHHLYLDNHRMFNKILEDEMR 434

>NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454
          Length = 440

 Score =  457 bits (1175), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 242/455 (53%), Positives = 295/455 (64%), Gaps = 25/455 (5%)

Query: 2   RTRFLTFKSTLSSIIKGPLKGFQLLTGASSSSTQPESGETSIKDAAEKRILRTPSAP-TA 60
           R+  LT K+TL +I K   +          +  + ES     + A    IL  PS P  A
Sbjct: 5   RSFMLTLKTTLQTIFKRRQR--------IGTIAKQESQRNVTEYATSNTILPQPSTPPVA 56

Query: 61  IPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPXXXXXXXXXXX 120
           IP+ +II  +P LFPR L DS +D+  F  + DS Q  LL TLPF+P             
Sbjct: 57  IPITDIITSLPSLFPRSLHDSRRDYNTFTTDIDSLQLNLLKTLPFFPMGSSQKVAKLIRT 116

Query: 121 XVDDDGNYINEFCIYPQVPS--VPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCV 178
            +DD+GNYINEFCI P V        DLKHL+FIHGYGAGLGFF+KN E+IPLL+N+WC+
Sbjct: 117 PIDDEGNYINEFCIMPAVKDGDYSSPDLKHLIFIHGYGAGLGFFLKNLENIPLLDNKWCI 176

Query: 179 HAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLG 238
           HAIDLPGYGFSSR KFPF YP D    VQ WFH+RI+ WF +RNLL  P+ N+VMAHSLG
Sbjct: 177 HAIDLPGYGFSSRFKFPFHYPNDSQTKVQKWFHDRIYRWFRERNLLQNPQNNLVMAHSLG 236

Query: 239 SYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISP 298
           +YLMA Y   +  S  FKK+I+CSPAGVS   F  G  +    K PPWWY KLWD N SP
Sbjct: 237 AYLMAHY--AFHFSNHFKKIIMCSPAGVSQ--FAVGKQN----KQPPWWYNKLWDLNYSP 288

Query: 299 FTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSF 358
           F+LVRNS  +GSKITSGWSYRRFK       ++S+ FEALH+Y Y IFNK GSGEYLLSF
Sbjct: 289 FSLVRNSGIYGSKITSGWSYRRFKPTSFNGLNESQ-FEALHKYTYGIFNKNGSGEYLLSF 347

Query: 359 ALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKL-- 416
            L CGG+PR  LE+ LF  +N         +WVW+YGD DWMD+NG  R+S+ L  K   
Sbjct: 348 ILSCGGDPRFALEDNLFKEENP---PEDLCDWVWVYGDRDWMDINGAHRISRRLVKKAGD 404

Query: 417 KQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451
             KS V  +P+AGHHLYLDN+K FN +I+ EM+ +
Sbjct: 405 TSKSKVHVIPSAGHHLYLDNYKAFNNLIIKEMETM 439

>KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON} 
          Length = 411

 Score =  452 bits (1164), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 225/413 (54%), Positives = 282/413 (68%), Gaps = 16/413 (3%)

Query: 39  GETSIKDAAEKRILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTE 98
           G + IK +         SAP AIPL +II ++P LFPR +++S KD+R + +  +  Q +
Sbjct: 15  GHSKIKKSQVPVHSNISSAPVAIPLVKIIAQLPRLFPRSIDESFKDYRVYKEGPERMQED 74

Query: 99  LLATLPFYPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAG 158
           LL+TLPFYPN             VD++GNYINEFCI P+  +V    LKHL+FIHGYGAG
Sbjct: 75  LLSTLPFYPNVSKDKVARIIKTVVDEEGNYINEFCITPK-NTVNSQKLKHLIFIHGYGAG 133

Query: 159 LGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWF 218
            GFF+KN E IPLL+N WC+HAIDLPG+GFSSR  FPFKYP  +   V  WFHERI  W 
Sbjct: 134 FGFFLKNLESIPLLDNNWCIHAIDLPGFGFSSRKNFPFKYPTSNTSEVTAWFHERIRRWL 193

Query: 219 EKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDV 278
           E+R LL+ P+ N+++AHSLG+YLMALY Q Y      +KLI+CSPAGVS    +S     
Sbjct: 194 EERTLLDNPKNNVIVAHSLGAYLMALYTQVYPA--HLRKLIMCSPAGVSKSQNNS----- 246

Query: 279 EKWKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEAL 338
           +    PPWWY KLWD N+SPFTLVR S+  GSK+TSGWSYRRFK I N       +FE L
Sbjct: 247 KAVLQPPWWYAKLWDMNLSPFTLVRLSKHLGSKLTSGWSYRRFKLIEN-----RMQFEML 301

Query: 339 HRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDD 398
           HRY+Y+IFN+ GSGEYLL F L+CGG PR  LE+ LF+  N NV  ++K EW W+YG++D
Sbjct: 302 HRYSYAIFNQPGSGEYLLGFILECGGNPRCSLEDTLFSN-NFNV--SSKVEWAWIYGEND 358

Query: 399 WMDVNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451
           WMD+ GG RV  LL +K  + S    VPNAGHHLYLDN ++FN II+  M+ V
Sbjct: 359 WMDIEGGRRVHNLLLEKFNRDSKFYMVPNAGHHLYLDNIRYFNNIIVQHMENV 411

>SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {ON}
           similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 431

 Score =  453 bits (1166), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 225/429 (52%), Positives = 297/429 (69%), Gaps = 17/429 (3%)

Query: 25  LLTGASSSSTQPESGETSIKDAAEKRIL--RTPSAPTAIPLREIIYKVPGLFPRPLEDSV 82
           L    +S S         ++ +AE   +  +  + PTA+PL +I  ++P LFP   E S+
Sbjct: 16  LKAAVNSISITNLISRAKVRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASI 75

Query: 83  KDFRDFIKNEDSFQTELLATLPFYPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPSVP 142
           +D+  F +N +SFQ++LL+TLPFYP+P            VDD+GNYINEF I P  PS  
Sbjct: 76  RDYSMFQENAESFQSQLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPSS- 134

Query: 143 EADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDD 202
            + +KHL+F+HGYGAGLGFF+KNFE+IPLLNN WC+HAIDLPGYGFSSRPKFPF YP  +
Sbjct: 135 SSSMKHLIFVHGYGAGLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHN 194

Query: 203 IHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCS 262
              V+DWFH+RI  W  KR LL  P+ N+++AHSLG+Y+ ALY  K+     F KLI+CS
Sbjct: 195 PIMVEDWFHQRIKGWLHKRGLLANPKNNLLVAHSLGAYISALYANKFPN--HFSKLIMCS 252

Query: 263 PAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFK 322
           PAG+            +  + PP W+VKLWD+NISPF+LVRNS   GSK+TSGW+YRRF+
Sbjct: 253 PAGIC--------PSPKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFR 304

Query: 323 HILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANV 382
             L       ++ +A+H+Y Y+IFNK GSGEYLLSFALKCGG+PRLPLE++LF+  N + 
Sbjct: 305 QFLREGQRGYEQHKAMHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFD--NTSS 362

Query: 383 LKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNT 442
            K A  +W+WLYGD+DWMD+ GG R S+ L  K+  KS V  VP+AGHHLYLDN+K FN 
Sbjct: 363 FK-ANCDWLWLYGDEDWMDLRGGQRASEFL-KKIGMKSDVKVVPSAGHHLYLDNYKHFNN 420

Query: 443 IIMNEMQKV 451
           +++ EM+K+
Sbjct: 421 VVIKEMEKM 429

>KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.454
           YGR110W
          Length = 418

 Score =  452 bits (1162), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 228/410 (55%), Positives = 285/410 (69%), Gaps = 22/410 (5%)

Query: 44  KDAAEKRILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATL 103
           K +  +  ++TP+APTAIPL EII K+P LFPR +  S++D++ F  N D  Q +LL+TL
Sbjct: 29  KQSDSRVYVKTPTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTL 88

Query: 104 PFYPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFI 163
           PF+P              +D+D N+INEF I P   + P + LKHL+FIHGYGAGLGFF+
Sbjct: 89  PFFPEAKDGKRAEIVRTKIDEDDNFINEFFIQPANVTEP-SKLKHLIFIHGYGAGLGFFL 147

Query: 164 KNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNL 223
           KNFE+I L +N WC+HAIDLPG+GFSSR KFPFKYP DD+  VQ WFHER+  WFEKR+L
Sbjct: 148 KNFENIQLKDNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDL 207

Query: 224 LNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKP 283
           L  P  N+V+AHSLG+YLMALY  K      FKKLI+CSPAG+        NS V K K 
Sbjct: 208 LKNPGNNMVVAHSLGAYLMALY--KRNNPLHFKKLIMCSPAGMC-------NSTVVK-KQ 257

Query: 284 PPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAY 343
           PPWWY  LWD N+SPF+LVRNS   GSK+TSGWSYRRF+ +         +FE LH Y+Y
Sbjct: 258 PPWWYAALWDMNLSPFSLVRNSGWLGSKLTSGWSYRRFRSL-----HSKIQFENLHLYSY 312

Query: 344 SIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLK--NAKYEWVWLYGDDDWMD 401
           +IFN+ G GEYLL+FAL+CGG+PR+ LE  LFN    +V+   ++  EWVWLYGD DWMD
Sbjct: 313 AIFNRPGCGEYLLAFALRCGGDPRVSLEATLFN----DVVNKWDSDSEWVWLYGDRDWMD 368

Query: 402 VNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451
           V GG R+S+ +N+    KSSV  +PNAGHHLY DN   FN I+  EM K+
Sbjct: 369 VKGGRRISQKINEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418

>KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]
           {ON} similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 438

 Score =  452 bits (1164), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 218/406 (53%), Positives = 286/406 (70%), Gaps = 11/406 (2%)

Query: 44  KDAAEKRILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATL 103
           + A+   I   PS+P+AIPLRE++  +P LFPR +++SV+D+  F K+  + Q +LL+TL
Sbjct: 40  ESASNPSITCRPSSPSAIPLRELVINLPRLFPRSMKESVRDYFAFRKDAGTLQHQLLSTL 99

Query: 104 PFYPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFI 163
           PF+P              VD+  NYINEFC+ P +P  P   L+HL+ +HGYGAGLGFF+
Sbjct: 100 PFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMPH-PSGTLRHLIIVHGYGAGLGFFL 158

Query: 164 KNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNL 223
           KN E + L++N W +HAIDLPGYGFSSRPKFP+KY  D    V+ WFH R  TW EKR L
Sbjct: 159 KNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSDPAAQVEHWFHARFKTWLEKRGL 218

Query: 224 LNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKP 283
           L  PE+N+++AHS+G+YL ALY  KY     FKKL++CSPAG+ +   +      ++ + 
Sbjct: 219 LQHPEQNMLVAHSMGAYLAALYANKYPN--HFKKLVMCSPAGICNTPSN------KQRRL 270

Query: 284 PPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAY 343
           PPWW+ KLWD+NISPF+LVRNSR  GSK+TSGWSYRRF  +L+     +++FEA+H+YAY
Sbjct: 271 PPWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRFGQLLSEGYRGAQQFEAIHKYAY 330

Query: 344 SIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVN 403
           +IFN  GSGEYLLSFALKCGG+PR  LE +LF+ K  N  K AK EW+WLYGD DWMDV 
Sbjct: 331 AIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNK-MNQFK-AKCEWLWLYGDQDWMDVG 388

Query: 404 GGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQ 449
           GG RVS  LN  + +KS V  V ++GHHLY DN++ FN I+  EM+
Sbjct: 389 GGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFNRILEKEMK 434

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score =  451 bits (1159), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 226/400 (56%), Positives = 285/400 (71%), Gaps = 20/400 (5%)

Query: 54  TPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPXXXX 113
            P+ PTAIPL  II  +P LFPR ++ S++D++ F K+ +  Q +LL TLPF+ N     
Sbjct: 68  APTPPTAIPLLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFK 127

Query: 114 XXXXXXXXVDD-DGNYINEFCIYPQVP-SVPEADLKHLVFIHGYGAGLGFFIKNFEDIPL 171
                   ++D D  YINEFCI P    ++  AD+KHL+FIHGYGAGLGFFIKN E+IPL
Sbjct: 128 TGKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIKNLENIPL 187

Query: 172 LNNEWCVHAIDLPGYGFSSR-PKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKN 230
           LNN WC+HAIDLPGYG+S+R  KFPFKYPRD    VQ+WFH++IH W +KRNLLN P+ N
Sbjct: 188 LNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNLLNYPKNN 247

Query: 231 IVMAHSLGSYLMALYLQKYEGSPS-FKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYV 289
           +++AHSLG+YLMA Y  K+   PS F+KLI+CSPAGV+       N+       PPWWY 
Sbjct: 248 LIVAHSLGAYLMAQYAFKF---PSHFQKLIMCSPAGVTKSSIKKLNNS------PPWWYE 298

Query: 290 KLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKR 349
           KLWD N SPF++VRNS  +GSKITS WSYRRFK +   D D  K+FEALHRYAYSIFN+ 
Sbjct: 299 KLWDLNFSPFSIVRNSGIYGSKITSAWSYRRFKPL---DLDH-KQFEALHRYAYSIFNRP 354

Query: 350 GSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVS 409
           G GEYLLSF L CGG PR  LE+ LF  +N   L     +W W+YGD+DWMD+NG  RVS
Sbjct: 355 GCGEYLLSFILSCGGNPRFSLEDTLFQREN---LSTELCDWGWIYGDNDWMDINGAKRVS 411

Query: 410 KLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQ 449
           +L+N++ K KS V  +P+AGHHLYLDN+K FN +++ EM+
Sbjct: 412 RLINEQQKGKSDVHVIPSAGHHLYLDNYKDFNKLLIKEME 451

>Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}
           similar to Ashbya gossypii ABL019W
          Length = 438

 Score =  449 bits (1154), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 217/399 (54%), Positives = 279/399 (69%), Gaps = 13/399 (3%)

Query: 55  PSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPXXXXX 114
           P+ PTAIPL EI+  +P LFP PL++S KD++ F  + D FQT LL+TLPF+P+      
Sbjct: 43  PTPPTAIPLMEILLNIPSLFPMPLKESWKDYKIFHDDVDKFQTGLLSTLPFFPSAADGKI 102

Query: 115 XXXXXXXVDDDGNYINEFCIYPQVPSVPEADLK--HLVFIHGYGAGLGFFIKNFEDIPLL 172
                  VD++GNYINEFCI P  P V   D K  HL+F+HGYGAGLGFF+KNFE+I LL
Sbjct: 103 GEIIRTPVDEEGNYINEFCIRPNSPPVNPKDSKMHHLIFVHGYGAGLGFFLKNFENIKLL 162

Query: 173 NNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIV 232
           NN W +HAID PGYGFSSRPKFPF   ++    V++WFH+R   W +KR LL   E+N+V
Sbjct: 163 NNSWTIHAIDFPGYGFSSRPKFPFSINKNTASEVENWFHDRFEIWLQKRGLLEDQERNLV 222

Query: 233 MAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLW 292
           +AHSLG+YL+ALY Q        KKLI+CSPAG+   +        +  K PPWW+VKLW
Sbjct: 223 LAHSLGAYLIALYAQSRPK--HLKKLIMCSPAGICPSN--------KVIKQPPWWFVKLW 272

Query: 293 DKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSG 352
           D+N+SPF+LVRNS  FGSK+TSGWS+RRFK  LN       +F+ALHRYAY+IFNK GSG
Sbjct: 273 DRNLSPFSLVRNSGIFGSKLTSGWSFRRFKQFLNEGTMGESQFQALHRYAYAIFNKPGSG 332

Query: 353 EYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLL 412
           EYLLSF LKCGG+PR PL  +LFN + A+  K A+ +W+W+YGD DWMD  GG + S  +
Sbjct: 333 EYLLSFVLKCGGDPRSPLLSRLFNSQAADSFK-AQCDWLWMYGDQDWMDCKGGEQASDFI 391

Query: 413 NDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451
              + ++S+V  +P +GHHLYLDN+  FN ++  EM K+
Sbjct: 392 VRHIGKESNVHVIPQSGHHLYLDNYSVFNELLQAEMAKM 430

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score =  444 bits (1141), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 214/411 (52%), Positives = 278/411 (67%), Gaps = 16/411 (3%)

Query: 44  KDAAEKRILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATL 103
           KD      +R P+ PTA+PL EII  +P LFP P   S +D++ F  + ++FQ  LL+TL
Sbjct: 31  KDGRHIHTVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTL 90

Query: 104 PFYPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPSVPE---ADLKHLVFIHGYGAGLG 160
           PF+               VDD+GNYINEFCI P   S+ E   A   HL+FIHGYGAGLG
Sbjct: 91  PFFERAREGKIGKIIRTPVDDEGNYINEFCIRPA--SMEENHGAATNHLIFIHGYGAGLG 148

Query: 161 FFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEK 220
           FFIKNFE +PLL+++W +HAIDLPGYG+S+R +FPF      +  V+ WFHER+ TW  K
Sbjct: 149 FFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSK 208

Query: 221 RNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEK 280
           R LL  P +N+VMAHS+G+YL A Y Q  +    FKKLI+CSPAG+S             
Sbjct: 209 RGLLQAPHRNMVMAHSMGAYLTAHYAQSRQN--HFKKLIMCSPAGIS--------PSKSM 258

Query: 281 WKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHR 340
            K PPWW++KLWD+N+SPF+LVRNS   GSK+TSGWS+RRF+H+LN      ++FEALH+
Sbjct: 259 KKQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHK 318

Query: 341 YAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWM 400
           Y+Y+IFN  GSGEYLLSF LKCGG+PR+PL   +F+ +  +  K A+ EW+WLYGD  WM
Sbjct: 319 YSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFK-AQCEWLWLYGDHVWM 377

Query: 401 DVNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQKV 451
           D  GG R S  + D++  KS V  VPN+GHHLY DN+ +FN I++ EMQ +
Sbjct: 378 DKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQSI 428

>TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {ON}
           
          Length = 438

 Score =  444 bits (1141), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 210/389 (53%), Positives = 277/389 (71%), Gaps = 12/389 (3%)

Query: 61  IPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPXXXXXXXXXXX 120
           + L E+I + P LFPR    S +D++ F  + ++FQ  LL TLP++P+P           
Sbjct: 59  LSLFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNT 118

Query: 121 XVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHA 180
            VDD+G+ INEF +YP   SVP   LKHL+F+HGYGAGLGFF+KN E+I LLN+EWCVHA
Sbjct: 119 IVDDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHA 178

Query: 181 IDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSY 240
           IDLPGYGFS+R KFPF+  +     V +WFH RI  W  +RNLL   + N ++AHSLG+Y
Sbjct: 179 IDLPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAY 238

Query: 241 LMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFT 300
           LMALY+ K+      +K+++CSPAG+       G+S   K K P WW+ KLW++NISPFT
Sbjct: 239 LMALYVDKHPN--DLQKILMCSPAGI-------GDSMNLKKKTPAWWFEKLWERNISPFT 289

Query: 301 LVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFAL 360
           LVR+S   GSK+TSGW+YRRF  +L+   +  K+FEALH+Y YSIFN+RGSGEYLL+FAL
Sbjct: 290 LVRSSSYIGSKLTSGWTYRRFSSLLS--QNNLKQFEALHKYTYSIFNQRGSGEYLLNFAL 347

Query: 361 KCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKS 420
           KCGG PR PLE+ LF   +  + K++  EW+W YGD+DWMD NGG+RVS++L  +LK++S
Sbjct: 348 KCGGGPRYPLEKTLFMNNDKGISKSST-EWIWAYGDNDWMDKNGGIRVSEILTKQLKKRS 406

Query: 421 SVITVPNAGHHLYLDNHKFFNTIIMNEMQ 449
            V  VP AGHHLY DNH+FFN +I+ EM+
Sbjct: 407 EVYIVPRAGHHLYFDNHQFFNDLILKEME 435

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score =  419 bits (1077), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 215/439 (48%), Positives = 282/439 (64%), Gaps = 29/439 (6%)

Query: 32  SSTQPESGETSIKDAAEKRILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKN 91
           SS   +S E   KD +    +   +APTA PL EI+  +P LFPR L +S +D+  F  N
Sbjct: 22  SSLGEKSSEVVGKDGSA---IIHATAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSN 78

Query: 92  EDSFQTELLATLPFYPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPSVPEADLKHLVF 151
            D  Q ELL TLPF+               +D DGNYINE  I P     P    K L+F
Sbjct: 79  VDLMQLELLRTLPFFERTGYNKRAYLRKTEIDSDGNYINELVIEPANVD-PNKKRKRLIF 137

Query: 152 IHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFH 211
           +HGYGAGLGF++KN+E +PLL++ W +HAIDLPGYGFSSR  FPF++PRDD   V DWF 
Sbjct: 138 VHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFI 197

Query: 212 ERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDF 271
            R+ T FEKR        NIVMAHS+G+YLMA YL KY  S   KK+++CSPAG+S   +
Sbjct: 198 SRLRTLFEKRGF--DKSDNIVMAHSMGAYLMAFYLNKYPDS--VKKMVMCSPAGISRSQY 253

Query: 272 DSGNSDVEKWKPP-----------PWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRR 320
              N+  E                PWWY KLWD+NISPF LVR +   GSKITSGW+YRR
Sbjct: 254 SINNNITEDISSGKEEIKLKIKKVPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRR 313

Query: 321 FKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFN---- 376
           FK IL    +  ++FE LHRY+++IFN +GSGEYLLSF L+CGG+PR PLE  LF+    
Sbjct: 314 FKPILLNKENNYEQFEKLHRYSFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDAN 373

Query: 377 --GKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSK--LLNDKLKQKSSVITVPNAGHHL 432
             G +   +KN+  EWVW+YG +DWMD++G  RV+K  L+N+  ++KS V+T+P +GHHL
Sbjct: 374 KFGIDNAGIKNSSCEWVWVYGANDWMDIHGAERVTKDFLMNN--RKKSRVVTIPESGHHL 431

Query: 433 YLDNHKFFNTIIMNEMQKV 451
           Y DN+  FN+++++EM+ +
Sbjct: 432 YFDNYPMFNSLLIDEMKSL 450

>KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
          Length = 426

 Score =  383 bits (983), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 191/405 (47%), Positives = 258/405 (63%), Gaps = 25/405 (6%)

Query: 44  KDAAEKRILRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATL 103
           K +     +R  +AP  +PL +I+  +  LFP    +S+KD++ +  N++ FQ +LL+ L
Sbjct: 46  KKSVRVNTVRKSTAPIGLPLLQIVTNLHKLFPLSFAESLKDYKQYNINKEQFQEDLLSVL 105

Query: 104 PFYPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFI 163
           P+YP P            +D  GNYINEF I P  P      LKH++ +HGYGAGLGF++
Sbjct: 106 PYYPEPSARFSSKIIKTPIDAAGNYINEFQITPIRPESDGKPLKHIILVHGYGAGLGFYL 165

Query: 164 KNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNL 223
           KNF    LL+    VHAIDLPGYGFSSRP FPF YP+D   +V+D+FH+ +H WF+K+ L
Sbjct: 166 KNFN--ALLSENVVVHAIDLPGYGFSSRPMFPFHYPKDSYLAVEDYFHDALHKWFDKKGL 223

Query: 224 LNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKP 283
           ++  E N V+AHS+G+Y+ +LY  KY+    FKKL +CSP G+S       N D+    P
Sbjct: 224 ISCWENNYVIAHSMGAYIFSLYANKYK---HFKKLFMCSPGGISR------NKDMP---P 271

Query: 284 PPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAY 343
           PPWW++KLWD+NISPF+LVRN+   GSK+ SGW+ RRF             F+ LH Y Y
Sbjct: 272 PPWWFLKLWDQNISPFSLVRNAGHVGSKLVSGWTARRFGL-------HHPNFDKLHHYTY 324

Query: 344 SIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVN 403
            IFN+ GSGEY+LSF L CGG PR+PLE +LF  +N N   ++  +WVWLYGD DWMD+N
Sbjct: 325 GIFNQPGSGEYMLSFMLGCGGWPRVPLETRLFTEENFN---SSHLDWVWLYGDSDWMDIN 381

Query: 404 GGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEM 448
           G  R++  L  K    + +  VPNAGHHLY DN  FFN ++  E+
Sbjct: 382 GARRINDFLRKKCIN-TKLEIVPNAGHHLYWDNDSFFNNVLRKEL 425

>TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  335 bits (860), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 183/412 (44%), Positives = 246/412 (59%), Gaps = 31/412 (7%)

Query: 52  LRTPSAPTAIPLREIIYKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPXX 111
           L+  +AP A  L +I+  +P LFPR + DS++D+  F  N + FQ  LL+ L FYP+   
Sbjct: 42  LKPSTAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYN 101

Query: 112 XXXXXXX----------XXXVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGF 161
                                 ++  YINEF I P   S P   LKHL+ IHGYGAGLGF
Sbjct: 102 NNSNDTSGNDDPRQGQIIKTYVNENEYINEFQILPNT-STPYDRLKHLILIHGYGAGLGF 160

Query: 162 FIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHS---VQDWFHERIHTWF 218
           +I   + + + N  WC+HA+DLPGYGFSSR KFP+      I+S   V DWF +R+ TWF
Sbjct: 161 YINTLQHLSMDN--WCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWF 218

Query: 219 EKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDV 278
            K+ LL  PE N+V AHS+G+Y+M  YL  +     F+K+I+CSPAG     + + N   
Sbjct: 219 HKKGLLAHPENNLVTAHSMGAYIMCHYLNNHPSD--FRKIIMCSPAGF----YPASNPLT 272

Query: 279 EKWKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEAL 338
                 P WY  LWD+N SPF+LVR S   GSK+TSGWSY RF H  +     ++   AL
Sbjct: 273 NI----PLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFH--SNQTISNELSLAL 326

Query: 339 HRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNA--NVLKNAKYEWVWLYGD 396
           H YAYSIFN  GSGEY LS  LK GG+PR PL+E+ F  ++   N ++ +  E+ WLYG 
Sbjct: 327 HTYAYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQ 386

Query: 397 DDWMDVNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEM 448
            DW++  GG ++S+ LN  L +KS+V   PN+GHHLY DN+ +FN+ +  EM
Sbjct: 387 SDWINKTGGFKISQFLNS-LNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437

>SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON}
           conserved hypothetical protein
          Length = 432

 Score =  185 bits (470), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 139/413 (33%), Positives = 190/413 (46%), Gaps = 91/413 (22%)

Query: 96  QTELLATLPFYPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPSVPEAD---LKHLVFI 152
           +  +L+ L FYP              +   GN I+EFCI     +  E+D    + +V +
Sbjct: 45  EENILSMLDFYPEGDESRRCETMDVDIGT-GNSIHEFCI----ENTKESDRDYCRDMVLV 99

Query: 153 HGYGAGLGFFIKNFE---DIPLLNNEWCVHAIDLPGYGFSSRPKFP-----------FKY 198
           HGYGA LG FI+NF+    IP +     +HAID+ GYG SSRPKFP            + 
Sbjct: 100 HGYGAALGLFIRNFDGLSQIPGIR----LHAIDMLGYGLSSRPKFPDTGFLTSFWKKREV 155

Query: 199 PRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKL 258
            ++D+   +D+F + I TW  KR+L    +K +++ HSLG YL   Y  KY      +KL
Sbjct: 156 TKEDVLLAEDFFIDSIETWRHKRHL----DKFVLVGHSLGGYLSCRYALKY--PERVEKL 209

Query: 259 ILCSPAGVSHRDFD---------------------------------------------S 273
           IL SP GV    FD                                             +
Sbjct: 210 ILVSPVGVETSIFDLTKEHTATHEHAAELGPDIAQELKVVPENSTTDKPVQPSSSFHVPN 269

Query: 274 GNSDVEKWKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSK 333
            +  VE+    P     +W+ NISPF ++R+   +G  + S WS+RRF H   GD +Q  
Sbjct: 270 ESGHVERIPNLPKIVRIIWENNISPFGILRSLGPWGPLLCSRWSFRRFSHC--GDKEQVM 327

Query: 334 RFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWL 393
           +F   H YAY+ FN RGSGEY L+  L  G   R+PL         +   KN K E +W+
Sbjct: 328 KF---HDYAYNTFNARGSGEYALTRILAPGVLARIPLL--------SCAPKNLKCESLWM 376

Query: 394 YGDDDWMDVNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMN 446
           YG  DWM    G  + K LN K    +    V +AGHHLYLDN   FN  + N
Sbjct: 377 YGSHDWMSKEAGSVIVKELN-KAGNTADYSVVSDAGHHLYLDNPHEFNQKLRN 428

>KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {ON}
           conserved hypothetical protein
          Length = 434

 Score =  172 bits (436), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 128/421 (30%), Positives = 194/421 (46%), Gaps = 87/421 (20%)

Query: 83  KDFRDFIKNEDSFQTE--LLATLPFYPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPS 140
           K F+ +    D+ + E  LL+TL F+P              + +   +I+EF I   + S
Sbjct: 28  KAFKTWWSRADAKENEKKLLSTLEFFPGGDSIRNCELLDVDIGNK-QHIHEFSIQ-NIES 85

Query: 141 VPEADLKHLVFIHGYGAGLGFFIKNFED---IPLLNNEWCVHAIDLPGYGFSSRPKFPF- 196
                 K LV +HGYGA LG F++NF+    IP +N    +HA+D+ G G SSRP+FP  
Sbjct: 86  CSRDYCKDLVMVHGYGAALGLFVRNFDGLSRIPGIN----LHALDMLGCGLSSRPRFPGT 141

Query: 197 ----------KYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYL 246
                     +  +++++  +++F + +  W ++R L    +K +++ HSLG YL   Y 
Sbjct: 142 GLISSVIKRGRVTKEEVYEAENFFIDSLEKWRQQRKL----DKFVLVGHSLGGYLSCCYA 197

Query: 247 QKYEGSPSFKKLILCSPAGVSHRDFD--------------------------SGN----- 275
            K+      +KL+L SP GV    FD                          SG      
Sbjct: 198 LKF--PERVEKLVLVSPVGVEKSVFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTTDD 255

Query: 276 --------------SDVEKWKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRF 321
                          +VE+    PW +  +W  NISPF L+R++   G  ++S WS+RRF
Sbjct: 256 PVKTSSSFHVPDEAGNVERVPNMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFRRF 315

Query: 322 KHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNAN 381
               N     +++    H Y YSIF+  GSGEY L+  L  G   R+PL         + 
Sbjct: 316 SFAEN-----TEQLLTFHEYCYSIFSGSGSGEYALTRILAPGVLARVPLL--------SR 362

Query: 382 VLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLN-DKLKQKSSVITVPNAGHHLYLDNHKFF 440
           V +N K +  W+YG  DWM    G  + + +N  K   K+    V +AGHHLYLDN + F
Sbjct: 363 VPENLKCDSFWMYGSHDWMSKEAGSVIVRQINKTKGSVKADYSVVSDAGHHLYLDNPEEF 422

Query: 441 N 441
           N
Sbjct: 423 N 423

>Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar to
           Saccharomyces cerevisiae YGR110W
          Length = 433

 Score =  167 bits (423), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 121/406 (29%), Positives = 180/406 (44%), Gaps = 82/406 (20%)

Query: 96  QTELLATLPFYPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGY 155
           +  +L  L FYP+             +   G+Y++EFCI  ++P   +   K +V +HGY
Sbjct: 41  EDNVLRMLSFYPDGDSERTCEVLHVDIGG-GDYMHEFCIENKLPMTRDT-CKDIVLVHGY 98

Query: 156 GAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFK-----------YPRDDIH 204
           G  LG FI+NF+++  +     +HAID+ GYG SSRP+FP               ++ + 
Sbjct: 99  GTALGVFIRNFDELSQIPGVR-LHAIDMLGYGLSSRPRFPRSGFWDYYVKGKVVTKEQVE 157

Query: 205 SVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPA 264
               +F + +  W EKRN+    +  +++ HSLG YL + Y  ++       KL+L SP 
Sbjct: 158 EALAFFVDSLEAWREKRNV----DSFVLVGHSLGGYLSSFYALRH--PERIDKLVLVSPV 211

Query: 265 GVSHRDFD----------------------------------SGNSD------------- 277
           GV    +D                                  S +S+             
Sbjct: 212 GVETSIYDLTAEHTPEHQHAGQLGPEVASEFKEDATEHTTDLSIDSNSPQSSSLHIPNEK 271

Query: 278 --VEKWKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRF 335
             VE     PW    LW+ N+SPF+L+R     G KI + WS+RRF     G    +   
Sbjct: 272 GFVEHVPNIPWLVKMLWNTNVSPFSLLRLLGPLGPKICANWSFRRF-----GACKDTNEL 326

Query: 336 EALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYG 395
              H+YAY+ F  +GSGEY +   L  G   R+PL  QL      + L        W+YG
Sbjct: 327 MNFHQYAYNNFKAKGSGEYAMMKILAPGALARVPLLSQLPGALKCDSL--------WMYG 378

Query: 396 DDDWMDVNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFN 441
            +DWM    G  + + L +K   ++    V NAGHHLYLDN + FN
Sbjct: 379 SNDWMSKEAGCIIVEELQEKSDYRAEYKIVNNAGHHLYLDNPEEFN 424

>Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 244] FULL
          Length = 435

 Score =  160 bits (405), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 122/407 (29%), Positives = 179/407 (43%), Gaps = 79/407 (19%)

Query: 96  QTELLATLPFYPNPXXXXXXXXXXXXVDDDGNYINEFCIYPQVPSVPEADLKHLVFIHGY 155
           + +LL+TL F+P              + D    I+E  I   + +   +    LV +HGY
Sbjct: 44  EKQLLSTLEFFPQGDSTRKCKILDVDIGDK-QTIHELEI-ENLKTSSRSYANDLVLVHGY 101

Query: 156 GAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPF-----------KYPRDDIH 204
           GA LG F++NF+ +  +     +HAID+ G G SSRPKFP               +++++
Sbjct: 102 GAALGLFVRNFDGLSSVPG-IKLHAIDMLGCGLSSRPKFPGTGLISSLIKRGNVTKEEVY 160

Query: 205 SVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPA 264
             +D+F + +  W +KR +    EK +++ HSLG YL + Y  KY      +KL+L SP 
Sbjct: 161 EAEDFFVDSMEKWRKKRQV----EKFVLVGHSLGGYLSSCYALKY--PERVEKLVLVSPV 214

Query: 265 GVSHRDFD-----------------------SGNSD----------------------VE 279
           GV    FD                       + N D                      VE
Sbjct: 215 GVEKSIFDLTHEHTESHKGAAELGPDVAKEITNNPDKPTTDNPVKNSSSFHVPDEHGMVE 274

Query: 280 KWKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALH 339
           +       +  +W  NISPF ++R     G  I+S WS+RRF        D  K+    H
Sbjct: 275 RVPNMSRIFSYMWTYNISPFGILRTLGPVGPLISSNWSFRRFSFT-----DDPKQLLTFH 329

Query: 340 RYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDW 399
            Y Y +F+  GSGEY L+  L  G   RLPL  ++          N K +  W+YG  DW
Sbjct: 330 EYCYGVFSGAGSGEYALTRILAPGVLARLPLLSRMPG--------NLKCDSFWMYGSQDW 381

Query: 400 MDVNGGLRVSKLLNDKLK-QKSSVITVPNAGHHLYLDNHKFFNTIIM 445
           M    G  + K LN+     K+    V +AGHHLYLDN + FN  ++
Sbjct: 382 MSKEAGSVMVKKLNESPGLGKADFSIVSDAGHHLYLDNPEEFNRKLL 428

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 95/349 (27%), Positives = 145/349 (41%), Gaps = 76/349 (21%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFP-----------FKY 198
           V IHGY A    F + FE   L +N   ++AIDLP  G S  P              FK+
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSDNIKDLYAIDLPANGASQAPALQVDKTKKIKPLRFKH 131

Query: 199 PRDDI------------------HSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSY 240
             DD+                     +++F +RI  W +     NK  +  V+ HS G Y
Sbjct: 132 IEDDVVVPVLDKHPPAEDIKSHLEQYENYFVDRIEQWRKD----NKLRRINVVGHSFGGY 187

Query: 241 LMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFT 300
           +   Y  KY  S    KL L SP GV     +S ++   KW+P   + +   D +   +T
Sbjct: 188 ISFKYALKYPNS--IDKLCLISPLGVE----NSIHAIAHKWEPNTTYPLTFTDPSSRYYT 241

Query: 301 LVRNSRQF---------------GSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSI 345
              N  QF               GSK+ S +    +  +    PDQ  +   LH +    
Sbjct: 242 RKLNVPQFIFENQLNVLKWMGPIGSKLCSNYISTAYVKV----PDQLYKDYLLHSFV--- 294

Query: 346 FNKRGSGEYLLSFALKCGG---EPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDV 402
               G  + +    +K      E  L   + + N  N  +L  A +  +++YG+ DWMD 
Sbjct: 295 ----GKNQTVQPQTIKVFTHLFERNLIARDPIIN--NVGLLNPATHV-MFMYGEHDWMDK 347

Query: 403 NGG-LRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQK 450
             G L    +L  K K K+S + VP+AGH+L+LDN   F + +++ + K
Sbjct: 348 YAGYLTTESML--KNKAKASYVEVPDAGHNLFLDNPHHFTSSLVSFLSK 394

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 95/335 (28%), Positives = 137/335 (40%), Gaps = 76/335 (22%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP-----------KFPFKY 198
           V IHGY A    F + FE   L NN   ++AIDLP  G S  P              FK+
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSNNIKDLYAIDLPANGASEAPVLQVDKTKKVKSLRFKH 131

Query: 199 PRDDI------------------HSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSY 240
             DD+                     +++F +RI  W +     NK  K  V+ HS G Y
Sbjct: 132 IEDDVVIPVLDRRPPAEDIKSHLEQYENYFVDRIEQWRKD----NKLRKINVVGHSFGGY 187

Query: 241 LMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFT 300
           +   Y  KY  S    KL L SP GV     +S ++   KW+P   + +   D +   +T
Sbjct: 188 ISFKYALKYPNS--IDKLCLISPLGVE----NSIHAITHKWEPNTTYPLTFTDPSSRYYT 241

Query: 301 LVRNSRQF---------------GSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSI 345
              N  +F               GSK+ S +    +  +    PDQ  +   LH +    
Sbjct: 242 RKLNVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKV----PDQIYKDYLLHSFV--- 294

Query: 346 FNKRGSGEYLLSFALKCGG---EPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDV 402
               G  + +    +K      E  L   + + N  N  +L N     +++YG+ DWMD 
Sbjct: 295 ----GKNQTVQPQTIKVFTHLFERNLIARDPIIN--NVGLL-NPTMHVMFMYGEHDWMDK 347

Query: 403 NGG-LRVSKLLNDKLKQKSSVITVPNAGHHLYLDN 436
             G L    +L  K K K+S I VP+AGH+L+LDN
Sbjct: 348 YAGYLTTESML--KNKAKASYIEVPDAGHNLFLDN 380

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 81.3 bits (199), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 95/349 (27%), Positives = 145/349 (41%), Gaps = 76/349 (21%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFP-----------FKY 198
           V IHGY A    F + FE+  L +N   ++AIDLP  G S  P              FK+
Sbjct: 74  VLIHGYAASSMAFYRTFEN--LSDNIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKH 131

Query: 199 PRDDI------------------HSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSY 240
             DD+                     + +F +RI  W +     NK  K  V+ HS G Y
Sbjct: 132 IEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKD----NKLRKINVVGHSFGGY 187

Query: 241 LMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFT 300
           +   Y  KY  S   +KL L SP GV     +S ++   KW+P   + +   D +   +T
Sbjct: 188 ISFKYALKYPDS--IEKLCLISPLGVE----NSIHAITHKWEPNTTYPLTFTDPSSRYYT 241

Query: 301 LVRNSRQF---------------GSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSI 345
              N  +F               GSK+ S +    +  +    PDQ  +   LH +    
Sbjct: 242 RKLNVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKV----PDQIYKDYLLHSFV--- 294

Query: 346 FNKRGSGEYLLSFALKCGG---EPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDV 402
               G  + +    +K      E  L   + + N  N   L N     +++YG+ DWMD 
Sbjct: 295 ----GKNQTVQPQTIKVFTHLFERNLIARDPIIN--NVRFL-NPATPVMFMYGEHDWMDK 347

Query: 403 NGG-LRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQK 450
             G L    +L  K K K+S + VP+AGH+L+LDN + F + +++ + K
Sbjct: 348 YAGYLTTESML--KNKAKASYVEVPDAGHNLFLDNPQHFASSLVSFLSK 394

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 95/349 (27%), Positives = 144/349 (41%), Gaps = 76/349 (21%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFP-----------FKY 198
           V IHGY A    F + F++  L +N   ++AIDLP  G S  P              FK+
Sbjct: 74  VLIHGYAASSMAFYRTFKN--LSDNIKDLYAIDLPANGASEAPALQVEGVKKIKSLRFKH 131

Query: 199 PRDD------------------IHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSY 240
             DD                  +   + +F +RI  W +  NL     K  V+ HS G Y
Sbjct: 132 VEDDMVTPVLDKRPPAEEIKSHLEQYESYFVDRIEQWRKDNNL----RKINVVGHSFGGY 187

Query: 241 LMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFT 300
           +   Y  KY  S    KL L SP GV     +S ++   KW+    + V   D +   +T
Sbjct: 188 ISFKYALKYPNS--IDKLCLISPLGVE----NSIHAINHKWEANTTYPVTFTDPSSRYYT 241

Query: 301 LVRNSRQF---------------GSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSI 345
              N  QF               GSK+ S +    +  +    PDQ  +   LH +    
Sbjct: 242 RKLNVPQFIFENQLNVLKWMGPIGSKLCSSYISTAYVKV----PDQLYKDYLLHSFV--- 294

Query: 346 FNKRGSGEYLLSFALKCGG---EPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDV 402
               G  + +    +K      E  L   + + N  N  +L  A +  +++YG+ DWMD 
Sbjct: 295 ----GKNQSVQPQTIKVFTQLFERNLIARDPIIN--NVGLLNPATHV-MFMYGEHDWMDK 347

Query: 403 NGG-LRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMNEMQK 450
             G L    +L  K K K+S + VP+AGH+L+LDN   F + +++ + K
Sbjct: 348 YAGYLTTESML--KNKAKASYMEVPDAGHNLFLDNPNHFTSSLVSFLSK 394

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 94/350 (26%), Positives = 143/350 (40%), Gaps = 88/350 (25%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP----------------- 192
           + IHGY A    + +N+    L  +   +++IDLP  G SS P                 
Sbjct: 123 LLIHGYAASSMSYFRNYPG--LSKHIRDLYSIDLPASGLSSIPSLEINATTPLPLDIKFI 180

Query: 193 -KFPFKYP--------RDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMA 243
            K  FK P        +  I   +D++ +RI  W     + NK  K  ++ HS G+YL  
Sbjct: 181 GKNKFKIPYTINANHHKFVIQMFEDFYLDRIEQW----RIDNKLGKMNIVGHSFGAYLSF 236

Query: 244 LYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNS-------DVEKWKPPPWWYVKLWDKNI 296
            Y  KY  S   +KL L SP GV    +   N+        ++   P   +Y K   +NI
Sbjct: 237 KYAVKYPNS--VEKLCLVSPLGVERNIWSVNNNFRSNSPYTIDFENPSSKFYSK---RNI 291

Query: 297 SP-------FTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKR 349
            P       F ++R     G+K+   W+Y     IL                AYS     
Sbjct: 292 IPRYLFQQQFQILRMMGPLGAKLC--WNY-----ILA---------------AYSRVPSL 329

Query: 350 GSGEYLLSFALKCGGEPRLPLE--EQLFNGK---------NANVLKNAKYEWVWLYGDDD 398
              EY+       GG P +  E  E LF+           + N L   K   + +YG  D
Sbjct: 330 AYKEYIFELFYGKGGIPAVTTEIFEGLFSRSILARDPLMDSLNSLNVRK--LLVVYGQYD 387

Query: 399 WMDVNGGLRVSKLLNDKLK--QKSSVITVPNAGHHLYLDNHKFFNTIIMN 446
           WM+ N G+ + K LN+     +K++   +P +GH+L+LDN + FN  I++
Sbjct: 388 WMNKNAGMLMVKELNNLGDHFEKATYTEIPFSGHNLFLDNPESFNQSIVS 437

>KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON}
           Anc_8.284 YDR125C
          Length = 411

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/339 (25%), Positives = 133/339 (39%), Gaps = 68/339 (20%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSR---------PKFPFKYPR 200
           + +HG+ +    F +NF  +    +   ++AIDLP  G S           PK   K+  
Sbjct: 91  LLLHGFASSSMSFFRNFTGLS--QDIMDLYAIDLPANGLSRSLSTKFYRVSPKETRKFDM 148

Query: 201 -DDIH-----------------SVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLM 242
            DDIH                   +D++ + I  W  + N L+K     ++AHS G YL 
Sbjct: 149 LDDIHFQLLSHGNYHAEKELIQKCEDYYIDTIERW-RRSNELHKIN---IVAHSFGGYLS 204

Query: 243 ALYLQKYEGSPSFKKLILCSPAGVS------HRDFDSGNS-DVEKWKPPPWWYVKLWDKN 295
             Y  KY    S  KL L SP GV       + +F+ G +  V +  P    Y+   ++N
Sbjct: 205 FKYALKYP--ESINKLCLVSPLGVEANIYSINNNFNVGETYTVNRLDPSSCCYI---NEN 259

Query: 296 ISP-------FTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNK 348
             P       F ++R S   G+K+   +    +  I + D           RY + +   
Sbjct: 260 EIPKYVFDNLFKILRLSGPIGAKLCWNYVLSSYSRISSLD---------FKRYVFELLYG 310

Query: 349 RGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGG--- 405
           +G                RL   + L +  ++          + LYG+ DWM  N G   
Sbjct: 311 KGGMTATAINLFTQLFTTRLLARDPLMDSAHSLSCNGI----LLLYGEYDWMAKNAGKSL 366

Query: 406 LRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTII 444
           L   K  N     K+  + VP +GH+L+LDN  FFN  I
Sbjct: 367 LTNCKADNKGSASKTKYLEVPKSGHNLFLDNPAFFNKSI 405

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 93/368 (25%), Positives = 146/368 (39%), Gaps = 101/368 (27%)

Query: 142 PEADLKHL--VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYP 199
           PEA L     + IHGY A    + + F  +   +    ++AIDLP +G S+ P   FK  
Sbjct: 93  PEASLVDTPTLLIHGYAASSLAYFRTFSGLS--DKIKNLYAIDLPSFGLSNAPPLDFKEK 150

Query: 200 RDDIH----------------------------SVQDWFHERIHTWFEKRNLLNKPEKNI 231
             DI                               +D++ E+I  W +     NK EK  
Sbjct: 151 VSDIKIKLSDDNTKFKISDSNRVDSLDLKKLIGKYEDYYVEKIEDWRKA----NKLEKIN 206

Query: 232 VMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWK--------P 283
           ++ HS G Y+   Y  KY  +    +L L SP G+   +  S N++ E  K        P
Sbjct: 207 LVGHSFGGYISFKYAIKYPDA--INRLCLVSPLGM-ESNIHSVNNNFETKKEYPLDLEDP 263

Query: 284 PPWWYVKLWDKNISPF------TLVRNSRQFGSKITSGW---SYRRFKHILNGDPDQSKR 334
              +Y K  ++ I  F       ++R     GSK+   +   SYRR  + L         
Sbjct: 264 SSRFYAK--ERRIPNFLFKNQLNVLRWMGPIGSKLCWNYINASYRRVPNPL--------- 312

Query: 335 FEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLE--EQLFNGK-------NANVLKN 385
                             EYL       GG P + ++    LF            ++ K 
Sbjct: 313 ----------------FKEYLFELLYGKGGMPSVTIDIFTNLFTRSLLARDPIMDSISKL 356

Query: 386 AKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKSSVIT--------VPNAGHHLYLDNH 437
              + + LYG+ DWM+   G  + + LN +LK  +++ T        VP+AGH+L+LDN 
Sbjct: 357 KAEKVLLLYGEHDWMNNLAGYNMVESLN-QLKPNNNISTIDYANYVEVPDAGHNLFLDNP 415

Query: 438 KFFNTIIM 445
           +FFN+ ++
Sbjct: 416 QFFNSAVL 423

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 88/332 (26%), Positives = 131/332 (39%), Gaps = 61/332 (18%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPF----------KYP 199
           + IHGY A    + +NF  +     +  ++AIDLP  G S+   F            KY 
Sbjct: 116 LLIHGYAASSMAYYRNFTGLSQTVTD--LYAIDLPANGLSAEQPFKLNGDKPRSLKVKYL 173

Query: 200 RDDIHSVQ----------------DWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMA 243
            +D  SVQ                 ++ ++I  W +    +NK EK  ++ HS G YL  
Sbjct: 174 DNDKFSVQHVIDESGTKQMIQQCESYYLDKIEEWRK----VNKLEKINLVGHSFGGYLSF 229

Query: 244 LYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVR 303
            Y  KY    S +KL L SP GV    +   N    K +    + + L D   + +T  R
Sbjct: 230 KYALKYPN--SIEKLCLVSPLGVETSIYSVNN----KLEKNTKYALDLEDPTSNFYTRRR 283

Query: 304 NSRQFGSKITSGWSYRRFKHILN-GDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFALKC 362
              +F         ++    IL    P  +K        AYS   +     Y+       
Sbjct: 284 EIPKF--------IFKNQSEILRWMGPLGAKMCWNYILSAYSRIPEMEYKSYIFELLYGK 335

Query: 363 GGEPRLPLEEQLF-NGKNANVLKN----------AKYEWVWLYGDDDWMDVNGGLRVSKL 411
           GG    P   Q+F N    N+L               + + +YGD DWM+   G ++ + 
Sbjct: 336 GGIA--PTARQIFTNLFTRNLLAKDPIMDSLGQLQAKKVLLVYGDHDWMNKYAGYKLVER 393

Query: 412 LNDKLKQKSS-VITVPNAGHHLYLDNHKFFNT 442
           LN      S+  I VP +GH+L+LDN  FFN 
Sbjct: 394 LNTIRNNTSAQYIEVPESGHNLFLDNPTFFNA 425

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 89/367 (24%), Positives = 142/367 (38%), Gaps = 102/367 (27%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFP-------------- 195
           + +HGY      + +NF  +     +  +++IDLP +G S  P+ P              
Sbjct: 65  LLVHGYATSSLAYYRNFAGLSSYIKD--LYSIDLPTFGLSKTPELPTRKVTKNLKVTLSN 122

Query: 196 -------------FKYPRDDIHSVQDWFHE--------------RIHTWFEKRNLLNKPE 228
                        F+  +DDI   + +++E              RI  W     + NK +
Sbjct: 123 SNDKSDDPKKITSFQLSKDDIKHNEKYYNETKKELEINENYYIDRIEKW----RIENKLD 178

Query: 229 KNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNS-------DVEKW 281
           K  ++ HS G YL   Y  KY    S +KL L SP G+    +   N        ++E+ 
Sbjct: 179 KINLVGHSFGGYLSYKYATKY--PDSIEKLCLVSPLGMESNIYSINNKFENDKIYEIEEE 236

Query: 282 KPPPWWYVKLWDKNISPF------TLVRNSRQFGSKITSGW---SYRRFKHILNGDPDQS 332
            P   ++     + I  F       ++R     GS +T  +   SYRR    L  D    
Sbjct: 237 DPSSIFFTNT--RTIPKFLFNNQLNVLRWLGPVGSTLTWKYIKASYRRVDDALYKD---- 290

Query: 333 KRFEALHRYAYSIFNKRGSGEYLLS-----FALKCGGEPRLPLEEQLFNGKNANVLKNAK 387
                +H     I+ K G  E  +      F  K   +   P+ + +   K  NVL    
Sbjct: 291 ----YIHEL---IYGKGGMEETTIKTFTNLFTTKLLAKD--PITDTVDKLKAKNVL---- 337

Query: 388 YEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKSSVI---------TVPNAGHHLYLDNHK 438
                LYG +DWM+   G +++K LN+     +S +          VP AGH+L+LDN  
Sbjct: 338 ----LLYGQEDWMNNYAGYQMTKKLNELKGYNTSKVGELNYATYMEVPEAGHNLFLDNPS 393

Query: 439 FFNTIIM 445
           FFN  ++
Sbjct: 394 FFNKALL 400

>Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 92/350 (26%), Positives = 145/350 (41%), Gaps = 88/350 (25%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP----------------- 192
           + IHGY A    + +N+  +    +   +++IDLP  G SS P                 
Sbjct: 112 LLIHGYAASSMSYFRNYSGLS--KHFQNLYSIDLPASGLSSIPPLEVNTTTPLPLDIKFI 169

Query: 193 -KFPFKYP--------RDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMA 243
            K  FK P        +  I   +D++ +RI  W     + NK +K  ++ HS G YL  
Sbjct: 170 GKNKFKIPYTINASHHKFVIQMFEDFYIDRIEQW----RIDNKLDKMNIVGHSFGGYLSF 225

Query: 244 LYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEK--------WKPPPWWYVK--LWD 293
            Y  KY    S +KL L SP GV  R+  S N+++            P   +Y K  L  
Sbjct: 226 KYAVKYPN--SVEKLCLVSPLGV-ERNIWSVNNNLSSNTLYTTDFKDPSSKFYSKGHLIP 282

Query: 294 KNI--SPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGS 351
           K +    F L+R     G+K+   W+Y                       AYS       
Sbjct: 283 KYLFEEQFKLLRLMGPLGAKVC--WNYI--------------------MAAYSRVTSLAF 320

Query: 352 GEYLLSFALKCGGEPRLPLEEQLFNGKNAN-------VLKNAKY----EWVWLYGDDDWM 400
            EY+       GG P +  +  +F G  +        +L +  Y    + + +YG  DWM
Sbjct: 321 KEYIFELFYGKGGIPEVTTD--IFKGLFSRSILARDPILDSLNYLNVKKLLVVYGQYDWM 378

Query: 401 DVNGGL----RVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMN 446
           + N G+     V+KL N    +++S + VP++GH+L+LDN + FN  I++
Sbjct: 379 NKNAGMLLVENVNKLGNG--LERASYLEVPSSGHNLFLDNPESFNQSIVS 426

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 89/333 (26%), Positives = 128/333 (38%), Gaps = 79/333 (23%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWC-VHAIDLPGYGFSSRP---------------- 192
           V IHGY A    F   F  IP LN +   ++ IDLPG G S  P                
Sbjct: 110 VLIHGYAATSTAF---FRSIPYLNRDIKDLYTIDLPGNGLSFTPSLDLEVSKPLPLKIEN 166

Query: 193 -----KFPFKYPRDDIH------SVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYL 241
                +F   Y  D  H       + D++ +RI  W     L NK  K  V+AHS G YL
Sbjct: 167 IDDGNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQW----RLDNKLGKINVVAHSYGGYL 222

Query: 242 MALYLQKYEGSPSFKKLILCSPAGVS------HRDFDSGNSDVEKWKPPPWWYVK----- 290
              Y  KY    +   L L SP GV       + +F S      +W      +       
Sbjct: 223 SFNYALKYPA--NINTLGLISPLGVERNIYSINNEFHSRTIYKREWNDCNSMFYDRKFKL 280

Query: 291 ---LWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFN 347
              L+ K + P   +R     G+K+   W+Y R  +      D          Y +  F 
Sbjct: 281 NDYLFQKQLKP---LRWLGPIGAKLC--WNYIRSAYARVPSIDYKD-------YTFETFY 328

Query: 348 KRG----SGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVN 403
            RG        + +  L      R PL + +   +   +        + +YG  DWM+ N
Sbjct: 329 GRGGLPEQTSQIFTSLLTSSLLARDPLLDHVSQLQVPKL--------IMMYGQYDWMNKN 380

Query: 404 GGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDN 436
           GG  ++++ N + K     I +PNAGH+L+LDN
Sbjct: 381 GGKLMTQIFNGETK----YIDIPNAGHNLFLDN 409

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 85/338 (25%), Positives = 133/338 (39%), Gaps = 74/338 (21%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP-------------KFPF 196
           + +HGY      F + F   PL      ++AID P  G S  P             K  F
Sbjct: 107 LLLHGYATSSIAFFRTFG--PLSKQIRDLYAIDFPANGLSKAPPLNVNHLKKHTPYKVKF 164

Query: 197 K---------------YPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYL 241
           K                 ++ I   ++++ + +  W     L NK EK  ++ HS G Y 
Sbjct: 165 KDDNTKFQISHTVDVQLQKETIEHYENYYLDAVRKW----QLTNKIEKFNLVGHSFGGYF 220

Query: 242 MALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTL 301
              Y  +Y  S    KL L SP GV  R+  S N++ E             DK +    L
Sbjct: 221 AYKYALRYPDS--VDKLCLVSPLGV-ERNIYSVNNNFE-------------DKKVYNLEL 264

Query: 302 VRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALH-----RYAYSIFNKRGSGEYL- 355
              + ++      G +++  K +  G  D  ++F  L       Y  S + +  S E+  
Sbjct: 265 EDPTSKY-----YGRTFQIPKCLFEGQFDILRKFGPLGPRFTWNYINSSYRRVPSMEFKE 319

Query: 356 LSFALKCGGEPRLPLEEQLF-NGKNANVLKN----------AKYEWVWLYGDDDWMDVNG 404
             F L  G     P+  ++F N  + N+L                 + +YG +DWM+   
Sbjct: 320 YIFELLYGNRKTSPILTEVFSNIVSRNLLARDPILDSIDELKASNVMLMYGQEDWMNSQA 379

Query: 405 GLRVSKLLNDKLKQ--KSSVITVPNAGHHLYLDNHKFF 440
           G  + K LN+  +    +S + VPNAGH+L+LDN  FF
Sbjct: 380 GYLMVKELNEIRENPNAASYVEVPNAGHNLFLDNPDFF 417

>Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 86/336 (25%), Positives = 138/336 (41%), Gaps = 60/336 (17%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP----------------- 192
           + IHGY A    F +N+    L  +   +++IDLP  G SS P                 
Sbjct: 112 LLIHGYAASSMSFFRNYPG--LSKHIQNLYSIDLPASGLSSIPPLEINATTPLPLDIEFT 169

Query: 193 -KFPFKYP--------RDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMA 243
            K  FK P        +  I   +D++ ++I  W     + NK  K  ++ HS G YL  
Sbjct: 170 GKNKFKIPYTINLNHHKFVIQMYEDFYLDKIEQW----RIDNKLGKVNIVGHSFGGYLSF 225

Query: 244 LYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVR 303
            Y  KY    S +KL L SP GV    +   N+    ++    + +   D + S F   R
Sbjct: 226 KYAAKYPN--SVEKLCLVSPLGVERNIWSINNN----FRSNTLYTIGFEDPS-SKFYSKR 278

Query: 304 NSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFALKCG 363
           N       I      R+F+ +    P  +K        AYS        EY+       G
Sbjct: 279 N------MIPKYLFERQFQLLRMMGPVGAKLCWNYIMAAYSRVPSLAYKEYIFELFYGKG 332

Query: 364 GEPRLPLEEQLFNGKNAN-------VLKNAKY----EWVWLYGDDDWMDVNGGLRVSKLL 412
           G P +  E  +F G  +        ++ +  Y    + + +YG  DWM+   G+ + + L
Sbjct: 333 GIPEVTTE--IFKGLFSRCILAKDPLMDSLHYLNVRKLMVVYGQYDWMNKKAGMLMVENL 390

Query: 413 ND--KLKQKSSVITVPNAGHHLYLDNHKFFNTIIMN 446
           N      +K+S + +P++GH+L+LDN   FN  I++
Sbjct: 391 NSLGNCLEKASYLEIPSSGHNLFLDNPLSFNQSIVS 426

>YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}
           ECM18Protein of unknown function, similar to Rlp24p
          Length = 453

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 86/347 (24%), Positives = 139/347 (40%), Gaps = 84/347 (24%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFP-------------- 195
           + IHGY A    F +N+    L  +   +++ID+P  G SS P                 
Sbjct: 130 LLIHGYAASSMSFFRNYPG--LSKHIRNLYSIDMPASGLSSVPSLEINTTTPLPLDIKFI 187

Query: 196 ----FKYP--------RDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMA 243
               FK P        +  I   +D++ +RI  W     + NK  K  V+ HS G YL  
Sbjct: 188 GENKFKVPYTINANHNKFVIQMYEDFYLDRIEQW----RIDNKLGKMNVVGHSFGGYLSF 243

Query: 244 LYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNS-------DVEKWKPPPWWYVKLWDKNI 296
            Y  KY    S  KL L SP GV    +   N+        ++   P   +Y K   +N+
Sbjct: 244 KYAVKYPN--SVNKLCLVSPLGVERNIWSVNNNFHSNTLYTIDFKNPNSKFYSK---RNM 298

Query: 297 SP-------FTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKR 349
            P       F ++R     G+K+   W+Y                       AYS     
Sbjct: 299 IPKYLFEQQFHILRMMGPLGAKLC--WNYI--------------------MAAYSRVPSL 336

Query: 350 GSGEYLLSFALKCGGEPRLPLE--EQLFNG---KNANVLKNAKY----EWVWLYGDDDWM 400
              EY+       GG P +  +  + LF+        ++ + +Y    + + +YG  DWM
Sbjct: 337 AYKEYIFELFYGKGGIPEVTTDIFKALFSRCILAKDPLMDSLQYLNVKKLLIVYGQYDWM 396

Query: 401 DVNGGLRVSKLLND--KLKQKSSVITVPNAGHHLYLDNHKFFNTIIM 445
           +   G+ + K LN+     + +S + +P++GH+L+LDN + FN  I+
Sbjct: 397 NKKAGMFMVKELNNLKNCLEGASYLEIPSSGHNLFLDNPESFNQSIV 443

>NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8.284
          Length = 416

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 137/343 (39%), Gaps = 78/343 (22%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFS-------------------- 189
           + +HGY A    F + F   PL NN   ++AIDLP  G S                    
Sbjct: 98  LLLHGYAASSMSFYRTFA--PLSNNFKNLYAIDLPANGLSVAIPLKITKQRKRLYEVKYK 155

Query: 190 SRPKFPFKYP------RDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMA 243
              KF   YP      +  I   ++++ + + +W     + N  EK  ++ HS G Y   
Sbjct: 156 ENNKFSISYPVPIEEQKPLIEQYENYYLDAMRSW----QVANNIEKFNLVGHSFGGYFSF 211

Query: 244 LYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPF---- 299
            Y  ++    S  KL L SP G+    F   N    K++    + V L D   SPF    
Sbjct: 212 KYALRFPD--SINKLCLVSPLGMESNIFSIHN----KFEENKIYNVNLTDPT-SPFYGKK 264

Query: 300 ------------TLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIF- 346
                        ++R    FG+++   +    +K +    P    +      Y + +F 
Sbjct: 265 FQIPNYLFENQLDVIRKLGPFGARLCWNYILSAYKRV----PSMEYK-----EYLFELFY 315

Query: 347 -NKRGSGEY--LLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVN 403
            N++ S     L +  L      R P+ + +   + +NVL         +YG+ DWM+  
Sbjct: 316 GNRQVSPILCELFTNLLTRNLLARDPILDSIDQLQLSNVLV--------MYGEHDWMNRY 367

Query: 404 GGLRVSKLLND--KLKQKSSVITVPNAGHHLYLDNHKFFNTII 444
            G  +   LN+  +    +  + VP AGH+L+LDN ++F++ +
Sbjct: 368 AGYCMVSRLNNIRRTPNTAQYLQVPAAGHNLFLDNPEYFSSAL 410

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 138/333 (41%), Gaps = 66/333 (19%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFS-------------------S 190
           + +HGY A    F +NF  +     +  ++AIDLP  G S                   S
Sbjct: 100 LLVHGYAASSMGFHRNFPGLSQSIKD--LYAIDLPASGLSPALPLEMRCTQPLDLKINMS 157

Query: 191 RPKFPFKYPRDDIH------SVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMAL 244
           +  F   Y  + +H      + +D++ + I  W       NK     ++AHS G YL   
Sbjct: 158 KDTFSLPYTINYLHHKSLIQNYEDYYLDAIEQWRHD----NKLGPINIVAHSFGGYLSFK 213

Query: 245 YLQKYEGSPSFKKLILCSPAGVSHRDFDSGNS-------DVEKWKPPPWWYVK------- 290
           Y  K+  +   +KL L SP GV    F   N        +++   P   +Y+K       
Sbjct: 214 YAVKFPHA--VEKLCLVSPLGVERNIFSVNNQWRSNTSYNLDFENPASKFYIKKGPAIPR 271

Query: 291 -LWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKR-FEALHRYAYSIFNK 348
            ++++      L+RN    G+K++  W+Y    +      D  K  FE L  Y  +  N+
Sbjct: 272 LVFEQQTQ---LLRNLGPLGAKLS--WNYINAAYSRVPSLDYKKYVFELL--YGKNGLNQ 324

Query: 349 RGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRV 408
                ++  F  +      L L+   F GK+A ++         +YGD DWM+   G+ +
Sbjct: 325 TSKDLFIGLFNNRVLARDPL-LDSIQFFGKSAKLM--------CIYGDHDWMNRRAGMEM 375

Query: 409 SKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFN 441
               N +L  ++    V ++GH+L+LDN + FN
Sbjct: 376 VNEAN-QLGIEAKYNEVSSSGHNLFLDNPEEFN 407

>SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 419

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 88/365 (24%), Positives = 146/365 (40%), Gaps = 78/365 (21%)

Query: 129 INEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGF 188
           IN++  Y    S+    L     +HGY A    F +NF    L +    ++AIDLP  G 
Sbjct: 83  INQWHFYNASASIKTPTL----LLHGYAAASMGFHRNFAG--LSSRIQNLYAIDLPANGL 136

Query: 189 S-----------------------SRPKFPFK----YPRDDIHSVQDWFHERIHTWFEKR 221
           S                        R K P+     + +  I  ++D++   I  W    
Sbjct: 137 SPGSSQPLVVSCGEPLPMKAEFSNDRFKIPYTLEYLHQKSFIQQLEDYYLNSIEQW---- 192

Query: 222 NLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKW 281
            + NK  K  ++AHS G YL   Y  KY    + ++L L SP GV  R+  S N+    W
Sbjct: 193 RIDNKLNKINIVAHSFGGYLSTKYAIKYPH--AVERLCLVSPLGVE-RNIHSVNNH---W 246

Query: 282 KPPPWWYVKLWD----------KNI------SPFTLVRNSRQFGSKITSGWSYRRFKHIL 325
               W+ +   D          + I      S   L+R     G+K+   W+Y      +
Sbjct: 247 CSNTWYDLNYEDPGSKYYMRRMRGIPSTVFQSQVKLLRLLGPLGAKLC--WNY------I 298

Query: 326 NGDPDQSKRFEALHRYAYSIF-NKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLK 384
           N    + K  E    Y + +F  K G  +  +           L  +  + + ++ +V +
Sbjct: 299 NAAYSRVKN-EKYKEYVFELFYGKEGVTQTAMDIFTNLFTRQLLAKDPLMDSLQHLHVGR 357

Query: 385 NAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKSSVIT---VPNAGHHLYLDNHKFFN 441
                 +  YG+ DWM+   G+ ++K  N  L+ KS   T   + ++GH+++LDN   FN
Sbjct: 358 -----LMLAYGEHDWMNKYAGVLMTKEFNH-LRGKSDAATYTVISSSGHNMFLDNPDEFN 411

Query: 442 TIIMN 446
             ++N
Sbjct: 412 EKVIN 416

>KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {ON} 
          Length = 408

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 132/348 (37%), Gaps = 78/348 (22%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPR--------- 200
           V IHGY A    F  N   +    ++ CV  +DLP  G S  P  P   P+         
Sbjct: 84  VLIHGYAASSMAFHLNVAGLSNAFSDLCV--VDLPANGLSREP--PMLGPKVKGQPVHWK 139

Query: 201 -------------------------DDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAH 235
                                    DD    +D+F +RI  W     L +  +   V+ H
Sbjct: 140 ELDKKTGSLTVVCEPPSKMSSSGVLDDPGVYEDYFVDRIEKW----RLAHGFDNINVVGH 195

Query: 236 SLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKN 295
           S G Y+   Y  KY  S    KL+L SP GV  R+ DS ++   KW     + +   D  
Sbjct: 196 SFGGYMSFKYAIKY--SKHVDKLVLLSPLGVE-RNIDSVSN---KWDVGKTYDLTDIDAT 249

Query: 296 ----ISPFTL-----------VRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHR 340
                 PFT+           +R     G+ +       R+ ++            A H 
Sbjct: 250 SPLYYRPFTVPGYLFNNQLNVLRKMGPLGNHMAKRAIASRYSNVPG---------TAYHA 300

Query: 341 YAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWM 400
           Y + +F    +       A       +L   + L +    N+ +    + + +YGD DWM
Sbjct: 301 YLHHVFYGAHTFPSANITAFTHLFTRQLLARDPLLD----NIQRLKVNKLMMVYGDHDWM 356

Query: 401 DVNGGLRVSKLLNDK--LKQKSSVITVPNAGHHLYLDNHKFFNTIIMN 446
           +   G  + + +N +  +  K+    +P+AGH+L+LDN   FN ++++
Sbjct: 357 NKEAGYGMVQEINKERYVPAKAVYAELPSAGHNLFLDNPSGFNKLLID 404

>KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {ON}
           Anc_8.284 YDR125C
          Length = 391

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 79/331 (23%), Positives = 131/331 (39%), Gaps = 69/331 (20%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPK---------------- 193
           + IHGY A    F + F  +    +   ++AIDLPG G SS P+                
Sbjct: 72  LLIHGYAASSMAFHRTFNRLS--TDIKDLYAIDLPGNGLSSAPELSDVIKMKDLKITLNK 129

Query: 194 ----FPFKYPRD------DIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMA 243
               F  K   D      ++   ++++  RI  W +   +    EK  V+ HS G ++  
Sbjct: 130 SKDGFTLKKAIDLEIEKANLAKYENYYLSRIDEWRKFHGI----EKLNVIGHSFGGFISF 185

Query: 244 LYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVE---KW-----KPPPWWYVKLWDKN 295
            Y   +    +   LIL SP G+  ++  S N++ E   K+      P   +Y + ++  
Sbjct: 186 KYAITHPNQVN--DLILVSPLGME-KNIHSLNNNFELETKYTLDFENPASLYYARSFN-- 240

Query: 296 ISPFTLVRNSRQ-------FGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNK 348
             P  L  N           G ++   +    +K +    PD      A   Y Y +F  
Sbjct: 241 -VPSILFNNQLNILRWMGPLGGRMARQYIDMAYKKV----PDV-----AYKNYLYYVFYD 290

Query: 349 RGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRV 408
             S   +            L   + + +    N+LK    + + +YG+ DWMD   G  +
Sbjct: 291 GKSFPKVTINNFTNMFSKNLLARDPIMD----NLLKLRAKKVMLVYGEHDWMDKYAGYNM 346

Query: 409 SKLL---NDKLKQKSSVITVPNAGHHLYLDN 436
            +LL   N KLK     + +P+AGH+L+LDN
Sbjct: 347 VELLSKSNYKLKDTVHYVEIPDAGHNLFLDN 377

>NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284
          Length = 430

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 82/329 (24%), Positives = 132/329 (40%), Gaps = 66/329 (20%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP----------------- 192
           + +HGY A    F + F  +PL  +   ++A DLPG G S                    
Sbjct: 112 LLLHGYAASSLCFFRTF--VPLSRSIKNLYATDLPGNGLSKNKSFFSVMYGNEYMKVKYE 169

Query: 193 ---KFPFKY---PRDDIHSV---QDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMA 243
              KF  KY    +D  +S+   +D++ + I  W    NL   P+ N+V  HS G YL  
Sbjct: 170 ENNKFSIKYLNSLKDQTNSIKHSEDYYIDAIREWQLSNNL---PKINLV-GHSFGGYLSF 225

Query: 244 LYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNS-------DVEKWKPPPWWYVKLWD--K 294
            Y  +Y    +  KL L SP GV    +   NS       DV+   P   +Y + +   K
Sbjct: 226 KYALRYPD--NVNKLCLVSPLGVESNLYSVNNSLKENYLYDVDYSDPKSSYYSRNFAIPK 283

Query: 295 NI--SPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKR---FEALHRYAYSIFNKR 349
           ++    F ++R     G+++   +    +K +    P    +   F  L   A  +    
Sbjct: 284 SLFEGQFGILRWMGPIGARVCWNYILSSYKRV----PSMKYKEYLFHLLFGNAKKLVTSA 339

Query: 350 GSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGG-LRV 408
            +   L +  L    +P +   E+L   K            + +YG  DWM+   G   +
Sbjct: 340 KTFTNLFTRNL-LAKDPIMDSIEKLQCEK-----------LMVMYGQHDWMNKYAGYCLI 387

Query: 409 SKLLNDKLKQKSSVIT-VPNAGHHLYLDN 436
           +KL N +  + +   T +P AGH+L LDN
Sbjct: 388 AKLNNYRSTKDAGYFTEIPEAGHNLILDN 416

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 86/363 (23%), Positives = 143/363 (39%), Gaps = 94/363 (25%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP---------KFPFKYPR 200
           + +HGYGA    + + F   PL  +   ++AIDLP  G S  P         K  FK   
Sbjct: 48  LLVHGYGASSMAYHRCF--APLSRHIRDLYAIDLPANGLSEAPPLVAEGEAPKAKFKIEE 105

Query: 201 DDIHSVQ----------------------------------DWFHERIHTWFEKRNLLNK 226
           +    VQ                                  D++ E I  W ++ NL   
Sbjct: 106 NKFTVVQGARRAAEPVTDAQVDQELMLRTHREKRRYLQQYEDYYVESIEQWRKENNL--- 162

Query: 227 PEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNS--------DV 278
            +K  ++ HS G YL   Y  KY    S  KL L SP G+  R+  S N+        ++
Sbjct: 163 -DKFNLVGHSFGGYLSYKYALKY--PESVNKLCLLSPLGME-RNIHSINNTFEENVVYEL 218

Query: 279 EKWKPPPWWYVKLWDKNISP-------FTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQ 331
           ++  P  + Y +   K  +P       F+++R     G K+   +    +  +    P Q
Sbjct: 219 QESDPSSYLYTR---KRKAPKFLFENQFSVLRWMGPIGDKLCLSFINSSYAKV----PSQ 271

Query: 332 SKR---FEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKY 388
           + +   FE+     +       + ++L + +L      R P+ + +   K  +V      
Sbjct: 272 AYKDYLFESFLGKKHFAKQNVHALKHLFTRSLLA----RDPIMDTIDKLKVPDV------ 321

Query: 389 EWVWLYGDDDWMDVNGG-LRVSKLLNDKLKQKS----SVITVPNAGHHLYLDNHKFFNTI 443
                YGD DWM+   G L V +L   ++   S    S + VP+AGH+L+LDN  +F+  
Sbjct: 322 --SVFYGDHDWMNSYAGYLMVERLKKFRVASTSGGSASYLEVPDAGHNLFLDNPDYFSKK 379

Query: 444 IMN 446
           ++ 
Sbjct: 380 LVQ 382

>Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar to
           Ashbya gossypii AGR062C
          Length = 405

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 86/353 (24%), Positives = 133/353 (37%), Gaps = 86/353 (24%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVH--AIDLPGYGFSS--------------RPK 193
           + +HGY      + +N   +    +E   H   IDLP  G S               +P+
Sbjct: 87  LLLHGYATSSMCYHRNMPQL----SEGIKHLYTIDLPANGLSKELPLELDIAKPIVFKPE 142

Query: 194 F-----PFKYP--------RDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSY 240
           F      F  P        R  I  ++D++ + I  W  K +L      N+V  HS G Y
Sbjct: 143 FNSVKSEFHIPYTIDGLHHRCAIQKLEDYYIDSIELWRRKNSL---GAINLV-GHSFGGY 198

Query: 241 LMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFT 300
           +   Y  KY  +   KKL L SP GV    +   N+    W+    + +   D +   F 
Sbjct: 199 ISFKYSIKYPQN--VKKLCLISPIGVERNIYSVHNN----WRSNCPYSIDYEDPSSKHFA 252

Query: 301 ---------------LVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSI 345
                          L+R     G+K+  GW Y      +N    +   F  L      I
Sbjct: 253 NKTMIPEFVFNEQTKLLRLMGPLGAKL--GWKY------INAVYSKVPNFLYLEFIFTLI 304

Query: 346 FNK-------RGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDD 398
           + K       R    YL + +L    +P L   E L   K            + LYG+ D
Sbjct: 305 YGKNVMTDTSRNIFTYLFTNSL-LARDPMLDSLEHLHVDK-----------LLMLYGEHD 352

Query: 399 WMDVNGGLRVSKLLNDKLKQKSSVITV-PNAGHHLYLDNHKFFNTIIMNEMQK 450
           W+    G  + +  N +    S  +TV P+A H+L+LDN  FFN  ++N +++
Sbjct: 353 WVRSQPGKMMVEEFNKQRSHPSGTLTVVPDASHNLFLDNPVFFNVALLNFLKE 405

>NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {ON} 
          Length = 396

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 84/359 (23%), Positives = 138/359 (38%), Gaps = 79/359 (22%)

Query: 139 PSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP------ 192
           P+  + D+   V IHGY A    + +      L  N   V+ IDLP    SS P      
Sbjct: 60  PAAAKVDVP-TVLIHGYAASSMAYYRTLA--TLSKNVKDVYVIDLPANSLSSVPPHSDIS 116

Query: 193 -------------------KFPFKYP----------RDDIHSVQDWFHERIHTWFEKRNL 223
                              K+ FK            +  I  +++++ + I  W      
Sbjct: 117 HLKINKIKVVQVSKDKENEKYVFKVAPPHAYDAQREKQVIDKLENYYLDVIEKWRRANYG 176

Query: 224 LNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVS------HRDFDSGNSD 277
           L+K     ++ HS G YL   Y  KY       KL L SP GV+      +  FD+    
Sbjct: 177 LDKFN---LVGHSFGGYLSFKYAIKY--PEVVDKLCLVSPLGVASNIRSVNNVFDTKKEY 231

Query: 278 VEKWKPPPWWYVKLWDKN-ISPFTLVRNSRQF-------GSKITSGWSYRRFKHILNGDP 329
           V   + P      L+++  + P  L  N           GSK+T  +    +  +   D 
Sbjct: 232 VMDLQNPGSM---LYNRQRMIPNFLFNNQLNVLKWMGPVGSKLTRKYINSAYVKVPTMD- 287

Query: 330 DQSKRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYE 389
                      Y Y  F + G  +  +    K      +  +  +    N N LK+ ++ 
Sbjct: 288 --------YKDYLYEYF-QMGVPQVNVDIFTKLFSRNLMARDPIM---DNMNRLKSTRF- 334

Query: 390 WVWLYGDDDWMDVNGGLRVSKLLN---DKLKQKSSVITVPNAGHHLYLDN-HKFFNTII 444
            + +YGD+DWMD   G  + + +N   +   +K++ + +P+AGH+L+LDN   F N +I
Sbjct: 335 -MMMYGDNDWMDKFSGYTLVQNINKIKNNFDRKATYVEIPDAGHNLFLDNPEDFSNNLI 392

>KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 415

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 75/334 (22%), Positives = 133/334 (39%), Gaps = 59/334 (17%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFS-------------------S 190
           + +HGY A    F +NFE +     +  ++AIDLP  G S                   S
Sbjct: 100 LLLHGYAASSMAFHRNFEGLSKCIRD--LYAIDLPANGLSPPQPLEIRCTEPQPLKIEIS 157

Query: 191 RPKFPFKYPRDDIH------SVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMAL 244
              F   Y  + +H      + +D++ + +  W     L NK     ++AHS G Y+   
Sbjct: 158 NDTFKLPYTINSLHHKSAIQNFEDYYLDALEQW----RLDNKLGPINIVAHSFGGYISFR 213

Query: 245 YLQKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVRN 304
           Y  KY    + K+L L SP GV    F   N+    W+    + +  ++   S F + + 
Sbjct: 214 YAVKYPH--AVKRLCLLSPLGVERNIFSVNNN----WRSNTQYKLD-FENPASKFYIRKG 266

Query: 305 SR------QFGSKITSGWSYRRFKHILNGDPDQSKRFEAL--HRYAYSIFNKRG----SG 352
                   +  +K+  G      +   N       R  +L   +Y + +F  +     + 
Sbjct: 267 PAIPPAIFELQTKVLRGLGPLGARLCWNYITAAYARVPSLKYKQYIFEMFYGKNALTQTS 326

Query: 353 EYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLL 412
           + + +         R PL + L + ++  +L         +YGD DWM+   GL +    
Sbjct: 327 KDIFTGLFTNRLLARDPLLDSLCHVRSKKLL--------LMYGDHDWMNRKAGLEMVTEA 378

Query: 413 NDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMN 446
             KL   +    V ++GH+L+LDN +  N +I++
Sbjct: 379 K-KLGIDAQYGEVSSSGHNLFLDNPEESNELIVS 411

>ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 380

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 81/342 (23%), Positives = 127/342 (37%), Gaps = 82/342 (23%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSR------------------ 191
           + IHGY A    + + F+   L +    ++ IDLP  G S                    
Sbjct: 62  LLIHGYAASSMAYYRTFQG--LTDKISDLYTIDLPSNGLSKELPLILDGQTPPPLKVEIH 119

Query: 192 ---PKFPF------KYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLM 242
               KF        ++ R  +   +D++ + I  W  K N + +     ++ HS G Y+ 
Sbjct: 120 KDGSKFKIIERVDAEHCRSVVKQYEDYYLDSIELW-RKHNGIGRFN---LVGHSFGGYIA 175

Query: 243 ALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNS-------DVEKWKPPPWWYVKLWDKN 295
             Y  KY    + ++L L SP GV    +   N        ++E   P    Y K W+  
Sbjct: 176 FKYAVKY--PKAVEQLGLISPLGVESNIYSVNNDWKLDTVYEMESTDPASRMYGKNWEIP 233

Query: 296 ISPFT----LVRNSRQFGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGS 351
              F     L+R     G+K+   W+Y                       AY+       
Sbjct: 234 KVLFERQTELLRWMGPIGAKLC--WNYITA--------------------AYNKLPTMEY 271

Query: 352 GEYLLSFALKCGGEPRLPLEEQLFNGKNANVL-----------KNAKYEWVWLYGDDDWM 400
            +Y+       GG P+     ++F G     L           K    + + LYGD DWM
Sbjct: 272 KDYVFELLYGNGGIPKTA--RKVFGGLFTRSLLARDPIMDSMDKLGARKVLLLYGDSDWM 329

Query: 401 DVNGGLRVSKLLNDKL-KQKSSVITVPNAGHHLYLDNHKFFN 441
           +   G R+ +LLN K  K  ++   VP+A H+L+LDN   FN
Sbjct: 330 NNYAGYRMVELLNQKRGKGYATYDEVPDARHNLFLDNPDSFN 371

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 91/387 (23%), Positives = 139/387 (35%), Gaps = 125/387 (32%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKF--------------- 194
           V IHGY A    + K F    L  +   ++ IDLPG+G S+ PK                
Sbjct: 54  VLIHGYAASSMAYYKTFR--YLTGSIKDLYTIDLPGFGLSASPKIIINDHNRKKSQFDIK 111

Query: 195 ----------PFKYPRDD--------------IHSVQDWFHERIHTWFEKRNLLNKPEKN 230
                      F   + +              I +  D++ +RI  W +  NL     K 
Sbjct: 112 LIDSKDSNNNKFSISKKNLKLLENGNIEDKAFISAFDDYYIDRIEKWRKFNNL----GKI 167

Query: 231 IVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDF------------------- 271
            V+ HS G Y+   Y  KY    S + L L SP G+    +                   
Sbjct: 168 NVIGHSFGGYISFKYAIKYP--DSIENLCLVSPFGMESNVYSINNYDDWKEKFSNPSSTR 225

Query: 272 ---------------DSG------NSDVEKW------KPPPWWYVKLWDKNISPFTLVRN 304
                          DSG      NSD +         P   +Y +   + + P  L  N
Sbjct: 226 TSSVSSLGSSNSILNDSGTKIFKTNSDTDTQLELDLVDPTSKYYFR---EKVVPGVLFNN 282

Query: 305 SRQ-------FGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYL-L 356
                      GSK+T  +  RR++HI +         EA   + + +F    +      
Sbjct: 283 QFNVLKCMGPLGSKLTWSFISRRYEHIAS---------EAYQNFLFKLFATVPNVTINNF 333

Query: 357 SFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKL 416
           S         + P+ + +      N L++ K   +  YG++DWM+   G  +++ LN  L
Sbjct: 334 SNMFTRNLLAKDPIMDSI------NKLQSKK--LLLFYGENDWMNKEAGFLMAEKLN-IL 384

Query: 417 KQKSSV---ITVPNAGHHLYLDNHKFF 440
           K  S     I VPN+GH+L LD+ KFF
Sbjct: 385 KGDSKYANWIEVPNSGHNLILDDPKFF 411

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 84/348 (24%), Positives = 138/348 (39%), Gaps = 83/348 (23%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFS----------SRPK------ 193
           + IHGY A    F +NFE + L   +  V+A+DLPG G S           +P       
Sbjct: 90  LMIHGYAASSMTFFRNFEQLSLSLKD--VYAVDLPGNGLSKELPLSVDSMQKPDRVEFNE 147

Query: 194 ------FPFKYPRDD------IHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYL 241
                 F  + P D+      +   +D++ + +  W ++    NK  K  ++ HS G YL
Sbjct: 148 TVKGQYFRLQNPVDEEKYKKHLAHYEDYYVDALEKWRKE----NKLSKINLVGHSYGGYL 203

Query: 242 MALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGNS-------DVEKWKPPPWWYVKLWDK 294
              Y  KY    +  KL L SP GV    F   N        +++   P    Y     +
Sbjct: 204 TFKYSLKY--PDNVHKLCLVSPLGVERSIFSIHNHLEPERDYEIQSEDPSKSNYSN--KR 259

Query: 295 NISPFTLVRNSRQ------FGSKITSGW---SYRRFKHILNGDPDQSKRFE------ALH 339
           NI    L   ++        G+K   G+   SY R   +    P +   F+       + 
Sbjct: 260 NIPKLILQYQNKALRWMGPLGAKACWGYVNSSYGRVPSV----PYREYVFQLVFGKGIMT 315

Query: 340 RYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYEWVWLYGDDDW 399
             +  IFN+  S   LL++          P+ + L   K + ++         +YG+ DW
Sbjct: 316 DTSIRIFNQLFS-RSLLAYD---------PIMDSLDKVKVSKLM--------LVYGEHDW 357

Query: 400 MD-VNGGLRVSKLLNDKLKQKSSVITVPNAGHHLYLDNHKFFNTIIMN 446
           M+ V G L + +  + +     +   V  AGH+L LDN   FN+ +++
Sbjct: 358 MNKVAGRLAIEEFNSIRKSYDGTFDIVSRAGHNLVLDNPSEFNSKLVD 405

>KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.284
           YDR125C
          Length = 434

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 77/353 (21%), Positives = 133/353 (37%), Gaps = 98/353 (27%)

Query: 149 LVFIHGYGAGLGFFIKNFEDIPLLNNEWC--VHAIDLPGYGFSSRPKF------------ 194
           ++ IHGY +    + +NF  +    +  C  V+AIDLP  G S                 
Sbjct: 111 VLLIHGYASSSMSYFRNFRGL----SSQCKDVYAIDLPANGLSREISLSEDADLKDLVKY 166

Query: 195 -----------------PF--KYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAH 235
                            P+  K     +  ++D++ + I  W     + N+ ++  ++ H
Sbjct: 167 SLQVKGLDSPGQVKVTKPYNNKLCATQLRILEDYYVDEIERW----RVENQIDQLHLVGH 222

Query: 236 SLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHRDFDSGN------------------SD 277
           S G Y+   Y  KY    +  KL L SP GV    +   N                  S 
Sbjct: 223 SFGGYISYKYALKY--PQNVMKLALISPLGVERNLYSVNNHLPQDSIVQGTFEDPSSPSY 280

Query: 278 VEKWKPPPWWYVKLWDKNISPFTLVRNSRQFGSK-----ITSGWS---YRRFKHILNGDP 329
           + K + P + +        +   ++R     G++     ITS ++    R FK  L    
Sbjct: 281 LRKLEVPRYIFE-------NQLKILRWGGPMGARLCWNYITSAYAKVPSREFKEYL---- 329

Query: 330 DQSKRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNGKNANVLKNAKYE 389
                FE    Y      K     ++L F        R P+ + +   K  +V+      
Sbjct: 330 -----FELF--YGDGGITKTALTTFILLFTRNLLA--RDPIMDSIAELKVKDVM------ 374

Query: 390 WVWLYGDDDWMDVNGGLRVSKLLNDKLKQKSSV-ITVPNAGHHLYLDNHKFFN 441
             + YG  DWM+ N G R ++LL  +    S++ + +P +GH+L+LD+ + FN
Sbjct: 375 --FQYGQYDWMNKNAGARAAELLRKQPYNNSALYLEIPESGHNLFLDSPQSFN 425

>AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR099C
           (ICT1) and YDR125C (ECM18)
          Length = 384

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 28/120 (23%)

Query: 339 HRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNG--KNANVLKNAKYEWV----- 391
           HRY +++ ++          AL+       PL  +LF G   NA + ++   + +     
Sbjct: 277 HRYTFALLHR---------LALR-------PLPRKLFTGLFTNALLARDPLLDSLAELKV 320

Query: 392 ----WLYGDDDWMDVNGGLRVSKLLND-KLKQKSSVITVPNAGHHLYLDNHKFFNTIIMN 446
                LYGD DWMD   G  +   LN  + +  +S+  VP AGH+L+LDN + F++ +++
Sbjct: 321 PNVQLLYGDHDWMDARAGRALVAELNALRGRPDASLAIVPAAGHNLFLDNPEDFHSWLLD 380

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 8/126 (6%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDW 209
           +FIHG G  L  F+   +   L N  +   A+DLPG+G  S     +      + S+  +
Sbjct: 93  IFIHGLGGSLEQFLPLLKLTDLSNKSFI--AVDLPGFG-QSEFNDEYNIANYSMSSIIGF 149

Query: 210 FHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSHR 269
              ++ + +     L    K I+  HS+G YL   + Q+Y+     +K++L +P      
Sbjct: 150 LKSQVFSRY-----LTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAPPNPHET 204

Query: 270 DFDSGN 275
             D  N
Sbjct: 205 RLDKSN 210

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 86/217 (39%), Gaps = 34/217 (15%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSR-PKFPFKYPRDDIHSVQD 208
           +FIHG G  LG F        L   ++    +DLPG+G S     +  K   + I SV D
Sbjct: 85  LFIHGLGGSLGQFEPLLRLTHLKGKKFL--TLDLPGFGQSDELESYSMKSVIETIRSVVD 142

Query: 209 WFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSP----- 263
                + T  +K    N   K I+  HS+G YL   + + Y  +   +K+ L SP     
Sbjct: 143 -----LATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSPPKPIM 197

Query: 264 AGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFT--LVRNSRQFGSKITSGWSYRRF 321
             +S R++              W    LW     PF   L RN       ++S    R F
Sbjct: 198 TSLSKRNY--------------WTQWALWGVFKLPFIFDLYRNYFDQTRGLSSSGMKRFF 243

Query: 322 KHILNGDP-DQSKRFEALHRYAYSIFNK-RGSGEYLL 356
               N DP D   R+  L ++  ++ NK R    YLL
Sbjct: 244 ---FNNDPNDYDLRYRKLWQFHSNVQNKSRSVVGYLL 277

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 54/118 (45%), Gaps = 17/118 (14%)

Query: 149 LVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFS--SRPKFPFKYPRDDIHSV 206
            + IHG G  +  F    + + LL  ++ V A+DLPG+G S  S   +   Y    +  V
Sbjct: 78  FLLIHGLGGSMDQFQPLMKLLTLL--KYRVIALDLPGFGQSGSSTNGYDMLYVTSVVKKV 135

Query: 207 QDWFHERIHTWFEKRNLLNKPEKNI-VMAHSLGSYLMALYLQKYEGSPSFKKLILCSP 263
            D             N+ NK + +  V+ HS+G Y+ + ++Q Y    +  KL+L  P
Sbjct: 136 VD------------NNIENKTDIDFKVVGHSMGCYIASHFVQMYHEEYNIDKLVLTCP 181

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 51/117 (43%), Gaps = 16/117 (13%)

Query: 149 LVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQD 208
            +FIHG G  L  F     ++   N  +   A DLPG+G S       +YP  D+    D
Sbjct: 81  FLFIHGLGGTLEQFEPVLRELDQRNKSFL--AFDLPGFGKSDEWD---QYPMLDVVKSID 135

Query: 209 WFHERI--HTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSP 263
           W   ++  +  FEK NL+          HS+G YL   +   +  S    +L+L +P
Sbjct: 136 WLIHQLTNNLKFEKLNLI---------GHSMGCYLAVHFYLLFHESWCISRLVLLAP 183

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 56/119 (47%), Gaps = 22/119 (18%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLN----NEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHS 205
           +FIHG G  L    + FE  PLL     NE    A+DLPG+G S   +    Y   D+ S
Sbjct: 93  LFIHGLGGVL----EQFE--PLLRLLDLNENKFLALDLPGFGKSDEYE---DYNMFDVIS 143

Query: 206 VQDWFHERIHTWFEKRNLLNKPEKNIVMA-HSLGSYLMALYLQKYEGSPSFKKLILCSP 263
           +       IHT  + R +  +   NIV+  HS+G Y+      K     SFKKL+  SP
Sbjct: 144 I-------IHTIVD-RLIPERTTSNIVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSP 194

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 53/115 (46%), Gaps = 17/115 (14%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQDW 209
           VFIHG G  L  F    + + LLN  +   ++DLPG+G S                V+ +
Sbjct: 133 VFIHGLGGTLAQFEPLLKLLSLLNKGF--FSMDLPGFGSSDE--------------VESY 176

Query: 210 FHERIHTWFEKRNLLNKPEKNIVM-AHSLGSYLMALYLQKYEGSPSFKKLILCSP 263
               I    +K      P +N+V+  HS+G YL   +   ++   SF++L+L +P
Sbjct: 177 GMLEIVAIVQKTFAKLTPSRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAP 231

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 18/116 (15%)

Query: 149 LVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSR-PKFPFKYPRDDIHSVQ 207
            +FIHG G  L  F      +  ++  +   A+DLPG+G S    ++P     + I  + 
Sbjct: 86  FLFIHGLGGELEQFEPLLRLVDAMDQRFL--ALDLPGFGKSDEWDEYPMLKVVETIEEIA 143

Query: 208 DWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSP 263
             F+                 K +++ HS+G YL + + + Y    S  +++L SP
Sbjct: 144 AKFN---------------AAKIVLVGHSMGCYLTSHFYEAYHKVHSINRIVLLSP 184

>KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {ON}
           similar to uniprot|P53750 Saccharomyces cerevisiae
           YNR064C
          Length = 294

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 66/161 (40%), Gaps = 29/161 (18%)

Query: 149 LVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQD 208
           +V +HGY      F      IPL+++++ V A DLPG+GF+  P        +D H   D
Sbjct: 33  IVLLHGYPTSSTMFRHL---IPLISDKFHVIAPDLPGFGFTEVP--------EDYHYSFD 81

Query: 209 WFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPAGVSH 268
                +  + ++ N+                   A+Y+  Y GSP   +L L  P+ ++ 
Sbjct: 82  NLAATVREFLKEINVTR----------------FAIYVFDY-GSPVGFRLALKDPSSITG 124

Query: 269 RDFDSGNSDVEKWKPPPWWYV-KLWDKNISPFTLVRNSRQF 308
               +GN+  E      W ++ K W    +    V+   QF
Sbjct: 125 IVTQNGNAYEEALGDEFWGFIKKYWQTTQTDPVFVKPLSQF 165

>Skud_14.400 Chr14 complement(717609..718490) [882 bp, 293 aa] {ON}
           YNR064C (REAL)
          Length = 293

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 71/165 (43%), Gaps = 33/165 (20%)

Query: 149 LVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP---KFPFKYPRDDIHS 205
           +V +HG+ +    F +N   IPLL +++ V A DLPG+GFS  P    F F    D +  
Sbjct: 32  IVLLHGFPSSSNMF-RNL--IPLLASQFHVIAPDLPGFGFSETPDDYTFSFDALSDTVGY 88

Query: 206 VQDWFHERIHTWFEK----------RNLLNKPEK-NIVMAHSLGSYLMAL---------- 244
           + D    +I  +F            R  L  P K   +++ +  +Y   L          
Sbjct: 89  LLDAL--KIEKYFVYIFDYGSPVGFRLALKNPSKITAIISQNGNAYEEGLDDRFWGPLKA 146

Query: 245 YLQKYEGSPSFKKLI---LCSPAGVSHRDFDSGNSDVEKWKPPPW 286
           Y + Y+  P+F + +   +  PA V  + +  G +D+E   P  +
Sbjct: 147 YWKSYQSDPAFVEALSSYVQDPANVISQ-YHDGVADIEAVDPAAY 190

>CAGL0F00275g Chr6 (33830..35044) [1215 bp, 404 aa] {ON} highly
           similar to uniprot|P32458 Saccharomyces cerevisiae
           YJR076c CDC11 septin
          Length = 404

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 247 QKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVRNS 305
           + YE +   + L+  S  G S+  FD GNS + + +  PW  + + D +IS F ++RN+
Sbjct: 212 EDYETNTYLRSLLPFSVIG-SNEVFDVGNSTMIRGRKYPWGMLDVEDTSISDFVVLRNA 269

>Suva_14.424 Chr14 complement(736902..737771) [870 bp, 289 aa] {ON}
           YNR064C (REAL)
          Length = 289

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 149 LVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP---KFPFKYPRDDIHS 205
           +V +HG+      F +N   IPLL   + V A DLPG+GFS  P   KF F    D I  
Sbjct: 32  IVLLHGFPTSSNMF-RNL--IPLLAGHFHVIAPDLPGFGFSETPDDYKFTFGALSDTIGY 88

Query: 206 VQD 208
           + D
Sbjct: 89  LLD 91

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 48/116 (41%), Gaps = 14/116 (12%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLN-NEWCVHAIDLPGYGFSSR-PKFPFKYPRDDIHSVQ 207
           +FIHG G  L  F   F  + LL+ +E    AIDLPG+G S     +P       I +V 
Sbjct: 86  IFIHGLGGSLDQF---FPLLKLLDLSEKYFVAIDLPGFGKSDEHTDYPMIQVVKHIDAVI 142

Query: 208 DWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSP 263
                     F+   L+          HS+G YL   ++  +       K++L +P
Sbjct: 143 SELLNEARLAFDTVRLI---------GHSMGCYLTLHFMTLFSKKYRIGKVVLLAP 189

>TDEL0G00150 Chr7 complement(22315..23214) [900 bp, 299 aa] {ON} 
          Length = 299

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 64/146 (43%), Gaps = 45/146 (30%)

Query: 149 LVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIHSVQD 208
           ++ +HG+ +    F +N   IPLL   + V A D+PG+GF+       +YP D       
Sbjct: 38  ILLLHGFPSSSNMF-RNL--IPLLAARFYVVAPDIPGFGFT-------EYPED------- 80

Query: 209 WFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYE------GSPSFKKLILCS 262
             +E     F   NL N          S+  +L AL ++KY       G+P   +L L S
Sbjct: 81  --YE-----FNFANLTN----------SIEQFLKALNIKKYSVYVFDYGAPIGFRLALKS 123

Query: 263 PAGVSHRDFDSGNS-----DVEKWKP 283
           P+ ++     +GN+     D   W+P
Sbjct: 124 PSAITGIVVQNGNAYDEGLDDRFWEP 149

>Kwal_27.10170 s27 complement(227197..228078) [882 bp, 293 aa] {ON}
           YNR064C - Hypothetical ORF [contig 41] FULL
          Length = 293

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 59/135 (43%), Gaps = 28/135 (20%)

Query: 145 DLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDIH 204
           D   ++ +HGY      F +N   IPL+   + V A DLPG+GF++  + PF        
Sbjct: 29  DKPTILLLHGYPTSSNMF-RNL--IPLIAASFHVVAPDLPGFGFTTMDE-PFS------- 77

Query: 205 SVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFKKLILCSPA 264
                        F   NL N    + V A  L  Y+  +Y+  Y G+P   +L L +P 
Sbjct: 78  -------------FSFENLANTI-ADFVRAMQLSKYI--IYIFDY-GAPVGLRLALKNPK 120

Query: 265 GVSHRDFDSGNSDVE 279
            V+     +GN+ +E
Sbjct: 121 AVAGLIVQNGNAYLE 135

>NCAS0G03550 Chr7 complement(664516..665736) [1221 bp, 406 aa] {ON}
           Anc_1.531
          Length = 406

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 247 QKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVRNS 305
           + YE +   K L+  S  G S+  +D GN    + +  PW  + + D N+S F ++RN+
Sbjct: 212 EDYETNMYLKSLLPFSIIG-SNEVYDMGNDLAIRGRKYPWGMIDVEDANVSDFVILRNA 269

>NDAI0C02560 Chr3 complement(594150..595439) [1290 bp, 429 aa] {ON}
           Anc_1.531
          Length = 429

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 249 YEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVRNS 305
           YE +   + L+  S  G S+  +D GN  + + +  PW  + + D NIS F ++RN+
Sbjct: 214 YETNMYLRSLLPFSIIG-SNEVYDMGNDLIIRGRKYPWGMLDVEDANISDFVILRNA 269

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 52/129 (40%), Gaps = 9/129 (6%)

Query: 150 VFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFKYPRDDI-HSVQD 208
           VF+ G G  L  +      + +LN ++     DLPG+G S        Y    + H + +
Sbjct: 98  VFLPGLGGSLDQYEPLLRLMDILNEKFI--GFDLPGFGGSEEDTSEGGYNMIKVCHIINE 155

Query: 209 WFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQKYEGSPSFK--KLILCSPAGV 266
                I   +  R+ +       ++ HS+G YL+  +   ++    +K  +LIL SP   
Sbjct: 156 ALQSIITQNYSTRDTIELR----LVGHSMGCYLVLHFFNSFQTKTEYKISQLILTSPPKK 211

Query: 267 SHRDFDSGN 275
                D  N
Sbjct: 212 KIEPLDKNN 220

>Kpol_1018.187 s1018 complement(470763..471986) [1224 bp, 407 aa]
           {ON} complement(470763..471986) [1224 nt, 408 aa]
          Length = 407

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 247 QKYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVRNS 305
           + YE +   + L+  S  G S+  FDSG+  + + +  PW  + + D ++S F ++RN+
Sbjct: 212 EDYETNMYLRSLLPFSIIG-SNDVFDSGDGTLIRGRKYPWGIIDVEDSSVSDFVVLRNA 269

>TBLA0B10100 Chr2 complement(2430756..2431946) [1191 bp, 396 aa]
           {ON} Anc_1.531 YJR076C
          Length = 396

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 8/93 (8%)

Query: 249 YEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVRNSRQF 308
           YE +   + L+  S  G S+  FD G+  + + +  PW  + + D +IS F ++RN+   
Sbjct: 214 YETNTYLRSLLPFSIIG-SNDVFDIGDGTIIRGRQYPWGILDVEDADISDFVILRNTLLI 272

Query: 309 G-----SKITSGWSYRRFK-HILNGD-PDQSKR 334
                  + T    Y R++   L+GD P+ SK+
Sbjct: 273 SHLSDLKEFTHEILYERYRTEALSGDTPNYSKK 305

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 9/84 (10%)

Query: 180 AIDLPGYGFSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGS 239
           AIDLPG+G S        Y    I ++ D   E +         +N      VM HS+G+
Sbjct: 112 AIDLPGFGKSEDYS---NYSMTHIATLIDQMLETVIGTAPDNYKIN------VMGHSMGT 162

Query: 240 YLMALYLQKYEGSPSFKKLILCSP 263
           +L   + + +    + +KLIL SP
Sbjct: 163 HLALHFYELFNKKYTVEKLILVSP 186

>Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON}
           (14238..15287) [1050 nt, 350 aa]
          Length = 349

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 26/120 (21%)

Query: 150 VFIHGYGAGLGFFIKNFEDI-PLLN----NEWCVHAIDLPGYGFSSRPKFPFKYPRDDIH 204
           +FIHG G        NFE   PLL     ++     +DLPG+G S   +    Y   DI 
Sbjct: 86  LFIHGLGG-------NFEQFEPLLRLVDASDKKFLTMDLPGFGKSDELE---SYGMFDII 135

Query: 205 SVQDWFHERIHTWFEKRNLLNKPEKNI-VMAHSLGSYLMALYLQKYEGSPSFKKLILCSP 263
            V ++  ++            K  K+I V+ HS+G  L   +++K+    +  +L+L +P
Sbjct: 136 EVINYVAKKFI----------KDGKSINVIGHSMGCLLSIHFMEKFSKELNITQLVLLTP 185

>YNR064C Chr14 complement(749136..750008) [873 bp, 290 aa] {ON}
           Epoxide hydrolase, member of the alpha/beta hydrolase
           fold family; may have a role in detoxification of
           epoxides
          Length = 290

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 3/45 (6%)

Query: 149 LVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPK 193
           ++ +HG+      F +N   IPLL  ++ + A DLPG+GF+  P+
Sbjct: 32  ILLLHGFPTSSNMF-RNL--IPLLAGQFHIIAPDLPGFGFTETPE 73

>KLLA0C11561g Chr3 complement(997866..998933) [1068 bp, 355 aa] {ON}
           no similarity
          Length = 355

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 60/157 (38%), Gaps = 27/157 (17%)

Query: 188 FSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQ 247
           F  R  FPF  P+     ++    + ++T+  +  +L +  K I+       Y  AL   
Sbjct: 105 FKERTGFPFSDPK----HMRKRMDQIVYTFKTQGEMLPENVKQII-----SEYNTALEAA 155

Query: 248 KYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVRNSRQ 307
           K   S + K+L L  P  +   +  +GNS  E                     +V NS +
Sbjct: 156 KQRDSSNRKRLSLMEPLEIDDGNI-TGNSSDE-----------------DSHAMVSNSNK 197

Query: 308 FGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYS 344
            G +  S  S   F H  + +P Q +    LHR + S
Sbjct: 198 IGIRNNSLSSSSHFYHHNHHNPQQQRIHNDLHRLSSS 234

>ZYRO0C14696g Chr3 (1144384..1146333) [1950 bp, 649 aa] {ON} similar
           to uniprot|P53135 Saccharomyces cerevisiae YGL113W SLD3
           Protein that interacts with Cdc45p in initiation of DNA
           replication gene exhibits synthetic lethality with
           dpb11-1
          Length = 649

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 20  LKGFQLLTGASSSSTQPESGETSIKDAAEKRILR---TPSAPTAIP 62
           LKG  L +  +S  T PE G +S+ DA  + + R   TPS+P   P
Sbjct: 409 LKGPSLKSRKTSERTVPERGSSSLADARHESVSRLSSTPSSPQLTP 454

>Kwal_23.4168 s23 (600899..602893) [1995 bp, 664 aa] {ON} YLR401C -
           Hypothetical ORF [contig 1] FULL
          Length = 664

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 9/84 (10%)

Query: 274 GNSDVEKWKPPPWWYVKLWDKNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDPDQSK 333
           GN DV  ++    WY  L DKNI    + R +      +   W +   +   + D    +
Sbjct: 508 GNGDVNNFED---WYKHLEDKNIDSVMVARGA------LVKPWIFEEVEAQQHLDKSSKE 558

Query: 334 RFEALHRYAYSIFNKRGSGEYLLS 357
           R + L  YA    +  G+ EY +S
Sbjct: 559 RLDMLKDYARFAMDHWGTDEYGIS 582

>TBLA0D05160 Chr4 complement(1272860..1273819) [960 bp, 319 aa] {ON}
           Anc_1.329 YJL053W
          Length = 319

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 378 KNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKL 411
           K A++ K  K+ WVWLYG D   D   G +  KL
Sbjct: 153 KGADISKTKKF-WVWLYGKDKGADETNGGKAIKL 185

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,704,497
Number of extensions: 2684100
Number of successful extensions: 5899
Number of sequences better than 10.0: 82
Number of HSP's gapped: 5852
Number of HSP's successfully gapped: 107
Length of query: 451
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 338
Effective length of database: 40,524,141
Effective search space: 13697159658
Effective search space used: 13697159658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)