Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.203.564ON1008100847450.0
Skud_7.263.564ON1015101036060.0
YGL241W (KAP114)3.564ON1004100835870.0
Smik_7.203.564ON1004100835590.0
NCAS0F039503.564ON1012101925690.0
NDAI0B062603.564ON1013102524830.0
KAFR0J001903.564ON1012103523160.0
TDEL0D063203.564ON1018102222390.0
KNAG0D029403.564ON1009102322020.0
CAGL0H07777g3.564ON1021101922000.0
Kpol_380.63.564ON1002100521360.0
ZYRO0E09460g3.564ON1009101020980.0
TBLA0E002403.564ON1010102520610.0
TPHA0G036303.564ON1022102520270.0
SAKL0F00880g3.564ON1009101619950.0
Ecym_25943.564ON1019102117890.0
Kwal_47.192583.564ON1011101217440.0
AFR269W3.564ON1017101617220.0
KLTH0G00792g3.564ON1021101216950.0
KLLA0A00803g3.564ON9526314514e-45
NDAI0E021708.624ON10291341085e-04
TDEL0A057008.624ON10311371076e-04
Kwal_47.192473.561ON9592571010.003
NCAS0C014308.624ON1029136970.009
TPHA0F031608.624ON1031114960.011
SAKL0H07876g8.624ON1032126960.013
Smik_6.3248.624ON1032124900.060
TBLA0G013504.180ON86583880.089
Skud_16.1558.624ON1032126880.10
YPL125W (KAP120)8.624ON1032152880.11
Ecym_83098.624ON1027122870.15
Suva_16.1858.624ON1032126860.16
ACR159C8.624ON1025152850.24
Ecym_25903.561ON955221840.27
CAGL0J06776g8.624ON1027143840.34
KAFR0H027008.624ON1041136840.34
KNAG0J014208.624ON1053123820.46
Kwal_26.85958.624ON1034155820.50
Kpol_530.128.624ON1030125801.00
KLLA0D06633g8.624ON1023126781.8
YJL025W (RRN7)5.183ON514105752.8
KLTH0G00858g3.561ON959234735.5
YDR251W (PAM1)8.484ON83039727.5
TBLA0J004708.624ON1036124727.5
ACL187W4.180ON861137727.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.20
         (1008 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (R...  1832   0.0  
Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (R...  1393   0.0  
YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}  KAP114Karyo...  1386   0.0  
Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (R...  1375   0.0  
NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {...   994   0.0  
NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa]...   961   0.0  
KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.5...   896   0.0  
TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa]...   867   0.0  
KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {...   852   0.0  
CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} simil...   852   0.0  
Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON} ...   827   0.0  
ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...   812   0.0  
TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.56...   798   0.0  
TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {...   785   0.0  
SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar...   773   0.0  
Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {...   693   0.0  
Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa...   676   0.0  
AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic h...   667   0.0  
KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar...   657   0.0  
KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar ...   178   4e-45
NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {...    46   5e-04
TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]...    46   6e-04
Kwal_47.19247 s47 complement(1151230..1154109) [2880 bp, 959 aa]...    44   0.003
NCAS0C01430 Chr3 complement(262823..265912) [3090 bp, 1029 aa] {...    42   0.009
TPHA0F03160 Chr6 complement(690476..693571) [3096 bp, 1031 aa] {...    42   0.011
SAKL0H07876g Chr8 (674192..677290) [3099 bp, 1032 aa] {ON} highl...    42   0.013
Smik_6.324 Chr6 complement(507726..510824) [3099 bp, 1032 aa] {O...    39   0.060
TBLA0G01350 Chr7 complement(361561..364158) [2598 bp, 865 aa] {O...    39   0.089
Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL12...    39   0.10 
YPL125W Chr16 (313388..316486) [3099 bp, 1032 aa] {ON}  KAP120Ka...    39   0.11 
Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON...    38   0.15 
Suva_16.185 Chr16 (322908..326006) [3099 bp, 1032 aa] {ON} YPL12...    38   0.16 
ACR159C Chr3 complement(631643..634720) [3078 bp, 1025 aa] {ON} ...    37   0.24 
Ecym_2590 Chr2 complement(1149034..1151901) [2868 bp, 955 aa] {O...    37   0.27 
CAGL0J06776g Chr10 (651309..654392) [3084 bp, 1027 aa] {ON} high...    37   0.34 
KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8....    37   0.34 
KNAG0J01420 Chr10 complement(260385..263546) [3162 bp, 1053 aa] ...    36   0.46 
Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {...    36   0.50 
Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON} (33954.....    35   1.00 
KLLA0D06633g Chr4 complement(568539..571610) [3072 bp, 1023 aa] ...    35   1.8  
YJL025W Chr10 (393967..395511) [1545 bp, 514 aa] {ON}  RRN7Compo...    33   2.8  
KLTH0G00858g Chr7 (59340..62219) [2880 bp, 959 aa] {ON} similar ...    33   5.5  
YDR251W Chr4 (960614..963106) [2493 bp, 830 aa] {ON}  PAM1Essent...    32   7.5  
TBLA0J00470 Chr10 (85713..88823) [3111 bp, 1036 aa] {ON} Anc_8.6...    32   7.5  
ACL187W Chr3 (30322..32907) [2586 bp, 861 aa] {ON} Syntenic homo...    32   7.7  

>Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (REAL)
          Length = 1008

 Score = 1832 bits (4745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 927/1008 (91%), Positives = 927/1008 (91%)

Query: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60
            MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS
Sbjct: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60

Query: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISA 120
            LRKLITMYWSPGFESYRSTSNVDLNVKESIR             TKIKNGASYCIVQISA
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIREALLNLCLNANENTKIKNGASYCIVQISA 120

Query: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180
            VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL
Sbjct: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180

Query: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVN 240
            TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQC                VN
Sbjct: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCLSTSLQTLGQLLTLDLVN 240

Query: 241  EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTEN 300
            EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTEN
Sbjct: 241  EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTEN 300

Query: 301  EDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYFV 360
            EDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYFV
Sbjct: 301  EDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYFV 360

Query: 361  SKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSNHQTLESLLYLLQCIL 420
            SKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSNHQTLESLLYLLQCIL
Sbjct: 361  SKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSNHQTLESLLYLLQCIL 420

Query: 421  LNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIKSL 480
            LNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIKSL
Sbjct: 421  LNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIKSL 480

Query: 481  TSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXXXXXXXXXX 540
            TSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEV           
Sbjct: 481  TSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVQQNIIQIINEI 540

Query: 541  SDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVVQSQE 600
            SDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVVQSQE
Sbjct: 541  SDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVVQSQE 600

Query: 601  CLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKPSS 660
            CLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKPSS
Sbjct: 601  CLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKPSS 660

Query: 661  EFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMKVLER 720
            EFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMKVLER
Sbjct: 661  EFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMKVLER 720

Query: 721  LLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFSVL 780
            LLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFSVL
Sbjct: 721  LLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFSVL 780

Query: 781  CFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGERRIKENIIALIKLFLLD 840
            CFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGERRIKENIIALIKLFLLD
Sbjct: 781  CFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGERRIKENIIALIKLFLLD 840

Query: 841  DARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGFQNKQPNP 900
            DARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGFQNKQPNP
Sbjct: 841  DARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGFQNKQPNP 900

Query: 901  EQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXXXXXXXXXXXIT 960
            EQLITT                           VLDYEKLKDYI              IT
Sbjct: 901  EQLITTDIAKDAANNDNDDDNDADNDDWEDVDDVLDYEKLKDYIGDDVDGGEEDDSEDIT 960

Query: 961  GLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008
            GLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL
Sbjct: 961  GLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008

>Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (REAL)
          Length = 1015

 Score = 1393 bits (3606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 722/1010 (71%), Positives = 821/1010 (81%), Gaps = 7/1010 (0%)

Query: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60
            MDI+ LI  AQSADNHTRE AEAQLLQWCDSDASQ+FT+L + AL  Q++LQSRQFALLS
Sbjct: 11   MDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTALVNAALQQQSALQSRQFALLS 70

Query: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISA 120
            LRKLITMYWSPGFESYRSTSNVD+ VKE IR             T+IKNGASYCIVQISA
Sbjct: 71   LRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISA 130

Query: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180
            VDFPDQWPQLL+VIYD IS+ HS+NAM LLNEIYDDVVSEEMFFEGGIGLET EIIFKVL
Sbjct: 131  VDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVL 190

Query: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVN 240
              E S+LVAKIAALKL KACL QMSSH+ H +ESR +F++QC                 N
Sbjct: 191  VAETSSLVAKIAALKLLKACLLQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDN 250

Query: 241  EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGP--T 298
            EDV  Q K +SIIYENLVFIKN+FSKKHF ++ Q  FKLVAI+DLKNI+ ++ ND     
Sbjct: 251  EDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDYP 310

Query: 299  ENEDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNY 358
            E+E+ ++TV  CSVYIVEFLT+VC+I FTIEE+ +II +LT LC+V SD ++LWI DFN 
Sbjct: 311  ESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDFNE 370

Query: 359  FVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSNHQTLESLLYLLQC 418
            FVSKETGLAASYN+RDQ  EFFTSLS+P LSL+F +VS++I  NTSNHQT ESLLYLLQC
Sbjct: 371  FVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTSNHQTFESLLYLLQC 430

Query: 419  ILLNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIK 478
            ILLNDDEI+ QNI QS Q+L+  L++ L SSE++E+TLAR+IL+IPK+LDKFIDVLPDIK
Sbjct: 431  ILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDVLPDIK 490

Query: 479  SLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXXXXXXXX 538
            S+TS FL  SLDLALK  QEL++SA LIAF YYCYFAELDSVLGP+ CTE+         
Sbjct: 491  SVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKVIQIIN 550

Query: 539  XXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVVQS 598
              S+DAEEDTNGTIMEVLN+VIS N+KGP+  +EVLQAE HLVF+ISSKDPANVQVVVQS
Sbjct: 551  EISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVVVQS 610

Query: 599  QECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKP 658
            QECLEKLLD+I M NY +YIELCLPSFINVL AN  NNYKY+PLLSLVLEFI VFLKK+P
Sbjct: 611  QECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLKKRP 670

Query: 659  SSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMKVL 718
            +  +LP EI+Q+LFEPLAKVL YSTEDETLQLATEAFSYLIFNTDTQ M+ RLMDIMK+L
Sbjct: 671  NDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMDIMKIL 730

Query: 719  ERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFS 778
            ERLLSLEVSDSAAMNVGSLVV IFTRFS E+QPLV RILQAVV+RLVKAQNISTQQNL S
Sbjct: 731  ERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNLLS 790

Query: 779  VLCFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGERRIKENIIALIKLFL 838
            VLCFLTCND KQTVDFL SF+ID+ +ALSLVM KWME+FEV+RGER+IKE+I+AL K F 
Sbjct: 791  VLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKIKESIVALSKFFF 850

Query: 839  LDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGFQNKQP 898
            L+D RLHKLMVNGD+IPY+GDLIITRSMAKKMPDKYVQVPLYTKIIKLF+SELGFQ KQ 
Sbjct: 851  LNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISELGFQAKQL 910

Query: 899  NPEQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXXXXXXXXXXX 958
            +PEQL+ +                           VLDYEKLK+YI              
Sbjct: 911  DPEQLVAS-----SIQESANANNDDETGDWEDVDDVLDYEKLKEYIDDDVDGEEEDDRDD 965

Query: 959  ITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008
            ITGL DVKESVVQILV FF+EVA+K+VS FH IYE+LS++ERK LSEALL
Sbjct: 966  ITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015

>YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}
            KAP114Karyopherin, responsible for nuclear import of
            specific proteins; cargoes include Spt15p, Sua7p,
            histones H2A and H2B, and Nap1p; amino terminus shows
            similarity to those of other importins, particularly
            Cse1p; localization is primarily nuclear; function is
            regulated by sumoylation
          Length = 1004

 Score = 1386 bits (3587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/1008 (70%), Positives = 814/1008 (80%), Gaps = 4/1008 (0%)

Query: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60
            MDI+ LI GAQSAD HTRE AE QLLQWCDSDASQVF +LA+VAL H+ SL+SRQFALLS
Sbjct: 1    MDINELIIGAQSADKHTREVAETQLLQWCDSDASQVFKALANVALQHEASLESRQFALLS 60

Query: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISA 120
            LRKLITMYWSPGFESYRSTSNV+++VK+ IR             TKIKNGASYCIVQISA
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCIVQISA 120

Query: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180
            VDFPDQWPQLLTVIYDAIS  HS+NAMSLLNEIYDDVVSEEMFFEGGIGL T+EI+FKVL
Sbjct: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEIVFKVL 180

Query: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVN 240
             TE S L+AKIAALKL KACL QMSSH+++++ SR +F++QC                 N
Sbjct: 181  NTETSTLIAKIAALKLLKACLLQMSSHNEYDEASRKSFVSQCLATSLQILGQLLTLNFGN 240

Query: 241  EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTEN 300
             DV  Q KF+SIIYENLVFIKN+FS+KHF  E Q QFK++AI+DL+N+  +N N   TE+
Sbjct: 241  VDVISQLKFKSIIYENLVFIKNDFSRKHFSSELQKQFKIMAIQDLENVTHINANVETTES 300

Query: 301  EDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYFV 360
            E  LETV  CS+YIVEFLT+VC++ F++EEM  II SLT LC++ S+T ++W  DFN FV
Sbjct: 301  EPLLETVHDCSIYIVEFLTSVCTLQFSVEEMNKIITSLTILCQLSSETREIWTSDFNTFV 360

Query: 361  SKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSNHQTLESLLYLLQCIL 420
            SKETGLAASYNVRDQ +EFFTSL +P LSL+F +VS DI  +T N+ TLESLLYLLQCIL
Sbjct: 361  SKETGLAASYNVRDQANEFFTSLPNPQLSLIFKVVSNDIEHSTCNYSTLESLLYLLQCIL 420

Query: 421  LNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIKSL 480
            LNDDEITG+NI QS Q LI+ L + LVS E+ E+ LAR IL IP+VLDKFID LPDIK L
Sbjct: 421  LNDDEITGENIDQSLQILIKTLENILVSQEIPELILARAILTIPRVLDKFIDALPDIKPL 480

Query: 481  TSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXXXXXXXXXX 540
            TS+FL  SL+LALK  +EL++SA LIAFTYYCYFAELDSVLGPE C+E            
Sbjct: 481  TSAFLAKSLNLALKSDKELIKSATLIAFTYYCYFAELDSVLGPEVCSETQEKVIRIINQV 540

Query: 541  SDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVVQSQE 600
            S DAEEDTNG +MEVL++VIS N K PH  +E+LQAEFHLVF+ISS+DPANVQVVVQSQE
Sbjct: 541  SSDAEEDTNGALMEVLSQVISYNPKEPHSRKEILQAEFHLVFTISSEDPANVQVVVQSQE 600

Query: 601  CLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKPSS 660
            CLEKLLDNI M NY +YIELCLPSFINVL++N  NNY+Y+PLLSLVLEFITVFLKKKP+ 
Sbjct: 601  CLEKLLDNINMDNYKNYIELCLPSFINVLDSNNANNYRYSPLLSLVLEFITVFLKKKPND 660

Query: 661  EFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMKVLER 720
             FLP EI+Q+LFEPLAKVLA+STEDETLQLATEAFSYLIFNTDT+ MEPRLMDIMKVLER
Sbjct: 661  GFLPDEINQYLFEPLAKVLAFSTEDETLQLATEAFSYLIFNTDTRAMEPRLMDIMKVLER 720

Query: 721  LLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFSVL 780
            LLSLEVSDSAAMNVG LVV IFTRFS EIQPL+ RIL+AVV+RL+K QNIST+QNL SVL
Sbjct: 721  LLSLEVSDSAAMNVGPLVVAIFTRFSKEIQPLIGRILEAVVVRLIKTQNISTEQNLLSVL 780

Query: 781  CFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGERRIKENIIALIKLFLLD 840
            CFLTCNDPKQTVDFL SFQIDN DAL+LVM KW+E+FEV+RGE+RIKENI+AL  LF L+
Sbjct: 781  CFLTCNDPKQTVDFLSSFQIDNTDALTLVMRKWIEAFEVIRGEKRIKENIVALSNLFFLN 840

Query: 841  DARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGFQNKQPNP 900
            D RL K++VNG+LIPY+GDLIITRSMAKKMPD+YVQVPLYTKIIKLFVSEL FQ+KQPNP
Sbjct: 841  DKRLQKVVVNGNLIPYEGDLIITRSMAKKMPDRYVQVPLYTKIIKLFVSELSFQSKQPNP 900

Query: 901  EQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXXXXXXXXXXXIT 960
            EQLIT+                              Y+KLK+YI              IT
Sbjct: 901  EQLITSDIKQEVVNANKDDDNDDWEDVDDVLD----YDKLKEYIDDDVDEEADDDSDDIT 956

Query: 961  GLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008
            GLMDVKESVVQ+LV FFKEVASKDVSGFH IYE+LS++ERKVLSEALL
Sbjct: 957  GLMDVKESVVQLLVRFFKEVASKDVSGFHCIYETLSDSERKVLSEALL 1004

>Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (REAL)
          Length = 1004

 Score = 1375 bits (3559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 700/1008 (69%), Positives = 810/1008 (80%), Gaps = 4/1008 (0%)

Query: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60
            M+I  L+T AQSAD  TREAAE QLLQWCDS+ASQ+FT+LA+VAL HQ+ L+SRQFALLS
Sbjct: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60

Query: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISA 120
            LRKLITMYWSPGFESYRSTS V++NVK+ IR             TKI NGASYCIVQISA
Sbjct: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120

Query: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180
            VDFPDQWPQLLTVIYDAIS  HS+NAMSLLNEIYDDVVSEEMFFEGGIGLETV+IIFKVL
Sbjct: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180

Query: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVN 240
             T+ S LVAK AALKLFKACL QMSSH+ +++ESR +FI+QC                 +
Sbjct: 181  ATDTSTLVAKFAALKLFKACLLQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240

Query: 241  EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTEN 300
            E+V  Q K +SIIYENLV IKN+FSK HF  + Q QFK+V ++DL NIA ++ N    E 
Sbjct: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEY 300

Query: 301  EDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYFV 360
            E   E V   S+YIVEFLT+VC++PF  EE+ +II+SLT LC+V+S+  +LWI DFN FV
Sbjct: 301  ESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFV 360

Query: 361  SKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSNHQTLESLLYLLQCIL 420
            SKETGLAASYNVRDQ SEF  SLS+P LSL+F ++S+DI +NT ++Q LESLLYLLQ +L
Sbjct: 361  SKETGLAASYNVRDQSSEFLISLSNPLLSLIFSVISKDIERNTYDNQILESLLYLLQSVL 420

Query: 421  LNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIKSL 480
            LNDDEIT QN+ +S Q+LI+  ++ LVS E+ E+TLAR IL+IPKVLDKFIDVLPDIKSL
Sbjct: 421  LNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDIKSL 480

Query: 481  TSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXXXXXXXXXX 540
            TS FL  SLDLALK+  EL++SA LIAFTYYCYFAELDSVLGP+ C+E+           
Sbjct: 481  TSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQIINDI 540

Query: 541  SDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVVQSQE 600
            + D+EEDTNG IMEVL++VIS N KG    EE+LQAEFHLVF+ISSKDPANVQVVVQSQE
Sbjct: 541  NSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQSQE 600

Query: 601  CLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKPSS 660
            CLEKLLD I M NY +YIELCLPSFINVL++N  NNY+Y+PLLSLVLEFITVFLKKKP  
Sbjct: 601  CLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKKPID 660

Query: 661  EFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMKVLER 720
             FLP EI Q+LFEPLAKVL YS+E+ETLQLATE+FSYLIFNTDTQVMEPRLMDIMKVLER
Sbjct: 661  GFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKVLER 720

Query: 721  LLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFSVL 780
            LLSLEVSDSAAMNVG LVVTIFT+FS +IQPLV RIL+AV++RLVKAQNISTQQNL SVL
Sbjct: 721  LLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLLSVL 780

Query: 781  CFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGERRIKENIIALIKLFLLD 840
            CFLTCND +QTV+FL +F+ID+ +ALSLVM KWME+FEV+RGE+RIKENI+AL  LF LD
Sbjct: 781  CFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRGEKRIKENIVALSNLFFLD 840

Query: 841  DARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGFQNKQPNP 900
            DARL K+MVNGDLIPY+ D+IITRSMAK+MPD+YVQVPLYTKIIKLFVSELGFQNKQP+P
Sbjct: 841  DARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQNKQPDP 900

Query: 901  EQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXXXXXXXXXXXIT 960
            +QLIT+                              YEKLK+YI              IT
Sbjct: 901  KQLITSNMQHDAANLNNDEDNDDWEDVDDVLD----YEKLKEYINDDVDGEDEDDSEDIT 956

Query: 961  GLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008
            GLMDVKESVVQILV FFKEVA+KDVSGF+RIYE+LS+++RKVLSEALL
Sbjct: 957  GLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004

>NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1012

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/1019 (51%), Positives = 707/1019 (69%), Gaps = 18/1019 (1%)

Query: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60
            MDI  LIT AQS+D  TREAAE QL   CD +ASQ+FTSL SVAL  ++ L +RQF+LL+
Sbjct: 1    MDIYQLITQAQSSDTQTREAAENQLSSSCDQNASQIFTSLMSVALDPKSPLSTRQFSLLT 60

Query: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISA 120
            +RK ITMYWSPGF+SYR+TS +  N KE IR             TKIKN ASYCIVQISA
Sbjct: 61   IRKFITMYWSPGFQSYRNTSTIQENTKEYIRNSLLQLCLDDAQDTKIKNSASYCIVQISA 120

Query: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180
            VDFPDQWPQLL+ IY AI Q+HS+NA+SLLNEIYDDV+SEEMFFEG IG+ET++IIF++L
Sbjct: 121  VDFPDQWPQLLSTIYMAIEQNHSLNALSLLNEIYDDVISEEMFFEGQIGMETLQIIFQLL 180

Query: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVN 240
            T   +NL AKIA  KLF ACL QMS  D  +  +R  F+ +C                V+
Sbjct: 181  TNNNANLKAKIAGTKLFNACLLQMSVVDSSSKHNRKEFVKECIFKALEVLGQLLELYPVS 240

Query: 241  EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTEN 300
             D +     R+ IYEN+V I N FS+K F + F+  +KL + +DL+  A  N  +   EN
Sbjct: 241  ND-SLILNLRTKIYENVVLISNEFSRKLFTQAFKGLYKLQSFRDLE--ACSNQFNAFLEN 297

Query: 301  -----EDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGD 355
                  D LE++  C +++++FLT++    FT++E+ +I+QSLT LC +DSDT + W  D
Sbjct: 298  LSQADNDILESMNECVIHVLDFLTSISDSDFTMQEINLIVQSLTFLCCLDSDTLEQWSED 357

Query: 356  FNYFVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTS---NHQTLESL 412
            FN FVSKETGL AS+ +RDQ +EF + LS+PN S  F+ +   ++ + +   N    ESL
Sbjct: 358  FNDFVSKETGLLASFTIRDQAAEFMSGLSNPNYSNFFNSIYAQVIYSLTGDVNDNLRESL 417

Query: 413  LYLLQCILLNDDEITGQNIIQSSQSLIENLRSELVSSELNEV-TLARLILIIPKVLDKFI 471
            LYLLQ +L N+++    + I    S+I    S +  + L +   L+R+IL+ PK+L+KF+
Sbjct: 418  LYLLQTLLTNEED--NDHDINIEPSVILKQFSSVFENGLQKTFLLSRIILLTPKLLEKFM 475

Query: 472  DVLPDIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXX 531
            D L D+K LT ++L+ +LDLAL+ H E+++S+ +IAFTYY YFAEL SVLGPE C+ V  
Sbjct: 476  DQLQDVKQLTGNYLRRTLDLALETHNEIIKSSSIIAFTYYSYFAELPSVLGPELCSIVQE 535

Query: 532  XXXXXXXXXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPAN 591
                     S +AEEDTNG +ME LN++ISCN    + S E+LQ EF+LV SISSKDPAN
Sbjct: 536  NTLKIISELSKEAEEDTNGLLMETLNQIISCNVH-ENLSPEILQTEFNLVLSISSKDPAN 594

Query: 592  VQVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFIT 651
            VQV V++Q+CLE LL+ +    Y+ Y+++CLPSFI+ ++A+  N Y+YTP+LSL+LEF+T
Sbjct: 595  VQVTVEAQDCLEHLLEGMNTETYLHYVDICLPSFIHTIDASAINQYRYTPVLSLILEFLT 654

Query: 652  VFLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRL 711
            +F+KKKP   FLP+ I    F+ L  +L+ STEDETLQLAT+AFSY+++NT+   M P+L
Sbjct: 655  IFMKKKPVDGFLPTSISDFSFKSLCNLLSLSTEDETLQLATDAFSYMVYNTEPSAMVPKL 714

Query: 712  MDIMKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNIS 771
             DI+ VL+RLLS+ VSD+AAMNVG+LVVT+F++FS EIQPL+  IL+A V RL++AQNIS
Sbjct: 715  QDIINVLDRLLSINVSDTAAMNVGTLVVTLFSKFSNEIQPLIPTILRAAVGRLIQAQNIS 774

Query: 772  TQQNLFSVLCFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGERRIKENII 831
            TQQNL S+LCFLTC+DPKQ +D L +F  D+    + VM KW ESFE +RGE++IKENI+
Sbjct: 775  TQQNLVSLLCFLTCSDPKQVIDLLYNFDSDH-STFTKVMNKWFESFETIRGEKKIKENIV 833

Query: 832  ALIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSEL 891
            AL KL+   D RL KL+VNGDLIPYDGDLIITRSMAKKMPDKY Q+P +TKI+KLF +EL
Sbjct: 834  ALSKLYFTGDERLGKLIVNGDLIPYDGDLIITRSMAKKMPDKYTQIPAFTKIVKLFTTEL 893

Query: 892  GFQNKQPNPEQLI-TTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXX-X 949
            GFQNKQP+ + L+ +                            VLDYEKL++++      
Sbjct: 894  GFQNKQPDSKILLESDIKNVDTSNNKTSEEAAGDDDEWEDVDDVLDYEKLREFVDDEDPA 953

Query: 950  XXXXXXXXXITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008
                     ITGL  +KE++ ++LV FFK+VA++D++GFH IY +LSENE+++L+E L+
Sbjct: 954  DFGENDSDEITGLDTLKETIPELLVEFFKDVAARDLNGFHNIYNTLSENEKRILTENLV 1012

>NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1013

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1025 (49%), Positives = 673/1025 (65%), Gaps = 29/1025 (2%)

Query: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60
            MDI+ LI  AQS+DN  R+AAE+QLLQ CD++A+Q+FTSL   A    T + SRQFALLS
Sbjct: 1    MDINQLIVQAQSSDNAVRDAAESQLLQACDTNAAQIFTSLMKGACDGNTDIASRQFALLS 60

Query: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISA 120
            LRKLITMYWSPGFESYR+TS ++   KE IR             +KI   A+YC+VQISA
Sbjct: 61   LRKLITMYWSPGFESYRNTSTINDQTKEYIRESLLNICLDDLQDSKITKSAAYCVVQISA 120

Query: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180
            VDFPDQWPQLL ++YD ISQ HS+NAMSLLNEIYDDVVSEEMFFEG IG+ET++IIF+VL
Sbjct: 121  VDFPDQWPQLLVILYDTISQSHSLNAMSLLNEIYDDVVSEEMFFEGQIGMETLQIIFQVL 180

Query: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVN 240
            +     + AKIAA KLF AC+ QMS  D  +   R     +C                + 
Sbjct: 181  SNNEGKIEAKIAATKLFNACILQMSVLDPSSSLKRKKLAEECIPKSIQVLGQLLEYYTI- 239

Query: 241  EDVTCQSK-------FRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMN- 292
             D T  SK        RS IYEN+V IKN   K+ F +     FK   +KDL +  ++  
Sbjct: 240  -DTTVDSKMLTSILELRSKIYENVVLIKNELPKRLFQRNLMASFKFQTLKDLSSSCTLYE 298

Query: 293  ---VNDGPTENEDSL-ETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDT 348
               +N+    N D+L + +  CS+++++FLT  CS+ F   E+  I+Q LT LC +D+D+
Sbjct: 299  TYCLNNIEVVNSDNLHDALSECSIHMLDFLTATCSLKFDNSEVSTIVQDLTVLCCLDNDS 358

Query: 349  TQLWIGDFNYFVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIV----QNTS 404
             +    DFN FVSKETGL  SY +RDQ SEF  SLSDPN + +   +    +    Q + 
Sbjct: 359  QEELAADFNAFVSKETGLLPSYTIRDQASEFLNSLSDPNYATILQAIINTFISTMNQPSR 418

Query: 405  NHQTLESLLYLLQCILLNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIP 464
            N + LES+LYLLQ ++ N+D++T  N       L+E L S       N    +RLIL+IP
Sbjct: 419  NDRILESILYLLQSLMTNEDDVTNIN----PNILLEPLSSLFDYETENPFLHSRLILLIP 474

Query: 465  KVLDKFIDVLPDIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPE 524
            K+L+KF+D +P++K +T  FL  SL  +L+ +  L + + LI +TYY YFAEL SVLG +
Sbjct: 475  KILEKFMDEIPNVKVVTKDFLTKSLKYSLQMNDGLNKISALIGYTYYAYFAELPSVLGRD 534

Query: 525  ACTEVXXXXXXXXXXXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSI 584
             CT+V             ++EEDT+G ++EVLN VI CN +     + +L+ EF++V SI
Sbjct: 535  VCTQVQENILLLITQVVHESEEDTHGLLVEVLNHVIDCNPEDIA-VQGILETEFYMVLSI 593

Query: 585  SSKDPANVQVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLS 644
            SSKDPAN+QV + S+ECLEKLL+ +    Y  YI++CLPSFINV++ +    YKY+PLLS
Sbjct: 594  SSKDPANIQVAIGSEECLEKLLEGVNTRTYTHYIDMCLPSFINVIKGHSVTEYKYSPLLS 653

Query: 645  LVLEFITVFLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDT 704
            L+LEF+TVF+KKKP+   LP+ I +H+F+PL  VL +STEDETLQLAT+AFSYL++NTD+
Sbjct: 654  LILEFVTVFMKKKPTDGPLPAIIFEHIFQPLLNVLNHSTEDETLQLATDAFSYLLYNTDS 713

Query: 705  QVMEPRLMDIMKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRL 764
             +M P L +I+ VL+RLLS+ VSD+AAMNVG+L+VTIF++FS E+Q L+  IL+A V +L
Sbjct: 714  TLMIPHLEEIVAVLDRLLSINVSDTAAMNVGTLIVTIFSKFSNELQSLIPTILRAAVTKL 773

Query: 765  VKAQNISTQQNLFSVLCFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGER 824
            V+A+NISTQQNL S+LCFLTC DP QT++FL     +     + VM KW E+FEV+RGE+
Sbjct: 774  VQAKNISTQQNLISLLCFLTCTDPLQTIEFLYGLD-ETHSTFAAVMNKWFEAFEVIRGEK 832

Query: 825  RIKENIIALIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKII 884
            +IKENI+AL KL+   D RL  L+VNGDLIPY+GDLIITRSMAK MPDKY Q+P YTKII
Sbjct: 833  KIKENILALSKLYFTCDPRLGSLLVNGDLIPYEGDLIITRSMAKTMPDKYTQIPAYTKII 892

Query: 885  KLFVSELGFQNKQPNPEQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYI 944
            KLFVSEL FQ +Q        T                           VLDY+KLK+Y+
Sbjct: 893  KLFVSELSFQTQQTGEP----TVLNADLKGIEKEEEEVGDDDEWEDVDDVLDYDKLKEYV 948

Query: 945  XXXXXXX-XXXXXXXITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVL 1003
                           ITGL DVKE+V ++L+ FFKEV SKD + FH IY +LS+N +K+L
Sbjct: 949  DDEDPAEFGEDDKDEITGLADVKETVTELLLEFFKEVTSKDTNNFHAIYNTLSDNGKKIL 1008

Query: 1004 SEALL 1008
            SE LL
Sbjct: 1009 SENLL 1013

>KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.564
            YGL241W
          Length = 1012

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1035 (46%), Positives = 679/1035 (65%), Gaps = 54/1035 (5%)

Query: 2    DISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSL 61
            DIS LI+ AQS DN  RE AE QLLQ CDS+AS +F +L  VA+++   L +RQFALLSL
Sbjct: 4    DISQLISQAQSPDNSLREHAEQQLLQSCDSNASLIFQALTDVAINNSNKLAARQFALLSL 63

Query: 62   RKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAV 121
            RKLIT YWSPGFESYR+TS +DL+ K S+R             +KIK+ ASYC+ QISAV
Sbjct: 64   RKLITFYWSPGFESYRNTSQIDLDTKSSLRNYLIQLALDDNQDSKIKSSASYCVTQISAV 123

Query: 122  DFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL- 180
            DFPDQWP+LL+++Y  I+QH+S++A+ LLNEIYDD+VSEEMFFEG IGLET+ I++++L 
Sbjct: 124  DFPDQWPELLSILYGCITQHYSLSAIKLLNEIYDDIVSEEMFFEGNIGLETLSIVYQLLE 183

Query: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVN 240
            + +  ++ A+IA + L  A ++QM++ D +  E R   +++                  +
Sbjct: 184  SGDNVSIQARIALVDLLNATITQMTNVDSNLTEKRKQLLSESIPRALGLLSNILEMS--H 241

Query: 241  EDVTCQS-KFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDL----KNIASMNVND 295
             D++  S  F   IYE LV IKN   KK F  + +  +K + +  L       ASM    
Sbjct: 242  RDISTDSLTFIGKIYEILVLIKNELPKKFFSAQTRDAYKRITLNTLSLLQNKYASMT--- 298

Query: 296  GPTENEDSLETVQTCSVYIVEFLTTVC-SIPFTIEEMKMIIQSLTALCRVDSDTTQLWIG 354
             P E E  LE+   C+++ +EFLT++  +  FT EE  +I+ SL  LC +D  T + W+ 
Sbjct: 299  EPAETE--LESFSECAIHTLEFLTSLSYNTNFTEEERTIILNSLLVLCSLDPVTKETWLA 356

Query: 355  DFNYFVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQ------DIVQNTSNHQT 408
            DFN+FVSKETGL  SY +RDQ  EF TSL D N  L+   + Q           + +   
Sbjct: 357  DFNHFVSKETGLLPSYTIRDQSFEFLTSLIDQNFQLILKSIFQYFFTLISSSSPSVDPSQ 416

Query: 409  LESLLYLLQCILLNDDEITGQN------IIQSSQSLIENLRSELVSSELNEVTLARLILI 462
            LE+  YLLQ IL NDD+I   N      +++   SL+ N+   L+        ++R+IL 
Sbjct: 417  LETTFYLLQSILSNDDDIENVNNEEITSVLRVLPSLLTNVHDSLM--------VSRIILA 468

Query: 463  IPKVLDKFIDVLPDIKSLTSSFLKASLDLALKYHQE-LVESAVLIAFTYYCYFAELDSVL 521
            +PK+L+KF+D LPD+K++  +FL  S +LAL+   + +++S+VLI+FT YCYFAEL SVL
Sbjct: 469  LPKILEKFMDDLPDVKAMVQTFLVQSTELALRLSGDYIIKSSVLISFTSYCYFAELPSVL 528

Query: 522  GPEACTEVXXXXXXXXXXXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLV 581
            GPE C  +           S+++E+DTNG + EVLN +I CN+   + S+E+LQ EF L+
Sbjct: 529  GPELCASIQKSILTLMKQVSNESEDDTNGLLTEVLNNIIECNST--NTSQEILQTEFSLL 586

Query: 582  FSISSKDPANVQVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTP 641
            FSISSKDP+NVQ+VV+SQE LEKLL N+T   Y+ YI++ LP FIN++ AN   +Y+Y+P
Sbjct: 587  FSISSKDPSNVQIVVESQESLEKLLTNVTEKVYLEYIQIYLPPFINIIHANSTTSYRYSP 646

Query: 642  LLSLVLEFITVFLKKKPS-SEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIF 700
            LLSLVLEFIT+F+KKKPS S+ LP  I  +LF+PL  +L  STEDETLQL T+AF+Y+I+
Sbjct: 647  LLSLVLEFITIFMKKKPSDSKILPESIIANLFQPLVDILTTSTEDETLQLTTDAFTYIIY 706

Query: 701  NTDTQVMEPRLMDIMKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAV 760
            NTD++ + P L  ++ +L+RLLSL+V+D+AAMNVG+L+VTIFT+FS +I  L+  IL A 
Sbjct: 707  NTDSEKVMPYLETVVNILDRLLSLDVTDTAAMNVGTLIVTIFTKFSAQISSLIPTILNAA 766

Query: 761  VIRLVKAQNISTQQNLFSVLCFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVV 820
            V RL+  +NISTQQNL S+LCFL  ++ ++TVDFL  F +   + +  V+ KW ESFE++
Sbjct: 767  VNRLIDCKNISTQQNLVSLLCFLFYSNTQETVDFL--FNLPQQNIVRDVLIKWFESFEII 824

Query: 821  RGERRIKENIIALIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLY 880
            RGE++IKENIIAL KL+ L D +L  + VNGD+IPY+GDLIITRS AK +PDKY Q+ ++
Sbjct: 825  RGEKKIKENIIALGKLYCLHDEKLFSIKVNGDIIPYEGDLIITRSRAKSLPDKYTQITIF 884

Query: 881  TKIIKLFVSELGFQNKQPNPEQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKL 940
             KIIKLF++ELGFQNKQP  E L+T                            VLDY+KL
Sbjct: 885  EKIIKLFIAELGFQNKQPAIENLMTN-------ETTALGDSNENDDEWEDVDDVLDYDKL 937

Query: 941  KDYIX-------XXXXXXXXXXXXXITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYE 993
            K+Y+                     ITGL DV ++V ++++GFFK+V SK+V+ F  IY+
Sbjct: 938  KEYVNDEDELDGEDSREYGEGDEEEITGLGDVSQTVTELIIGFFKDVTSKNVNNFQSIYD 997

Query: 994  SLSENERKVLSEALL 1008
            +LSENE+ +L++ L+
Sbjct: 998  TLSENEKMILTQYLV 1012

>TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1018

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/1022 (46%), Positives = 653/1022 (63%), Gaps = 26/1022 (2%)

Query: 2    DISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSL 61
            D   LI  AQSAD+  R +AEAQLL+  D DAS VF S   VA   Q  L SRQFAL+SL
Sbjct: 8    DSQQLIKEAQSADDVVRRSAEAQLLELSDRDASLVFLSFMKVASDSQELLSSRQFALVSL 67

Query: 62   RKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAV 121
            RKLITMYWSPGFESYRS SN+    KE++R             +K+ + A+YC+VQISAV
Sbjct: 68   RKLITMYWSPGFESYRSCSNLKEEAKETVRDYLLKLCLNDQEISKVISAAAYCVVQISAV 127

Query: 122  DFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVLT 181
            DFPDQWP+LLTV+YD I   HS++AMSLL EIYDDV+SEEMFFE GIGLET+ I+F+++ 
Sbjct: 128  DFPDQWPKLLTVLYDGILNKHSLSAMSLLTEIYDDVMSEEMFFEEGIGLETIRIVFQIVR 187

Query: 182  TEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVNE 241
               +NL AK+A   LF ACL Q+ + D ++   R     +C                + E
Sbjct: 188  DPNTNLEAKLAGFNLFHACLQQILTVDLNSAPKRKEMTVECAKEALTVWGEHLQSHSITE 247

Query: 242  DVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIAS--MNVNDGPTE 299
              + Q + +  IYE+L  +KN  SKK  P    V FK + + DL+      ++++ G  E
Sbjct: 248  H-SLQLQIKGRIYEDLSLMKNELSKKLIPDALYVPFKELVLIDLETAGKVYLSISQGFVE 306

Query: 300  NEDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYF 359
                L+ +  C+++I+EFLT  C       E++ II +L  LC +D+DT  LW+ DFN +
Sbjct: 307  GY-RLDDLNECAIHIIEFLTATCHFTMDSAEVERIITALGELCCLDNDTVTLWLEDFNSY 365

Query: 360  VSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSN-------HQTLESL 412
            +S E+GL ASY+VRDQ SE  TS+   N SL    V Q I+   S+        +  ES 
Sbjct: 366  ISMESGLTASYSVRDQASELLTSMDGRNYSL----VCQHILYKVSHLNEWKQEWKFQESF 421

Query: 413  LYLLQCILLNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFID 472
            L+L+Q   LN+   +G N I   + ++  L S L S ++     +R+IL++PK+L+K++D
Sbjct: 422  LFLVQAAALNESLPSG-NFINEIREVLSFLGSMLCSEDVVSFVSSRIILLLPKILEKYMD 480

Query: 473  VLPDIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXX 532
            +L D++ LTS  L  S +LAL  + ++++++VLIAFTY   FAEL SVLG E C      
Sbjct: 481  LLDDVRILTSHLLTKSAELALATNDDIIKASVLIAFTYCSNFAELSSVLGQEVCEITQKR 540

Query: 533  XXXXXXXXSDDAEEDTNGTIMEVLNEVISCNTKG-PHHSEEVLQAEFHLVFSISSKDPAN 591
                    S+DAE+DT+G +MEVLN VI CNT G P++  E++Q EF LV  IS+KDPAN
Sbjct: 541  VLGLIARISEDAEDDTDGVLMEVLNNVIDCNTPGVPNN--EIVQTEFSLVLKISAKDPAN 598

Query: 592  VQVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFIT 651
            +Q+VV+SQECLEKLL+N+ + +Y +Y+E  LPSF+  +E +    Y Y+PLLSLVL+F+T
Sbjct: 599  IQIVVESQECLEKLLENLDIDHYKNYVETWLPSFMKSIEGSAQTKYAYSPLLSLVLQFLT 658

Query: 652  VFLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRL 711
             FL KKP+   LP+ +    FEPL ++L  S +DET+QLATEAFSY ++NTD  V+ P L
Sbjct: 659  TFL-KKPTDYQLPTVMCNLTFEPLRQILLNSEDDETIQLATEAFSYFLYNTDPTVVAPHL 717

Query: 712  MDIMKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNIS 771
              I+ +L+RLLS +VSD+AAM VGSL+VT+FTRFS EI+ ++  IL+A   RL++A+++S
Sbjct: 718  EAIVAILDRLLSFDVSDAAAMYVGSLIVTVFTRFSTEIENMMPIILRAAANRLIQAKHLS 777

Query: 772  TQQNLFSVLCFLTCNDPKQTVDFLCSFQIDNMD--ALSLVMPKWMESFEVVRGERRIKEN 829
            T QNL SV CFLT  DP+QTVDFL    +DN +  AL  ++  W+ESFE +RGERR KEN
Sbjct: 778  TSQNLLSVFCFLTSVDPRQTVDFLFGLHLDNTEHNALYSIVSIWLESFESIRGERRTKEN 837

Query: 830  IIALIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVS 889
            +IALIKL+LL D RL ++ VN ++IPY+G+ IITRSMAKKMPD+Y QV +YTKIIKLFV+
Sbjct: 838  VIALIKLYLLHDKRLMEMQVNDEIIPYEGEQIITRSMAKKMPDRYSQVSVYTKIIKLFVA 897

Query: 890  ELGFQNKQPNPEQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXX 949
            EL FQ+KQP+PE+ IT+                           VL+YEKL++Y+     
Sbjct: 898  ELNFQDKQPDPERFITS-DMAKEGNNGNSDNDTDSDGEWEDVEDVLNYEKLQEYVDESDQ 956

Query: 950  XXXXXXXXX-ITGLMD--VKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEA 1006
                          +D     SV  ILV FFKEVA+ +  GF  IY SL+E E+K+LSE 
Sbjct: 957  DGEGSDSDDFFASAIDEYSNASVRDILVSFFKEVAANNTGGFRDIYNSLTEVEKKILSEN 1016

Query: 1007 LL 1008
            L+
Sbjct: 1017 LV 1018

>KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1009

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1023 (44%), Positives = 659/1023 (64%), Gaps = 29/1023 (2%)

Query: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHH-QTSLQSRQFALL 59
            M++  LI   QS DN  R  AE+ L+   D DAS V  SL +VAL+  +  L  RQFALL
Sbjct: 1    MNMDELIALLQSPDNSVRTQAESNLMTVSDEDASHVLQSLINVALNSAEKPLTERQFALL 60

Query: 60   SLRKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQIS 119
            S+RKLIT YWSP FESYR+T+ +DL  K+ +R             TKIK  ASYCIVQIS
Sbjct: 61   SMRKLITFYWSPAFESYRNTATLDLLTKQYVRDSLLQLSLNDSQDTKIKKSASYCIVQIS 120

Query: 120  AVDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKV 179
            AVDFPD+WP+LL  +Y AI+  HS++A+SLLNEIYDDV+SEEMFFEGGIGLET++IIF++
Sbjct: 121  AVDFPDEWPKLLEELYGAITNFHSLSAISLLNEIYDDVISEEMFFEGGIGLETLQIIFQL 180

Query: 180  LTTEASNLVAKIAALKLFKACLSQMSSHDKHN-DESRNNFINQCXXX-XXXXXXXXXXXX 237
            L+++AS + AK+AA+ LF A L QMS+ D H   E R   +  C                
Sbjct: 181  LSSDASTIEAKLAAINLFHATLLQMSTVDSHTTQEKRKEMVRNCVPICLDTLRTLLEGLA 240

Query: 238  XVNEDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGP 297
             +N  +  Q   +  IY++L FIKN F  + FP +F   FK+ A++DL    ++ +N   
Sbjct: 241  DINSALPLQ--LKGSIYKSLEFIKNKFPTQLFPSQFVEYFKIQAVRDL---VALQINQDS 295

Query: 298  TENEDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFN 357
              ++  +E    C+++++E ++++    +  E+   I+++L +L R+D++T + W  DFN
Sbjct: 296  FADDTVVEAFNECAIHVIELISSIEITEYGTEDQHAILKALLSLSRLDANTKESWTTDFN 355

Query: 358  YFVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQ---DIVQNTSNHQTLESLLY 414
             FVSKETGLAAS+ +RDQV+++  + +      MF+ + Q   DI+ + ++  T+ES L+
Sbjct: 356  DFVSKETGLAASFTIRDQVADYLGTPTGAQSQTMFENILQLVSDILSSNADPTTIESSLF 415

Query: 415  LLQCILLNDDEITGQNIIQSSQSLIENLRS----ELVSSELNEVTLARLILIIPKVLDKF 470
            LLQ +L  D + +    + S Q+L++ + +    + +++  + +  +R+IL IPK+LD F
Sbjct: 416  LLQSVLAEDTDFS----VSSPQTLVQLISALIGPQTINTHNDSILRSRIILTIPKILDVF 471

Query: 471  IDVLPDIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVX 530
            +D LP+IK LT   L  +L  AL    EL+  + LIAFTYY YFAEL SVLG E+C E+ 
Sbjct: 472  MDSLPNIKQLTKDLLLKTLQDALSSTDELIFCSTLIAFTYYVYFAELPSVLGSESCRELQ 531

Query: 531  XXXXXXXXXXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPA 590
                      + +AEEDTNG ++EVLN VISCN        ++LQ E   + SISSKDP+
Sbjct: 532  EAVLGIVNHVASEAEEDTNGLLIEVLNHVISCNVASTDF--KLLQKELTAMLSISSKDPS 589

Query: 591  NVQVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFI 650
            N++V V+SQECLEKLLDNI    Y  +I +CLPSF+N+++ N+P  YKY PLLSL+LEF+
Sbjct: 590  NIEVSVESQECLEKLLDNINTERYNKFISICLPSFVNIIKGNQPLKYKYNPLLSLILEFV 649

Query: 651  TVFLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPR 710
             +F+KKKP++  LP    + +   L  +L  S EDETLQLAT AFS+L+ NTD  ++   
Sbjct: 650  RIFMKKKPTNGMLPRNFSEGIIALLVDILERSEEDETLQLATAAFSHLLNNTDPTIVIQH 709

Query: 711  LMDIMKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNI 770
            L  ++KVL+RLLS+ VSD+AA NVG+L+VT+F ++S E+  L+  IL++ + RL+ A+N+
Sbjct: 710  LTVVIKVLKRLLSMFVSDTAAQNVGTLIVTLFNKYSKELTNLIPDILESAIYRLIDAKNV 769

Query: 771  STQQNLFSVLCFLTCNDPKQTVDFLCSF-QIDNMDALSLVMPKWMESFEVVRGERRIKEN 829
            +TQ+NL S++C++TC DP Q V+FL  F + +  D  SL+  KW E+FE+VRGER+IK+N
Sbjct: 770  TTQENLISLICYVTCCDPLQMVNFLFKFSESERRDIPSLMFNKWFETFEIVRGERKIKDN 829

Query: 830  IIALIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVS 889
            IIAL K+F L D RL  + VNGDL+PY+GD IITRSMAK+MPD+Y Q+ +Y+KI+K+FV+
Sbjct: 830  IIALSKIFFLSDFRLTYVKVNGDLLPYEGDRIITRSMAKEMPDRYTQIDVYSKIVKVFVT 889

Query: 890  ELGFQNKQPNPEQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXX 949
            EL F+NKQP+ E+LIT+                           VLDYEKLK+++     
Sbjct: 890  ELQFRNKQPDAERLITS---DIKHSDELAAAEGNDDDGWEDVDDVLDYEKLKEFVDDDDD 946

Query: 950  XXXXXX----XXXITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSE 1005
                         ITG+  V +S  Q+L  FFKE  + +V+GF  +Y +LSE+ER +LS+
Sbjct: 947  REDSVGLGNDADEITGIDAVPQSATQLLTAFFKEAMTNNVNGFQEMYNALSESERTILSQ 1006

Query: 1006 ALL 1008
             LL
Sbjct: 1007 CLL 1009

>CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241w KAP114
          Length = 1021

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1019 (44%), Positives = 653/1019 (64%), Gaps = 22/1019 (2%)

Query: 6    LITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLI 65
            LI  AQS DN  RE AE QLL  CD++A +VF SL  +  ++QT L SR F+LLSLRK I
Sbjct: 9    LIEQAQSPDNAVREGAETQLLNACDTNADEVFQSLIELGENNQTPLASRLFSLLSLRKFI 68

Query: 66   TMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPD 125
            TMYWSPGFESYR TSNV L  KE IR              K++N +SYC+VQISAVDFPD
Sbjct: 69   TMYWSPGFESYRGTSNVQLGTKERIRDVLLKLSLDDQQSNKVRNSSSYCVVQISAVDFPD 128

Query: 126  QWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVLTTEAS 185
            +WPQLL+ +Y+AI+Q+HS+NAMSLLNEIYDDV+SEEMFFEGGIG ET++IIF +LT    
Sbjct: 129  EWPQLLSTLYNAITQNHSLNAMSLLNEIYDDVISEEMFFEGGIGYETLQIIFTLLTNAQV 188

Query: 186  NLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXX-XXVNEDVT 244
             L +K +ALKLF AC+SQMS  D ++ + R   +++C                 +  D+T
Sbjct: 189  RLASKTSALKLFGACISQMSVLDNNSSQKRKLLVSECLGQALQTIKLLLEQCEIIQSDLT 248

Query: 245  CQSK---FRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTEN- 300
              ++   F+  +Y+++  IK NF +K FP++  +    +A++DL  +A +   +   +N 
Sbjct: 249  SINETLEFKDNLYDDINSIKENFPRKFFPEDVNLYVTNIAVRDLDQLAGL-YQESFKDNF 307

Query: 301  -EDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYF 359
             E S+   + C +++++FL    S P   E +  I+ +   LC   + T   W  DFN F
Sbjct: 308  DEQSMSIFENCVIHLLDFLANPIS-PLNNELISNILTASITLCEQSALTKDSWESDFNEF 366

Query: 360  VSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSN--HQTLESLLYLLQ 417
             SKETGL+AS+ +RD+V+E   +   P L   F+++   +  N+S+     +ES LYLLQ
Sbjct: 367  ASKETGLSASFTIRDEVAELVNAFEIPQLETSFELIVGYLSNNSSHLSADKIESALYLLQ 426

Query: 418  CILLNDDEITGQNIIQSSQSLIENLRSELVS-SELNEVTLARLILIIPKVLDKFIDVLPD 476
            C++  +D+ +  +++ S   LIE ++S L   + L++++  RL+L+IPK L KF+D+LP+
Sbjct: 427  CLMNVEDDFSNTSLVPS---LIEFIKSMLSQQNNLDQMSQIRLLLLIPKTLAKFMDILPN 483

Query: 477  IKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXXXXXX 536
            +K LT+  L   L +A   +  L+  + LI+FTY+  +AE+ SVLG +    V       
Sbjct: 484  VKQLTAETLNEILSMATNSNSHLIIISALISFTYFASYAEILSVLGNDQTLLVQNKTLHL 543

Query: 537  XXXXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVV 596
                S+++ EDTNG +MEVLN VI CN K   + E + + EF L+  IS KDPAN+QV +
Sbjct: 544  IQEISEESTEDTNGLLMEVLNCVIDCNDKNVANME-LFKFEFKLILVISGKDPANIQVSI 602

Query: 597  QSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKK 656
            +SQECLEKLL N+   +Y+S++++C+PSFIN+++++   NY Y+PLLSLVLEFITVF+K 
Sbjct: 603  ESQECLEKLLLNVNTNDYLSFVDICIPSFINIIKSSEVTNYSYSPLLSLVLEFITVFMKN 662

Query: 657  KPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMK 716
            KP    LPS + +++F+PL   L  STE+E LQ+ATEAFSY+I N+   V+ P+L  I+ 
Sbjct: 663  KPQEALLPSSVSEYVFDPLVSCLLKSTEEELLQIATEAFSYMIHNSSKDVITPKLETIVN 722

Query: 717  VLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNL 776
            +L+RLLS  +SDSAAMNVG+L++ + T +S  + PL+  I+ A V +LV + NI+TQQNL
Sbjct: 723  ILDRLLSSNISDSAAMNVGTLILALITEYSEPMNPLLPSIISAAVRKLVVSNNITTQQNL 782

Query: 777  FSVLCFLTCNDPKQTVDFLCSFQIDNMD----ALSLVMPKWMESFEVVRGERRIKENIIA 832
             ++LCFL C+DPKQTVDFLC   I N      AL +++ KW+++F VVRGE RIKENI+A
Sbjct: 783  VTLLCFLVCHDPKQTVDFLCELTIKNDKGEQVALPVIIQKWLDTFAVVRGENRIKENIVA 842

Query: 833  LIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELG 892
            L +LFLL D R++++ VNG++IPYDGDLIITRSMAK MPD+Y  V    KI+K+F+ ELG
Sbjct: 843  LSQLFLLGDDRVNEVKVNGEIIPYDGDLIITRSMAKSMPDRYTTVSAPEKIVKMFLGELG 902

Query: 893  FQNKQPNPEQLITTXXXXXXXXX-XXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXXXX 951
            FQ +  NPE+L+TT                            V+DYEKL++YI       
Sbjct: 903  FQGRNKNPEELLTTDDMKGMGLKPNQQSNNDEGDDDWEDVDDVVDYEKLQEYIDDEDDLD 962

Query: 952  XXXXXX--XITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008
                     ITG   + +S+ ++L  FF   A K+V+GF  IY +LSE ERK +SE +L
Sbjct: 963  DNSVGELETITGQQHIPQSIPELLKDFFNTAAQKNVAGFQEIYNNLSEEERKCISELIL 1021

>Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON}
            complement(8594..11602) [3009 nt, 1003 aa]
          Length = 1002

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/1005 (45%), Positives = 636/1005 (63%), Gaps = 17/1005 (1%)

Query: 2    DISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSL 61
            DI  LI  AQS DN  RE AE++LL  CD DA  VF S+  V  +    L SR FALL+L
Sbjct: 3    DIHQLINLAQSPDNSVREKAESELLAACDEDACIVFHSMIQVGSNGFEELSSRLFALLTL 62

Query: 62   RKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAV 121
            RKLITMYWSPGFESYR  S ++  +K + R             TKIKN ++YC+VQISAV
Sbjct: 63   RKLITMYWSPGFESYRLNSTLNEEIKNNFRDSLLKICLDDSQDTKIKNASAYCVVQISAV 122

Query: 122  DFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVLT 181
            DFPDQWP LL  +Y AI + HS++A+SLLNEIYDDV+SEEMFFE GIG ET+ IIF VLT
Sbjct: 123  DFPDQWPTLLNEVYGAIMERHSLSAISLLNEIYDDVMSEEMFFEEGIGSETIRIIFSVLT 182

Query: 182  TEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVNE 241
               + + AKIA+ KLF +CL QMS  D  +   R   + +C                V E
Sbjct: 183  DNNTGIAAKIASSKLFHSCLLQMSVLDPQSVHKRKQLVTECISQILTIWSGLLQKQNVTE 242

Query: 242  DVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDG-PTEN 300
             ++ + + RS IYE+L  IK+ F +K F KE    F+ + I DL NIA+   N+   +EN
Sbjct: 243  -MSSEFELRSKIYEDLAMIKSEFPRKLFSKENIEIFRRLVINDL-NIAAKCYNNVLSSEN 300

Query: 301  EDS-LETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYF 359
             D+ +  +    ++I+EFLT +    F+ E++  I +S   L  +D +T + W  DFN F
Sbjct: 301  SDTEMIHINEFVIHIIEFLTAISDFKFSPEDIGTISKSFVTLSCIDRNTEESWTADFNSF 360

Query: 360  VSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIV---SQDIVQNTSNHQTLESLLYLL 416
            +SKETGL AS+ +RDQ+++F +++++   S  + ++     +I+ + S+ +T ES+LYLL
Sbjct: 361  ISKETGLFASFTIRDQIADFISNVNEGVYSGFYSLILNEFNEIINSNSDWRTQESVLYLL 420

Query: 417  QCILLNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPD 476
            QCI  ++ EI  +++  ++Q L+  + + + +       L R IL IPK+L+KF++ LPD
Sbjct: 421  QCIATSETEI-NESLQCNTQILVTAIGNIISNPPTQSFVLMRSILTIPKLLEKFMETLPD 479

Query: 477  IKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXXXXXX 536
            +K  T   L  SLD+AL    ELV+S+ LIAFTYY  FAEL+SVLG  AC          
Sbjct: 480  VKEYTKQLLSISLDIALSSSDELVQSSGLIAFTYYTSFAELNSVLGDVACRVEQEKVLKL 539

Query: 537  XXXXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSEE-VLQAEFHLVFSISSKDPANVQVV 595
                S+D+EEDTNG ++EVLN VI CN+  P H +E +L+ EF  + +IS KDP+N+Q++
Sbjct: 540  IQNLSNDSEEDTNGVLVEVLNNVIDCNS--PQHLDETILEVEFDFLLTISVKDPSNIQLI 597

Query: 596  VQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLK 655
            V++QECLEKL++++ +  Y  Y    LP  INV+       Y Y+PLLSL LEFI + ++
Sbjct: 598  VEAQECLEKLIESMDINLYNKYAHKLLPFLINVINECNQTGYSYSPLLSLALEFINILMR 657

Query: 656  KKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIM 715
             +P    LP+ I + LF PL  +L  S EDETLQLATEAFS+L+FN+ T V+ P L +I+
Sbjct: 658  NRPDDISLPTYICEQLFSPLRHILMVSQEDETLQLATEAFSFLLFNSQTDVIFPYLEEII 717

Query: 716  KVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQN 775
             VL RLLS+++SD+AAMNVGSLVVTIFT+FS ++Q L+  IL+A   + + A+NIST QN
Sbjct: 718  NVLSRLLSMDISDTAAMNVGSLVVTIFTKFSEQVQELIPGILRATTDKFINAKNISTSQN 777

Query: 776  LFSVLCFLTCNDPKQTVDFLCSFQIDN--MDALSLVMPKWMESFEVVRGERRIKENIIAL 833
            L SV C L C DP +T+DFL + +I      +L LV+ KW+ESFE++RGE++IKENI+AL
Sbjct: 778  LVSVFCLLVCTDPARTIDFLYNLEIGTPPQSSLPLVLTKWLESFEIIRGEKKIKENILAL 837

Query: 834  IKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGF 893
             K++ L D+R+  + VNGD+IPY GDLIITRSMAK MPDKY +V +Y KI+KLFV+ELGF
Sbjct: 838  SKIYFLKDSRVSSIEVNGDIIPYTGDLIITRSMAKSMPDKYTRVSVYQKIVKLFVAELGF 897

Query: 894  QNKQPNPEQLITTXXXXXXX--XXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXXXX 951
            Q K+ +P  L+ +                             VLDYEKL++YI       
Sbjct: 898  QTKEQDPSDLVDSKLKQELGIPQQMGAAHGDDDDDDWEDVDDVLDYEKLQEYIDDDDEEE 957

Query: 952  XXX--XXXXITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYES 994
                     ITG+ +V ++  ++L+ FFKE ASKD++ F  IY +
Sbjct: 958  YVGGPESQEITGIEEVTQTTKELLIEFFKEAASKDINSFQEIYNT 1002

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] {ON}
            similar to uniprot|P53067 Saccharomyces cerevisiae
            YGL241W
          Length = 1009

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/1010 (43%), Positives = 621/1010 (61%), Gaps = 6/1010 (0%)

Query: 2    DISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSL 61
            D   LI  AQS  ++ R+++E +LLQ CD D+SQVF     VA   Q  L SRQFALL+L
Sbjct: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEDSSQVFVQFVQVAADTQQELPSRQFALLTL 62

Query: 62   RKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAV 121
            RKL+TMYW+PGFES+R TS V L  +  IR             +KI+NGASY +VQISAV
Sbjct: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122

Query: 122  DFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVLT 181
            DFPDQWP+LL ++Y+AI + HS+ AM LLNEIYDDV+SEEMFFE GIG ET++I+F V+ 
Sbjct: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISEEMFFEEGIGFETLKIVFHVMN 182

Query: 182  TEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVNE 241
            +  +N  AK+AAL L   C+ QMS+ +  +   R     +                    
Sbjct: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTI 242

Query: 242  DVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTENE 301
              T Q    + IY+ L  +KN FSKK    +   QF+ + ++DL+N + + +      ++
Sbjct: 243  SETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQ 302

Query: 302  DSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYFVS 361
            D L+ +   +V I+EFL+++C + FT EE++ +++ L+ LC ++ DT   W  DFN FVS
Sbjct: 303  DQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVS 362

Query: 362  KETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTS-NHQTLESLLYLLQCIL 420
            KETGL AS+ +RDQ +E  +S    + + +  ++  +I Q +  +   + +   L     
Sbjct: 363  KETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFNESLLYLLQS 422

Query: 421  LNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIKSL 480
            L  +E      + +   +   L+S L  S        R+IL+IPK+L+K +D  P+++ L
Sbjct: 423  LLLNEANSLEFMDAVTRIFTKLQSILEKSLSCVFVNCRIILLIPKLLEKIMDSFPNVRDL 482

Query: 481  TSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXXXXXXXXXX 540
              +FL  SLD AL    EL++SA LI+FTYY YFAEL SVLGP+ C +V           
Sbjct: 483  VQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIAQL 542

Query: 541  SDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVVQSQE 600
              +AE+DT+G +MEVL+ VI CN++    +  ++Q EFHLVF+ISSKDP+N+Q  ++ QE
Sbjct: 543  YPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIELQE 602

Query: 601  CLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKPSS 660
            CL KLL N+ +  ++++ E+C P  +NV+  +  ++++Y+PLLSL L+ + V +K+KP  
Sbjct: 603  CLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPLLSLTLQVLGVLMKRKPLD 662

Query: 661  EFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMKVLER 720
              L   I   +FEPL  +L  S ++E LQ ATEA  YLI+NT+ +V+ P L  I+ +L+ 
Sbjct: 663  PTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNILDA 722

Query: 721  LLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFSVL 780
            LLS  V D AA +VGSL VTIF++FS EIQ L+  ILQA   RL +A NI+T QNL SV 
Sbjct: 723  LLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLSVF 782

Query: 781  CFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGERRIKENIIALIKLFLLD 840
            CF+T  D +QTVDFL +  I N + L+LVM KW+ESF+VVRGE+R KENII L KLF L+
Sbjct: 783  CFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFFLN 842

Query: 841  DARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGFQNKQPNP 900
            D RL+ + VNGDLIPY+ D+IITRSMAK+MPD+Y QV +Y KIIKLF SEL FQ K  +P
Sbjct: 843  DQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQDP 902

Query: 901  EQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXX--XXXXXXXXX 958
            + L+                              L+YE+L+ Y+                
Sbjct: 903  QLLMAGTYGIETNTEENQDDDDNDDWEDVEGP--LEYERLQHYVEEDETDDRGEELDEQC 960

Query: 959  ITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008
            +   +D + SV Q+LV FFKEVA+K++SGF  IYE LS+NE+++LSE LL
Sbjct: 961  LADNLDSR-SVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009

>TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.564
            YGL241W
          Length = 1010

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/1025 (43%), Positives = 638/1025 (62%), Gaps = 34/1025 (3%)

Query: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60
            +DI  LI  AQS +   RE AE  LL+WC+ DA   F +LA+VA ++   L SRQ++LL+
Sbjct: 3    IDIDSLIKQAQSPETSLREHAENSLLEWCEHDACSAFAALANVAANNTEILSSRQYSLLA 62

Query: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISA 120
            LRKLITMYWSPGFESY  TSN++  VK  +R             +KI+   SYCIVQ+SA
Sbjct: 63   LRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSA 122

Query: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180
            VDFPD WP+LL  +Y +I + HS+ A+S+LNEIYDD++SEEMFFE GIGLET+ +IF +L
Sbjct: 123  VDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNIL 182

Query: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVN 240
              + + +  KIAA KLF  CL QMS     +   R N +                    +
Sbjct: 183  DDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLED 242

Query: 241  ------EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVN 294
                  E+   + KFR  IYE L F+ +NFSKK  P  F   F+  +++DL   +++ +N
Sbjct: 243  ALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYIN 302

Query: 295  DGPTENEDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIG 354
                +N  +   +    ++I E+L+ +    +  EE+ +I++S+  LC +D+   + W  
Sbjct: 303  MISGDN-IAFNALNKYIIHIFEYLSNISRANYEREELILILESIYKLCCLDNLIVETWNS 361

Query: 355  DFNYFVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSN------HQT 408
            +FN FVSKE GL ASY++RDQ+S+F  SLS  N    F+I+ ++ + N +N       + 
Sbjct: 362  NFNEFVSKEFGLMASYSLRDQISDFLISLSSNN----FNIIFKEFITNLNNCLIIEDWRQ 417

Query: 409  LESLLYLLQCILLNDDEITGQNIIQSSQSLIENLRSELVSSE----LNEVTLARLILIIP 464
            LES+LY+ Q +L+ND     ++I+  +   IENL S L  +      N +  +RLIL+IP
Sbjct: 418  LESMLYIFQSLLIND-----EDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIP 472

Query: 465  KVLDKFIDVLPDIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPE 524
            K+L+KF+D + +IK +T  FLK SL + L  +  L++S+ L+    YC FAEL +VLG +
Sbjct: 473  KILEKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDK 532

Query: 525  ACTEVXXXXXXXXXXXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSI 584
             C EV            DD+E+DT G IMEV+N +I CN       E + Q EF+L+ SI
Sbjct: 533  TCQEVQQITLKIILQILDDSEDDTYGMIMEVINNLIDCNLPNDKLGE-IPQQEFNLILSI 591

Query: 585  SSKDPANVQVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLS 644
            +S+DP+NVQ+ V+SQECL+KLL+ +    Y  YIE+C PS + VL  +    YKY+ LLS
Sbjct: 592  TSRDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLS 651

Query: 645  LVLEFITVFLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDT 704
            L LEFIT+F+KKKP+  +LP EI + +F PL  VL  S EDETLQL+++AFSYLI+NTD 
Sbjct: 652  LALEFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDP 711

Query: 705  QVMEPRLMDIMKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRL 764
             VM   L  I++V++RLLSL+V+DSAAMN GSLVVT+FT F  EI+P +++IL     RL
Sbjct: 712  IVMVESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRL 771

Query: 765  VKAQNISTQQNLFSVLCFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGER 824
            ++A+NIST QNL SV+C+L C++ + T++ L     +  D L LV+ KW+ +FE++RGER
Sbjct: 772  IQAKNISTIQNLISVICYLICSNTEDTINLLSRLGTEG-DILKLVLNKWISNFEIIRGER 830

Query: 825  RIKENIIALIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKII 884
            RIK+NI+AL KL+ L+++ +  +MV+ +LIPYDGD IITRSMAK+MPD+Y Q+P+Y+KII
Sbjct: 831  RIKQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKII 890

Query: 885  KLFVSELGFQNKQPNPEQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYI 944
            KLF+ EL  Q KQP     I                             VLDYEKL++Y+
Sbjct: 891  KLFIQELSEQMKQPEHNLKI-----EETVETIGDGNAAAADDDWEDVEDVLDYEKLQEYV 945

Query: 945  XXXXXXXX-XXXXXXITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVL 1003
                           I G MD++  V ++L+   KE ASK+VS F +IY +LSE+E+++L
Sbjct: 946  DDEDDELHFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRIL 1005

Query: 1004 SEALL 1008
            SE L+
Sbjct: 1006 SECLV 1010

>TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1022

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1025 (42%), Positives = 640/1025 (62%), Gaps = 23/1025 (2%)

Query: 2    DISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSL 61
            D+  LI  AQSADN+ RE AE++LLQ CD +AS VF SL  +A +    L SRQF +LSL
Sbjct: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62

Query: 62   RKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAV 121
            +KLITMYWSPGF+SYR TSNV    KE +R             +KIK+ +SYCIVQISA+
Sbjct: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122

Query: 122  DFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVLT 181
            DFPD WP LL VIY+AI + HSI AMSLLNEIYDDV+SEEMFFEGG+G ET++ IF + T
Sbjct: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISEEMFFEGGVGEETIKTIFAIFT 182

Query: 182  TEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVN- 240
            +  +N+ AK+AA KL  + + QMS  D      R +F++QC                VN 
Sbjct: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCITKLLDILLTILPHLDVNQ 242

Query: 241  -EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTE 299
             ED     + ++  YE L  IK  F KK F       FK +++KDL+ I S  +    ++
Sbjct: 243  SEDAL---QLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSD 299

Query: 300  NEDS-LETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNY 358
               S L+ +    V++++F++++    F   ++  I+ SL  LC +D++T + W  DFN 
Sbjct: 300  ASGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNT 359

Query: 359  FVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDI---VQNTSNHQTLESLLYL 415
            F+SKE GL A+Y +RDQ  +FF+ L  P  S+ + I+ +++   ++N +N +  ESLLY 
Sbjct: 360  FISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYT 419

Query: 416  LQCILLNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLP 475
            LQ I+ +++E   + ++  +++++ +L   L+    N +  +R +L+ PK L+KF++   
Sbjct: 420  LQSIISSEEEFNSE-LLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYT 478

Query: 476  DIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXXXXX 535
             +K +T   L  SL+L+L    E+++S++LIAF+YY  +A+L SVLG   C  +      
Sbjct: 479  AVKPMTKELLSTSLNLSLNTSSEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLK 538

Query: 536  XXXXXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVV 595
                 ++DAEEDT    +E ++ VI  N+ G   S+EV   EF+++  IS KDP N+Q+ 
Sbjct: 539  IIKDIANDAEEDTYAICVETISNVIDNNSSGT-GSDEVRDNEFNILLEISFKDPGNIQLS 597

Query: 596  VQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLK 655
            V+SQECLEKLLD + +  Y+ Y E  +P  I ++  +   NY Y+PLLSL L+F+  F+K
Sbjct: 598  VESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMK 657

Query: 656  KKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIM 715
            KKP    LP EI + +F P+ +VL  S E+ET+QLATEAFS+L+FN+D  +M+  L +I+
Sbjct: 658  KKPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIV 717

Query: 716  KVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQN 775
             VL +LLSL +SD+AAMNVG+L++TIF++FS +IQ L+  ILQA   + V A+NI T QN
Sbjct: 718  NVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQN 777

Query: 776  LFSVLCFLTCNDPKQTVDFLCSFQIDNM---DALSLVMPKWMESFEVVRGERRIKENIIA 832
            L  V CFL C+DP+QTVDFL +  +++    + L+LV+ KW+E F+++RGE+RIKENIIA
Sbjct: 778  LLMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIA 837

Query: 833  LIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELG 892
            L K++LL D R+  ++VNGD+IPY GD IITRSMAK +PD++ Q+P+Y KI+KLF+ EL 
Sbjct: 838  LSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELA 897

Query: 893  FQNKQ---PNPEQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYI----X 945
             Q+K     N   +                              VLDYEKL++Y+     
Sbjct: 898  SQSKNISDANLHSIDIQKLARAEENQVEQKLDSSEDDDWEDVEDVLDYEKLQEYVDDDDD 957

Query: 946  XXXXXXXXXXXXXITG--LMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVL 1003
                          TG  + D+ +SV ++++ FFKEV SK+++ F  IY SLSE+E+K+L
Sbjct: 958  ELANYTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKLL 1017

Query: 1004 SEALL 1008
            + AL+
Sbjct: 1018 ANALV 1022

>SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1009

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1016 (41%), Positives = 632/1016 (62%), Gaps = 19/1016 (1%)

Query: 2    DISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSL 61
            +++ L+  AQSAD   REAAE+ LLQ+   +   +F SL  +A +    L SRQF+LL L
Sbjct: 4    NVAQLVIQAQSADKKEREAAESSLLQFSAQEPESMFLSLIDIACN-SYPLTSRQFSLLFL 62

Query: 62   RKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAV 121
            R+L+TMYWS GFESY     V    K  +R              K KN +SYC+VQISAV
Sbjct: 63   RRLVTMYWSAGFESYVGPPGVGSRGKSIVRESLLRLSLDDSQDIKTKNSSSYCVVQISAV 122

Query: 122  DFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVLT 181
            DFPD+WP LL  IY+AI +H+S++AMSLL EI+DDVVSEEMFF+GGIG +T++I+ +VLT
Sbjct: 123  DFPDEWPDLLIRIYEAIVEHYSLSAMSLLTEIFDDVVSEEMFFQGGIGWQTIQIVSQVLT 182

Query: 182  TEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVNE 241
            +  S++ +K AAL L+ AC+ Q+ S    +   R + I +                  ++
Sbjct: 183  SSTSSVESKSAALDLYHACVLQLQSPQATSTIERKHAIAEHIKQMLGLFIQLLQFYQSSQ 242

Query: 242  DVTCQS--KFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTE 299
            D    +  K ++ IYENL  +K+NFSK+ FP+E +   K + +KDL  I+++        
Sbjct: 243  DEIQPTLLKLKASIYENLGMLKSNFSKQFFPEEEKNILKGLVLKDLNAISNIYYRSLNNT 302

Query: 300  NEDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYF 359
            ++  ++++  C+++I+ FL+++  + F+  E  +++ SLT +C +    T  W   FN F
Sbjct: 303  DDKDIDSLDECAIHIIVFLSSLHELVFSPTETPVLLDSLTKVCCLTDTQTSDWDNYFNIF 362

Query: 360  VSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDI-VQNTSNHQTLESLLYLLQC 418
            V+KETGLAASY+ RD+  +FF++L+  N + +   ++Q++      + +  ESL+YL++ 
Sbjct: 363  VTKETGLAASYSARDESFQFFSNLTGTNYTNLLAFLTQNVHASGIEDWKYQESLMYLMEA 422

Query: 419  ILLNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIK 478
             + ND+EIT  N  Q     ++     L S E NE    R+ILI+PK+L+KF+D L DIK
Sbjct: 423  AVNNDEEIT--NDFQPVLQTLDAFSELLASCETNEFVKVRVILILPKILEKFMDSLEDIK 480

Query: 479  SLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXXXXXXXX 538
             L   FL  +  L     +++++ A LI+FTYY  FAELDSVLG E   ++         
Sbjct: 481  LLVKKFLFQTFTLVSAPTKDILKVASLISFTYYSSFAELDSVLGTETYQQLKEAVLKIIN 540

Query: 539  XXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQA----EFHLVFSISSKDPANVQV 594
               +DAE+DT   ++E LN++I     G   + EV+ +    E  L+  IS+KDP+N+QV
Sbjct: 541  EIYEDAEDDTPALLLETLNQII-----GSTSNAEVIASVRFDELQLILKISAKDPSNIQV 595

Query: 595  VVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFL 654
            V+++QECL+ LL NI++  Y+ Y E+ +PSF+NVLE +  + ++Y+P+LSL LE +TVF+
Sbjct: 596  VLEAQECLQNLLKNISLEIYLKYAEMAIPSFVNVLEGSNSSGFEYSPILSLSLELLTVFM 655

Query: 655  KKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDI 714
            KKKP++  LP  I   +F+PL++ L  S +DE LQL T+ +S+LI N++   + P L  I
Sbjct: 656  KKKPTNGTLPPRITDFVFQPLSETLVGSQDDEVLQLTTDIYSFLINNSENSQIAPHLNTI 715

Query: 715  MKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQ 774
            + VLE+LLS+  SDSAAMNVGSL++ IF + S ++Q  +  IL+A   RLV+  NI+T +
Sbjct: 716  LSVLEKLLSINTSDSAAMNVGSLIIAIFCKLSDQLQETIPTILEAAAKRLVQVHNIATAE 775

Query: 775  NLFSVLCFLTCNDPKQTVDFLCSFQIDNMD--ALSLVMPKWMESFEVVRGERRIKENIIA 832
            NL  V C+LT  +P QTVDFL S  +D+    AL L++PKW+ESFE++RGE+RIKENI+A
Sbjct: 776  NLIFVFCYLTSTNPNQTVDFLSSLVLDSEGNSALKLILPKWLESFEIIRGEKRIKENILA 835

Query: 833  LIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELG 892
            L KLF L+D R+  ++VNGD IPYDGDL+ITRSM+K MP+KY Q+  Y KI+KLFV+EL 
Sbjct: 836  LSKLFFLNDERISSIIVNGDSIPYDGDLVITRSMSKIMPEKYTQISAYEKIVKLFVAELS 895

Query: 893  FQNKQPNPEQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXXXXX 952
            FQ  QP  E+ I                             VL+YEKL++Y+        
Sbjct: 896  FQGNQPGLEKYI-PHDLKKYDDQAIKAANDANDDDWEDVDDVLEYEKLQEYVDDESDLED 954

Query: 953  XXXXXXITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008
                  I G+ ++ +S  ++L+ FF+E A+K+VSGF  IY  L++NE++VL+E L+
Sbjct: 955  DEEGDVI-GVQELHQSTRELLIQFFREAAAKNVSGFQEIYNHLNDNEKRVLTENLV 1009

>Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {ON}
            similar to Ashbya gossypii AFR269W
          Length = 1019

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/1021 (38%), Positives = 599/1021 (58%), Gaps = 35/1021 (3%)

Query: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60
            MD+S LI  AQS     RE+AE  LL  C SD   VF SL ++A      + S+QF L+S
Sbjct: 13   MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVS 72

Query: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISA 120
            +RKLITMYW+ GFESY     V+   KE +R             +KI + +SYCIVQI+A
Sbjct: 73   IRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAA 132

Query: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180
            VDFPD+WP LL  +YDAI+  +S NA+SLL+EI+DDVVSEEMFF+GGIG +TV+I+F +L
Sbjct: 133  VDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL 192

Query: 181  TTEASNLVAKIAALKLFKACLSQM-SSHDKHNDESRNNF---INQCXXXXXXXXXXXXXX 236
            +  +S+   K AA+KL+ +CL Q+ S H   +DE+R+     +N+               
Sbjct: 193  SNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNLA 252

Query: 237  XXVNEDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDG 296
               NE +      ++  YENL  +K  F KK FP + +  FK VA+KDL  +        
Sbjct: 253  DPSNELL----DLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQIL 308

Query: 297  PTENEDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDF 356
             + +E  L++V   ++ I+ FL+++        E+  +++SL  LC +          D 
Sbjct: 309  ASVDEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDL 368

Query: 357  NYFVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSNHQTL-----ES 411
            N FVSKETG++  Y +RD+V +F + +   N   +F    Q +++   +   L     ES
Sbjct: 369  NSFVSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIF----QTLLEQAGSVMHLDWEKQES 424

Query: 412  LLYLLQCILLNDDE--ITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDK 469
            +LYLLQ    N +E  +  Q +++    L+  L++ L S  ++ +  +RL + I K+L+K
Sbjct: 425  MLYLLQSCQGNTEEFEVNSQGLVE----LLLRLQNILESQNIHCLVWSRLSITIAKILEK 480

Query: 470  FIDVLPDIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEV 529
            F+  L +IK +   F+  +L +A       +++  LI++  Y  F  L SVLG E C ++
Sbjct: 481  FVCKLENIKLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKL 540

Query: 530  XXXXXXXXXXXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQA-EFHLVFSISSKD 588
                         + ++DT G ++EVL+ VI+ N   P  + + L+A E   V  +S+ D
Sbjct: 541  ERQVLDIINDIYAEVDDDTPGFLLEVLSGVIASN---PESTNKSLKASELEFVLKLSTSD 597

Query: 589  PANVQVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLE 648
            P +VQVVV++Q+CL  LL  +   +Y+ Y ELC+PSF++VL A+  + + YTPL+SL LE
Sbjct: 598  PYSVQVVVEAQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLE 657

Query: 649  FITVFLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVME 708
             +TVFLKK PS  FLP  + +++FEPL  ++  S +DE LQL+TEAF++L+ N+    + 
Sbjct: 658  LLTVFLKKNPSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDIS 717

Query: 709  PRLMDIMKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQ 768
              L   + +LERLL+ + S SA+  VGSL++++ T+F+ +IQ ++ ++L+A   RLV+  
Sbjct: 718  SHLQTAIMILERLLASDTSYSASSKVGSLLLSVLTKFADQIQDIMPKLLEAAARRLVQVN 777

Query: 769  NISTQQNLFSVLCFLTCNDPKQTVDFLCSFQI--DNMDALSLVMPKWMESFEVVRGERRI 826
            NI T +NL  V C LT  D KQTVDFL S  +  D   AL L++PKW++SFE++RGE++I
Sbjct: 778  NIHTVENLILVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKI 837

Query: 827  KENIIALIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKL 886
            KENI+AL KLF L+D+R+  ++VNGDLIPYDGDLIITRSMAK +PDKY ++  Y KIIKL
Sbjct: 838  KENIVALSKLFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKL 897

Query: 887  FVSELGFQNKQPNPEQLITTXXXXXXXX---XXXXXXXXXXXXXXXXXXXVLDYEKLKDY 943
             V+EL FQ  QP+P++ +++                              VL+YEKL++Y
Sbjct: 898  MVTELMFQYNQPDPDKYMSSQSEKLTKTNQDNKSNSGNADHDDDWEDIDDVLEYEKLQEY 957

Query: 944  IXXXXXXXXXXXXXXITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVL 1003
            I              +    +++E+  ++L  FFKE   KD+SGF  IY  L+E E++ L
Sbjct: 958  IEGSDIDDDDDDLLIMN---NIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCL 1014

Query: 1004 S 1004
            S
Sbjct: 1015 S 1015

>Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa]
            {ON} YGL241W (KAP114) - Kap114p [contig 344] FULL
          Length = 1011

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/1012 (36%), Positives = 594/1012 (58%), Gaps = 19/1012 (1%)

Query: 7    ITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLIT 66
            I  AQS D  TRE  EA + + C  D S     L  +A      +++R F+LLSLRKLIT
Sbjct: 9    IASAQSPDKQTREQGEACIWKLCSEDPSFSCACLVQLACRQDYRIENRLFSLLSLRKLIT 68

Query: 67   MYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPDQ 126
            MYWS GFESYR    V+ + KE IR             T+I+ G+SYCIVQI+AVDFPD+
Sbjct: 69   MYWSAGFESYRGPPGVNEDCKELIRNSLLELGLDDAQDTRIQKGSSYCIVQIAAVDFPDE 128

Query: 127  WPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVLTTEASN 186
            WP L+ ++Y+AI + HS++A+ +LNEI+DDVVSEEMFF  G+G +T+++I  +L     +
Sbjct: 129  WPGLIEIVYNAILRSHSVSALYVLNEIFDDVVSEEMFFNQGVGWQTIQLISNILNDPGCS 188

Query: 187  LVAKIAALKLFKACLSQMSSHDKHN-DESRNNFINQCXXXXXXXXXXXXXXXXVNEDVTC 245
            ++AK +A KL++ACL Q+ S    +  E R+   N                  + ++   
Sbjct: 189  ILAKHSAAKLYQACLLQLQSPAASSTPELRSALTNHIQESTKMLLNLLQAYSNIQDEAID 248

Query: 246  QSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTENEDSLE 305
              +    + + L  I+  F KK        +   V I++   +A+++ ND  TE E S E
Sbjct: 249  LLRLHQTVLKCLTTIRTGFPKKLSSDTIGRELTTVLIENFTRVAALS-NDN-TEEEKSSE 306

Query: 306  TVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYFVSKETG 365
             +    + +V  L T+         +  +++       + ++  + W  DFN+FVSKE G
Sbjct: 307  -INEVGIQMVSLLATIPDRYLGGPALSKVVEDFVLASCLGTEEEEAWESDFNHFVSKEVG 365

Query: 366  LAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQ-NTSNHQTLESLLYLLQCILLNDD 424
            LA+SY +RD+ S+F   +S      +F+I+   + + +    +  E++ YL+Q + +N+D
Sbjct: 366  LASSYYIRDECSQFLQEISGARYQSIFEILVSALSKVDPLEWRLKEAVFYLIQSLCINED 425

Query: 425  EITGQNIIQSSQ--SLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIKSLTS 482
            E+T   +  +++   L+  LR  +    L      R IL +PKV++KF+D L ++K +  
Sbjct: 426  EVT---VFNNNEVFDLLNELRQNMEGQNLQLHVRTRAILALPKVVEKFMDRLENVKDIVK 482

Query: 483  SFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXXXXXXXXXXSD 542
              L A+L+ A + +   ++++ LIAF+ Y  FAELDSVLG EA  E             +
Sbjct: 483  ELLFATLNGACEDNDPTLKASALIAFSSYASFAELDSVLGLEAFQEARCLVLNLIQDVLE 542

Query: 543  DAEEDTNGTIMEVLNEVISCNTKGPHHSEEVL--QAEFHLVFSISSKDPANVQVVVQSQE 600
            D+E+DT   ++E LN  ++   K  + +++ L  Q   +LV  IS+KDP+N+QVV+++Q+
Sbjct: 543  DSEDDTPAVLLEALNPALA---KQSNTTKDTLFYQQALNLVLKISAKDPSNLQVVLEAQD 599

Query: 601  CLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKPSS 660
            C+  LL   +  +Y+   + C+P F+N+L   + NNY Y P++SL LE +TVF+KKKPS 
Sbjct: 600  CISALLSGESTESYVELSKSCIPLFVNILGTMKANNYIYAPIVSLSLELLTVFMKKKPSD 659

Query: 661  EFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMKVLER 720
             FLPS I  ++FEPL+ +L  S++DE LQ+A++A +YL+ N+    +EP L  ++ +LE+
Sbjct: 660  GFLPSNISSYVFEPLSDILINSSDDEILQVASDALTYLMSNSQASDLEPLLPTVLSILEK 719

Query: 721  LLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFSVL 780
            LLS+  SDS AMNVGSLVV    ++S ++Q +  +IL+A   R V A+N++T +NL  V 
Sbjct: 720  LLSVNTSDSGAMNVGSLVVITLEKYSYQLQEVYPKILEAATKRFVSAKNVATTENLVFVF 779

Query: 781  CFLTCNDPKQTVDFLCSFQIDNMDALSL--VMPKWMESFEVVRGERRIKENIIALIKLFL 838
            C+LT  +P + ++FL SF I+  +  SL  V+PKW+ESFEV+RGERRIKENI+AL K+F 
Sbjct: 780  CYLTSINPAEAINFLSSFTINEKEGNSLNYVLPKWLESFEVLRGERRIKENIVALSKIFF 839

Query: 839  LDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGFQNKQP 898
              D R+  ++VNGD +PY GD+I+TRSMAKKMP +Y ++  + KI+KLFV+EL FQ+ QP
Sbjct: 840  QSDPRVGSVIVNGDPLPYKGDIIVTRSMAKKMPIEYTRITAHEKIVKLFVAELEFQSSQP 899

Query: 899  NPEQL--ITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXXXXXXXXX 956
            + ++   +                             VL+Y++L+ ++            
Sbjct: 900  SLDKFLPVNARKFDTSSSFNNNAEDEQDDGEWEDVDDVLEYDQLQQFVVEDGERNDSDDE 959

Query: 957  XXITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008
              +  + D+++S  ++L+ FFKE A+K+++    +YE+LSE+E+K+LSE L+
Sbjct: 960  DSLANIQDIQQSTKELLIDFFKEAAAKNINNLRDLYENLSEHEKKILSENLM 1011

>AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGL241W (KAP114)
          Length = 1017

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/1016 (37%), Positives = 583/1016 (57%), Gaps = 25/1016 (2%)

Query: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60
            MD+  L+  AQSA    RE+AE  LL+ C +D + V   L  +A    T L SRQF L +
Sbjct: 19   MDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYT 78

Query: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISA 120
            LRKLITMYW+ GFESY     V  + KE++R             +KI + ++YC+VQI+A
Sbjct: 79   LRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAA 138

Query: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180
             DFPD+WP LL  +Y++I+   S+ A+ LL+EI+DDVVSEEMFF+GG+G +T+ IIF++L
Sbjct: 139  FDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELL 198

Query: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVN 240
              +   +  K AA+KL+ +CL Q+++     +      +                     
Sbjct: 199  GDDGP-VALKDAAMKLYHSCLLQLAAPQALEEADTRAAVGAHVHEALELFAQLLEHCRSL 257

Query: 241  EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTEN 300
            E      +F++  YENLV IK    K+ FP   +       ++DL  + +         +
Sbjct: 258  EPHADLLQFQAHTYENLVLIKTQLPKRFFPGALREALLDAVLRDLVLLGAYYEQHLAEGD 317

Query: 301  EDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYFV 360
            E+ L+ V   ++++V FL++V       E M M++ SL  L  + +  T+ W  D+N F+
Sbjct: 318  EELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSFI 377

Query: 361  SKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTS-NHQTLESLLYLLQCI 419
            SKETGL +SY  RD++ ++ + L   N      ++ + ++Q  S   ++ ESLL+LLQ  
Sbjct: 378  SKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRSQESLLFLLQSC 437

Query: 420  LLND-----DEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVL 474
             LN      DE T   +++ SQ L       L S +++ +   R+ + +P++L+K++D L
Sbjct: 438  QLNSEGPQFDEQTVAGLLEKSQRL-------LRSGDVHPLVRCRVAMTVPRLLEKYMDSL 490

Query: 475  PDIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXXXX 534
            P++K L   F+  + +  +    +L+ ++ LIAFTYY  F +  SVLG +   E+     
Sbjct: 491  PNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVL 550

Query: 535  XXXXXXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQV 594
                   D  +EDT G ++EVL+ V  CN +    + E+   E  LV ++++ DP+N+QV
Sbjct: 551  STIKNILDGIDEDTPGFLLEVLSGVTGCNKES--RNRELKLYELQLVQNVATADPSNIQV 608

Query: 595  VVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFL 654
            VV++QECL+ LL      NY+ Y ELC+PSF+ VL A+  + Y YTPL+SL LE + VF+
Sbjct: 609  VVEAQECLKNLL-QYDPENYLQYAELCIPSFLEVLRADSSHGYAYTPLVSLSLELLVVFM 667

Query: 655  KKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDI 714
            +KKP    LP  +  ++F+PL+ +L  + +DE LQL+TEAF+ L+ ++ T  +  R+  I
Sbjct: 668  RKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFTALLASSLTDDLLGRIPVI 727

Query: 715  MKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQ 774
            + +LE+LLS   S SAA+N G+L++ + T+F+ +IQ ++ +IL+A   RLV+ +N+ T +
Sbjct: 728  ITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAE 787

Query: 775  NLFSVLCFLTCNDPKQTVDFLCSFQID--NMDALSLVMPKWMESFEVVRGERRIKENIIA 832
            NL  V C+LT  D +QTVDFL S  ID     AL  ++P+W+E+FEV+RGE +IKENI++
Sbjct: 788  NLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILS 847

Query: 833  LIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELG 892
            L KLF L+D R+  + VNGDLIP+DGD+IITRSMAKKMPDKY Q+    KI+KLFV+EL 
Sbjct: 848  LSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELA 907

Query: 893  FQNKQPNPEQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXXXXX 952
            FQ  QP+P +                               +LDYEKL++Y         
Sbjct: 908  FQQNQPDPGRY---PKDGSGPADPHDSEGDSADEDWEDVDDILDYEKLQEYADDSDIDDT 964

Query: 953  XXXXXXITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008
                   +   +++E    +L  FFKE  +++ SGF  IY  L+E E+K LS  ++
Sbjct: 965  GDSLLFTS---NIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017

>KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1021

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/1012 (37%), Positives = 572/1012 (56%), Gaps = 20/1012 (1%)

Query: 7    ITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLIT 66
            I GAQS +   RE +E  L   C  + S   TSL  +A   + +++ R F+LLSLRKLIT
Sbjct: 20   IVGAQSTNGQVRENSENALWSLCSENPSATCTSLMQLACGIENAVEDRIFSLLSLRKLIT 79

Query: 67   MYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPDQ 126
            MYWS GFESYR    +    K  IR             T++KN +SYCIVQI+AVDFPD+
Sbjct: 80   MYWSAGFESYRGPPGIGDEGKRMIRESLLNLGLDDSQDTRLKNCSSYCIVQIAAVDFPDE 139

Query: 127  WPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVLTTEASN 186
            WP L+  I+DAI Q  S++A+ +LNEI+DDVVSEEMFF  GIG +T+++IF++L+   S+
Sbjct: 140  WPTLVDSIFDAILQRQSLSALYVLNEIFDDVVSEEMFFHRGIGWQTIQLIFRILSNSDSS 199

Query: 187  LVAKIAALKLFKACL----SQMSSHDKHNDESRNNFINQCXXXXXXXXXXXXXXXXVNED 242
              AK A+ KL++ACL    S M++  +    + +N I +                 +N  
Sbjct: 200  TQAKTASAKLYQACLLQLQSPMATSTQDYKYALSNHIQESVLLLIKVLKEHHIAKGIN-- 257

Query: 243  VTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTENED 302
             T     + ++   L  IK  FSKK F  E   +      ++ + IA + ++   T + D
Sbjct: 258  -TSALNLQQVLLSCLNTIKTGFSKKLFTIESAQELIEFLFENFRKIAELCID--VTIDPD 314

Query: 303  SLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYFVSK 362
                     + +V    T+       +    I++S      +  +  + W  DFN F SK
Sbjct: 315  MKLAANEVGIQMVSLFATLMDTLTENQNWNFIVESFVIAGMISDEDAECWDNDFNVFASK 374

Query: 363  ETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTS-NHQTLESLLYLLQCILL 421
            ETGL+ S+ VRD+  +F   LS    + +F+ ++  ++ N S N +  ES+L+ +Q +  
Sbjct: 375  ETGLSTSFTVRDECEQFMQGLSGFAYNSVFNALTSALIYNESPNWKVQESILFFIQALCG 434

Query: 422  NDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIKSLT 481
            N+D+    N  + +QSL+  LR  L   + + +   R ++ +PKV+++F++ L  +K+L 
Sbjct: 435  NEDDEVSFNF-EKTQSLLNTLRQILELEDSHILVKTRSLIALPKVIERFMETLESVKALV 493

Query: 482  SSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVXXXXXXXXXXXS 541
               L  S  LA +     V+   LI+FTYY  FAELDSVLGP    E             
Sbjct: 494  KDSLFHSFSLARQTPSYTVKIGCLISFTYYASFAELDSVLGPGFYGEAQRSVSAIIQELL 553

Query: 542  DDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVL---QAEFHLVFSISSKDPANVQVVVQS 598
            ++AEEDT   ++E L   +S N    H + E +   Q    L+  ISSK P+N+QV +++
Sbjct: 554  EEAEEDTPSILLEALAPTLSSN----HKTTETISFYQLALQLILKISSKHPSNIQVGLEA 609

Query: 599  QECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKP 658
            Q+CL  LL + +   Y++Y + C+P F NVL     N + Y P++ L LE +TVF+K+KP
Sbjct: 610  QDCLSNLLKSTSTEEYVTYSKTCIPLFANVLNGMIENKFAYAPIVCLSLEMLTVFIKRKP 669

Query: 659  SSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMKVL 718
                LPS+I  ++F PL+ +L  S++DE +QL ++A  YLI N++   + P L  ++  L
Sbjct: 670  RDGCLPSDITSYVFNPLSDILINSSDDEIMQLTSDALVYLISNSEPHQLFPHLNVVLCDL 729

Query: 719  ERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFS 778
            E+LLS E SDS A++VG+LVV +  +FS ++Q +  RIL+A   + + A N+ T +NL +
Sbjct: 730  EKLLSAETSDSGAIHVGNLVVVVLEKFSKQLQEIYPRILEAATKKFLGAHNVFTTENLAN 789

Query: 779  VLCFLTCNDPKQTVDFLCSFQIDNMD--ALSLVMPKWMESFEVVRGERRIKENIIALIKL 836
            V C+L   +P + ++FL SF ID  +   L  V+ KW+ESFEV+RGE+RIKENI+AL KL
Sbjct: 790  VFCYLVSLNPAEVINFLSSFSIDQQEQSVLCPVLSKWLESFEVLRGEKRIKENIMALSKL 849

Query: 837  FLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGFQNK 896
            F   D+R+ K+ VNGD IPY GD+IITRSMAK MP+KY ++  Y KI+KLFV+EL FQ  
Sbjct: 850  FFQADSRIDKIYVNGDPIPYSGDMIITRSMAKSMPEKYTRITAYQKIVKLFVAELDFQTS 909

Query: 897  QPNPEQLITTXXXXXXXXXXXXXXXXXXXXXXXXXXXVLDYEKLKDYIXXXXXXXXXXXX 956
            Q + E+ I                             VL+YE+L+ ++            
Sbjct: 910  QTDLEKYIPMSAKKTECSTIANAEAGQEESDWEDVDDVLEYEQLQHFVDQDTFSSDRDEE 969

Query: 957  XXITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008
              I G+ +V++S  ++L+ FFKE AS++++ F  IY++LSENE+++LSE L+
Sbjct: 970  DVIPGIKNVQQSTRELLISFFKEAASQNINDFKTIYDNLSENEKRILSENLV 1021

>KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar to
           uniprot|P53067 Saccharomyces cerevisiae YGL241W KAP114
           Karyopherin, responsible for nuclear import of Spt15p,
           histones H2A and H2B, and Nap1p; amino terminus shows
           similarity to those of other importins, particularly
           Cse1p; localization is primarily nuclear
          Length = 952

 Score =  178 bits (451), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 167/631 (26%), Positives = 300/631 (47%), Gaps = 49/631 (7%)

Query: 273 FQVQFKLVAIKDLKNIASMNVNDGPTENEDSLETVQTCSVYIVEFLTTVCSIPFTIEEMK 332
           ++++  L AIK   N  +  + +    +E  LE + +  +  V++L  + S       + 
Sbjct: 276 YRLRITLDAIKSNANSYARALTNN---DELRLEIINSSCINTVQYLAYIPSDLIENPTLP 332

Query: 333 MIIQSLTALCRVDSDTTQLWIGDFNYFVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMF 392
              +    LC +  D  +L   DFN F+SKETGL+ASYN RD++ ++ +S SD     + 
Sbjct: 333 DFTEDFIKLCLLPEDYFKL--SDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHIT 390

Query: 393 DIVSQDIVQNTSNH-QTLESLLYLLQCILLNDDEITGQNIIQSSQSLIENLRSELVSSEL 451
           D V Q  +Q TSN  Q  E+ L+L Q +  N+   T  N+ +  Q  +      L     
Sbjct: 391 DSVLQKCLQVTSNEAQYQEACLFLFQELCSNE---TSMNVPRY-QDFLSLAVMILDDDAC 446

Query: 452 NEVTLARLILIIPKVLDKFIDVLPDIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYY 511
                +R IL IPK  +  ++ LP+IK L   FL  +++  +    + + ++++I+FTYY
Sbjct: 447 PTFVKSRTILTIPKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYY 506

Query: 512 CYFAELDSVLGPEACTEVXXXXXXXXXXXSDDAEEDTNGTIMEVLNEVISCNTKGPHHSE 571
             FAEL S+L  +    +             D+EED+ G ++E ++E++    K  H  +
Sbjct: 507 TSFAELGSILDYQTSMILQQSLLKAIKTLYVDSEEDSLGLLLEAMHEIV----KTWHFQQ 562

Query: 572 EV--LQAEFHLVFSISSKDPANVQVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVL 629
           ++   Q   +L+  +SS +P+NV++V +S   L  LL +I   +Y    E C PSFI  +
Sbjct: 563 DLHTKQEILNLLLKLSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAM 622

Query: 630 EANRPNNYKYTPLLSLVLEFITVFLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQ 689
                +   Y+PL+ L LEF++VFLK  P    +  E+ +++  P+ + +    ++   +
Sbjct: 623 STFLQSQQTYSPLVVLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAE 682

Query: 690 LATEAFSYLIFNTDTQVMEPRLMDIMKVL---ERLLSLEVSDSAAMNVGSLVVTIF--TR 744
            A +AF YL  N++ +  +  + D+  ++   ER L   + D A + + SL VT     R
Sbjct: 683 TALQAFVYLACNSNPKFWKDSMFDLCSLVFDPERSLYKTI-DVAPIMLLSLRVTQPHENR 741

Query: 745 FSGEIQPLVERILQAVVIRLVKAQNISTQQNLFSVLCFLTCNDPKQTVDFLCSFQIDNMD 804
           F G+       I++  + +LV    +    +   + C +   D +  + ++ S  I   +
Sbjct: 742 FIGQ-------IMEYTISKLVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEE 794

Query: 805 AL-SLVMPKWMESFEVVRGERRIKENIIALIKLFLLDDARLHKLMVNGDLIPYDGDLIIT 863
           ++ + ++ +  + FE  R +  +KE  ++L +LF  +D RL                  T
Sbjct: 795 SIPNKLIRELFDCFEENRSKNMLKEVALSLSELFFSNDQRL------------------T 836

Query: 864 RSMAKKMPDKYVQVPLYTKIIKLFVSELGFQ 894
           RS      D  V+ P    I+K+F  EL  Q
Sbjct: 837 RSSYHDESDGVVR-PFKEYIVKMFADELTRQ 866

 Score =  152 bits (384), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 109/204 (53%)

Query: 1   MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60
           M I +L+ G QS     RE AE  LL+ C +D    F  L   A ++  S  +RQ ALL 
Sbjct: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60

Query: 61  LRKLITMYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISA 120
           LRK  TMYWS GF S+     V    K+ +R              K+ +  +YCIVQI A
Sbjct: 61  LRKFTTMYWSAGFPSFVGPPGVGEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120

Query: 121 VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180
           VDFPD+WP LL  + + I  +HS NA+SLL E+  D+++ EMFF+   G + V  +   L
Sbjct: 121 VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180

Query: 181 TTEASNLVAKIAALKLFKACLSQM 204
             +   L AK   L+L+  C+SQ+
Sbjct: 181 NDDTLRLQAKSKLLQLYHHCISQL 204

>NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 55/134 (41%), Gaps = 9/134 (6%)

Query: 9   GAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITMY 68
             Q A +  +++AE QL QW        +  L S+ L    +LQSR  A +  +  +  Y
Sbjct: 21  NPQQAGSQVQKSAEQQLKQWEIQPGYHYY--LQSIYLDLSNTLQSRWLAAIQFKNGVDRY 78

Query: 69  WSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPDQWP 128
           W            ++ + K SIR               I+   +  I +I+ +DFP +WP
Sbjct: 79  WRSS-----RVHAINKDEKASIRARLFELIDEQNNQLGIQYAQA--IAKIARLDFPAEWP 131

Query: 129 QLLTVIYDAISQHH 142
            L   +   +S H+
Sbjct: 132 DLFEHLESLLSDHN 145

>TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1031

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 57/137 (41%), Gaps = 13/137 (9%)

Query: 8   TGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITM 67
           +  Q A +  ++AAE QL +W           L S+ L+   SLQ R  A++  +  +  
Sbjct: 20  SNPQHAGSEVQKAAEQQLREWQQQPGFHFL--LQSIYLNLSNSLQIRWLAVIQFKNGVEK 77

Query: 68  YWSPGFESYRSTSNVDLNVKE--SIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPD 125
           YW       RST    +N  E  SIR               I+N  +    +I+ +DFP 
Sbjct: 78  YW-------RSTRINAINKDEKISIRGRLFDLIDEQNNQLSIQNAQA--AAKIARLDFPV 128

Query: 126 QWPQLLTVIYDAISQHH 142
           +WP L   +   +S  H
Sbjct: 129 EWPNLFEQLEQLLSNDH 145

>Kwal_47.19247 s47 complement(1151230..1154109) [2880 bp, 959 aa]
           {ON} YGL238W (CSE1) - (putative) kinetochore protein
           [contig 344] FULL
          Length = 959

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 115/257 (44%), Gaps = 30/257 (11%)

Query: 549 NGTIMEVLNEVI--SCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVVQSQECLEKL- 605
           N  IM+ +  V+  S +   P  +E + Q     + SI SK+P+N +    S  C E L 
Sbjct: 569 NEFIMKTVYRVLMTSEDLSAPFATETIQQ--LLSIISIISKNPSNPRF---SHYCFESLG 623

Query: 606 -LDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKPSSEFLP 664
            +      +   +++L +P F+ +L  +      YT      L+ I   +++ P++  LP
Sbjct: 624 VVLKYNKQDLSKFLDLIMPQFMEILSEDLQEFIPYT------LQLIAYCIEQLPAASSLP 677

Query: 665 SEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYL---IFNTDTQVMEPRLMDIMKVLERL 721
             + Q L +P+      S+    L+    A + L   I   D     P L+ ++ V +RL
Sbjct: 678 PSVSQ-LCQPIV-----SSSVWELKGNIPAVTRLLKDIIRVDPSAY-PDLVPVLGVFQRL 730

Query: 722 LSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFSVLC 781
           ++ +  D     +   ++T       ++QP +++I    V+ L + QN  T++ +   + 
Sbjct: 731 IASKTYDDNGFELLEFIMTYMP--VDKVQPYMKQI---AVLLLQRLQNSRTEKYVKKFVV 785

Query: 782 FLTCNDPKQTVDFLCSF 798
           FL+    K+  DF+ SF
Sbjct: 786 FLSAVAHKRGSDFVVSF 802

>NCAS0C01430 Chr3 complement(262823..265912) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 55/136 (40%), Gaps = 13/136 (9%)

Query: 9   GAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITMY 68
             Q A +  ++ AE+QL QW           L ++ L    SLQ+R  A++  +  +  Y
Sbjct: 21  NPQQAGSQVQKLAESQLKQWEVQSGYHFL--LQTIYLDLSNSLQTRWLAVIQFKNGVDKY 78

Query: 69  WSPGFESYRSTS--NVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPDQ 126
           W       RST    ++ + K SIR               I+   +    +I+ +DFP +
Sbjct: 79  W-------RSTRVHCINKDEKASIRTRLFDMIDEQNNQLGIQYAQA--TARIARLDFPVE 129

Query: 127 WPQLLTVIYDAISQHH 142
           WP L   +   +   H
Sbjct: 130 WPNLFETLKSLLENDH 145

>TPHA0F03160 Chr6 complement(690476..693571) [3096 bp, 1031 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1031

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 9/114 (7%)

Query: 18  REAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITMYWSPGFESYR 77
           ++ AEA+L +W   +    +  L S+ L+   SLQ R  +++  +  I  YW     S R
Sbjct: 27  QKLAEAKLKEWEVQEGFHYY--LQSIYLNMDNSLQIRWISIIQFKNGIEKYW----RSTR 80

Query: 78  STSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPDQWPQLL 131
           S + ++ N K  IR               I+N  +    +I+  DFP  WP L 
Sbjct: 81  SNA-INKNEKLKIRERLFNLVNEKNNQLSIQNAQA--TAKIARFDFPGHWPDLF 131

>SAKL0H07876g Chr8 (674192..677290) [3099 bp, 1032 aa] {ON} highly
           similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1032

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 52/126 (41%), Gaps = 13/126 (10%)

Query: 8   TGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITM 67
           +  Q A +  +  AE QL  W     S     L S+ L    SLQ R  A++  +  I  
Sbjct: 21  SNPQHAGSQVQRLAEQQLKTW--ETQSGYHYLLQSIYLDLSCSLQIRWLAIIQFKNGIER 78

Query: 68  YWSPGFESYRST--SNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPD 125
           YW       RST  + +  + K SIR               I+N  +    +I+ +DFP+
Sbjct: 79  YW-------RSTRVNAISKDEKASIRSRLFDMIDEQNNQLCIQNAQASA--RIARLDFPN 129

Query: 126 QWPQLL 131
           +WP L 
Sbjct: 130 EWPNLF 135

>Smik_6.324 Chr6 complement(507726..510824) [3099 bp, 1032 aa] {ON}
           YPL125W (REAL)
          Length = 1032

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 9/124 (7%)

Query: 8   TGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITM 67
           +  Q   +  ++ AE QL QW ++ A   F  L S+ L+   SLQ R  A++  +  +  
Sbjct: 18  SNPQHIRSEVQKLAEQQLKQW-ETQAGFHFL-LQSIYLNLSNSLQIRWLAVIQFKNGVDK 75

Query: 68  YWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPDQW 127
           YW          + +  + K SIR               I+N  +    +I+ +DFP +W
Sbjct: 76  YWRSS-----RVNAIPKDEKASIRGRLFEMIDEQNNQLCIQNAQA--AARIARLDFPVEW 128

Query: 128 PQLL 131
           P L 
Sbjct: 129 PNLF 132

>TBLA0G01350 Chr7 complement(361561..364158) [2598 bp, 865 aa] {ON}
           Anc_4.180 YLR347C
          Length = 865

 Score = 38.5 bits (88), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 3/83 (3%)

Query: 75  SYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFP-DQWPQLLTV 133
           S R  +NVD+N K  I+              ++ N  +  I  I+ ++ P ++WP+LL +
Sbjct: 83  SLRWINNVDMNSKLQIKQNALMALVSNVTSARVSNAVAQLIAAIANIELPRNEWPELLKI 142

Query: 134 IYDAIS--QHHSINAMSLLNEIY 154
           + D  S  Q  ++   SLL   Y
Sbjct: 143 MVDNTSSTQQENVKRASLLTLGY 165

>Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL125W
           (REAL)
          Length = 1032

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 13/126 (10%)

Query: 8   TGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITM 67
           +  Q   +  ++ AE QL QW ++ A   +  L S+ L+   SLQ R  A++  +  +  
Sbjct: 18  SNPQHIRSEIQKLAEQQLKQW-ETQAGFHYL-LQSIYLNLSNSLQIRWLAVIQFKNGVDK 75

Query: 68  YWSPGFESYRST--SNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPD 125
           YW       RST  + +  + K SIR               I+N  +    +I+ +DFP 
Sbjct: 76  YW-------RSTRINAISKDEKASIRGRLFEMIDEQNNQLCIQNAQA--AARIARLDFPV 126

Query: 126 QWPQLL 131
           +WP L 
Sbjct: 127 EWPNLF 132

>YPL125W Chr16 (313388..316486) [3099 bp, 1032 aa] {ON}
           KAP120Karyopherin responsible for the nuclear import of
           ribosome maturation factor Rfp1p
          Length = 1032

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 67/152 (44%), Gaps = 17/152 (11%)

Query: 8   TGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITM 67
           +  Q   +  ++ AE QL QW ++ A   +  L S+ L+   SLQ R  A++  +  +  
Sbjct: 18  SNPQHIRSDVQKLAEQQLRQW-ETQAGFHYL-LQSIYLNLSNSLQIRWLAVIQFKNGVDK 75

Query: 68  YWSPGFESYRST--SNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPD 125
           YW       RST  + +  + K SIR               I+N  +    +I+ +DFP 
Sbjct: 76  YW-------RSTRINAIPKDEKASIRGRLFEMIDEQNNQLCIQNAQASA--RIARLDFPV 126

Query: 126 QWPQLL----TVIYDAISQHHSINAMSLLNEI 153
           +WP L      ++ D I +  S+   ++L  I
Sbjct: 127 EWPTLFEDLENLLNDEIIRKDSVKIYNILMHI 158

>Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON}
           similar to Ashbya gossypii ACR159C
          Length = 1027

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 47/122 (38%), Gaps = 9/122 (7%)

Query: 21  AEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITMYWSPGFESYRSTS 80
           AE QL  W          SL SV L+   SLQ R  A++  +     +W P        +
Sbjct: 31  AEEQLKLW--QGLPGYHYSLQSVYLNLSWSLQVRWLAIIQFKNSTDKFWRPT-----RMN 83

Query: 81  NVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPDQWPQLLTVIYDAISQ 140
            +  + K SIR               I+N   +   +I+ +D+P  WP +      A++ 
Sbjct: 84  CISKDEKSSIRDRLFHMVNEENNQLAIQNA--HATAKIARLDYPQNWPNMFEYFEIALAD 141

Query: 141 HH 142
           H 
Sbjct: 142 HQ 143

>Suva_16.185 Chr16 (322908..326006) [3099 bp, 1032 aa] {ON} YPL125W
           (REAL)
          Length = 1032

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 51/126 (40%), Gaps = 13/126 (10%)

Query: 8   TGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITM 67
           +  Q   +  ++ AE QL QW           L S+ L+   SLQ R  A++  +  +  
Sbjct: 18  SNPQHLRSEVQKLAEQQLKQWETQPGFHYL--LQSIYLNLSNSLQIRWLAVIQFKNGVDK 75

Query: 68  YWSPGFESYRST--SNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPD 125
           YW       RST  + +  + K SIR               I+N  +    +I+ +DFP 
Sbjct: 76  YW-------RSTRINAIPKDEKASIRGRLFEMIDEQNNQLCIQNAQA--AARIARLDFPV 126

Query: 126 QWPQLL 131
            WP L 
Sbjct: 127 DWPNLF 132

>ACR159C Chr3 complement(631643..634720) [3078 bp, 1025 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL125W
           (KAP120)
          Length = 1025

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 62/152 (40%), Gaps = 20/152 (13%)

Query: 11  QSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITMYWS 70
           + A    ++ AE QL  W        F  L S+ L    SLQ R  A++  +  +  YW 
Sbjct: 21  RGAQPEIQKQAEQQLKIWEVQAGYHFF--LQSIYLDLSCSLQIRWLAIIQFKNGLDKYW- 77

Query: 71  PGFESYRST--SNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPDQWP 128
                 R+T  + +  + K+SIR               I+N  ++   +I+  D+P  WP
Sbjct: 78  ------RATRVNAISKDEKQSIRARLFEMVDEQNNQLCIQN--AHACARIARSDYPHDWP 129

Query: 129 QLLTVI------YDAISQH-HSINAMSLLNEI 153
            L          YDA+  +  + N +  LN++
Sbjct: 130 DLFEYFEKALGDYDALQNNVRTYNVLVCLNQV 161

>Ecym_2590 Chr2 complement(1149034..1151901) [2868 bp, 955 aa] {ON}
           similar to Ashbya gossypii AFR273W
          Length = 955

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 94/221 (42%), Gaps = 22/221 (9%)

Query: 581 VFSISSKDPANVQVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYT 640
           + +I +K+P+N +    + E L  ++      N  S IE  +P F+N+L  +        
Sbjct: 601 IITIIAKNPSNPRFTHYTFESLSVVI-KFNHDNLASIIEAIMPIFLNILADD------IQ 653

Query: 641 PLLSLVLEFITVFLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYL-- 698
             +  V + I   +++ PS+  +P  I Q L++PL     +      L+    A + L  
Sbjct: 654 EFMPYVFQIIAYCVEQLPSNMGIPEAIAQ-LYQPLLSPTVWD-----LKGCVPAVTRLLK 707

Query: 699 -IFNTDTQVMEPRLMDIMKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERIL 757
            I   D     P L+ ++ + +RL++ +  D+    +   ++T        +  L + + 
Sbjct: 708 DIIKHDPSAY-PNLIPVLGIFQRLIASKAYDTHGFELLEYIITYIP-----LSKLQDYLK 761

Query: 758 QAVVIRLVKAQNISTQQNLFSVLCFLTCNDPKQTVDFLCSF 798
           Q  V+ L + Q   T++ +   + FL     K   DF+  F
Sbjct: 762 QIAVLLLQRLQGSRTEKYVKKFIVFLGVLSNKFDSDFVVRF 802

>CAGL0J06776g Chr10 (651309..654392) [3084 bp, 1027 aa] {ON} highly
           similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125w KAP120 nuclear transport factor
          Length = 1027

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 56/143 (39%), Gaps = 20/143 (13%)

Query: 2   DISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSL 61
           D+ H+ T  Q         AE+QL  W           L S+ L     L  R  A++  
Sbjct: 20  DMQHMGTERQ-------RMAESQLKAWETQPGFHFL--LQSIYLDLSNGLHVRWLAVIQF 70

Query: 62  RKLITMYWSPGFESYRST--SNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQIS 119
           +  +  YW       R+T  +++  + K SIR               I+N  +    +IS
Sbjct: 71  KNGVEKYW-------RATRINSIGKDEKASIRKRLFDVVDEQNNQLCIQNAQA--TARIS 121

Query: 120 AVDFPDQWPQLLTVIYDAISQHH 142
            +DFP +WP L   I   ++ +H
Sbjct: 122 RIDFPVEWPNLFESIEQLLNINH 144

>KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8.624
           YPL125W
          Length = 1041

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 52/136 (38%), Gaps = 13/136 (9%)

Query: 9   GAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITMY 68
             Q A +  ++ AE QL  W           L SV L     LQ R  A++  +  I  Y
Sbjct: 22  NPQHAGSEIQKLAEQQLKAWEIKPGFHHL--LQSVYLDLSNPLQVRWLAVIQFKNGIDKY 79

Query: 69  WSPGFESYRSTSNVDLNVKES--IRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPDQ 126
           W       RST    ++ +E   IR               I+N  +    +IS +DFP +
Sbjct: 80  W-------RSTRVHAISKEEKSLIRSRLFELIDEQNNQLTIQNAQAAS--KISRLDFPGE 130

Query: 127 WPQLLTVIYDAISQHH 142
           WP L   +   +  +H
Sbjct: 131 WPNLFEQLEHLLKDNH 146

>KNAG0J01420 Chr10 complement(260385..263546) [3162 bp, 1053 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1053

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 50/123 (40%), Gaps = 13/123 (10%)

Query: 8   TGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITM 67
           +  Q A +  +  AE QL +W     S     L ++ L     LQ R  A++  +  I  
Sbjct: 21  SNPQHAGSEVQRLAETQLKEW--EIQSGFHYILQTIYLDLSNPLQVRWLAVIQFKNGIER 78

Query: 68  YWSPGFESYRST--SNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPD 125
           YW       RST  + +  + K SIR               I+N  +    +I+ +DFP 
Sbjct: 79  YW-------RSTRVNAIRKDEKASIRARLFDLIDEQNNQLCIQNAQATS--KIARLDFPA 129

Query: 126 QWP 128
           +WP
Sbjct: 130 EWP 132

>Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {ON}
           YPL125W (KAP120) - karyopherin [contig 67] FULL
          Length = 1034

 Score = 36.2 bits (82), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 64/155 (41%), Gaps = 20/155 (12%)

Query: 8   TGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITM 67
           +  + A +  ++ AE QL QW   +       L S+ L     L  R  A++  +  +  
Sbjct: 20  SDPRHAGSQIQKQAEQQLKQWETQEGFHYL--LQSIYLDLSCPLNVRWLAIIQFKNGVEK 77

Query: 68  YWSPGFESYRST--SNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPD 125
           +W       RST  + +    K SIR               I+N  S    +I+ +DFP 
Sbjct: 78  FW-------RSTRVNAIRKEEKVSIRTRLFDLIDEKNNQLCIQN--SQATARIARLDFPG 128

Query: 126 QWPQLLTVI-----YDAISQHH--SINAMSLLNEI 153
           +WP L   +     YD I Q +  + N + ++N+I
Sbjct: 129 EWPGLFDQLEKLLSYDKIWQDNIKTYNLLLIMNQI 163

>Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON}
           (33954..37046) [3093 nt, 1031 aa]
          Length = 1030

 Score = 35.4 bits (80), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 50/125 (40%), Gaps = 9/125 (7%)

Query: 7   ITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLIT 66
           ++  ++  +  ++ AE QL +W           L ++ L    SLQ R  A++  +  I 
Sbjct: 16  VSDPKNIGSDVQKLAEQQLKEWEIQPGYHYL--LQTIYLDLSNSLQIRWMAVIQFKNGIE 73

Query: 67  MYWSPGFESYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPDQ 126
            +W         T+ +  + K SIR               I+N  S    +I+ +DFP  
Sbjct: 74  KFWRSS-----RTNAIKKDEKASIRARLFELIDEQNNQLAIQN--SQAAAKIARLDFPVD 126

Query: 127 WPQLL 131
           WP L 
Sbjct: 127 WPNLF 131

>KLLA0D06633g Chr4 complement(568539..571610) [3072 bp, 1023 aa]
           {ON} similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1023

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 50/126 (39%), Gaps = 13/126 (10%)

Query: 8   TGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITM 67
           +  Q A +  +  AE Q+  W           L S+ +    SLQ R  A++  +  +  
Sbjct: 18  SNPQYAGSEVQRQAEQQIKSWEILPGFHYL--LQSIYMDLSVSLQVRWLAIIQFKNGLDK 75

Query: 68  YWSPGFESYRST--SNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPD 125
           YW       RST  + +  + K+ IR               I+N  +    +++ +DFP 
Sbjct: 76  YW-------RSTRINAITKDEKQQIRNRLFGMIDEPNDKLAIQNAQA--TARVARIDFPV 126

Query: 126 QWPQLL 131
           +WP L 
Sbjct: 127 EWPHLF 132

>YJL025W Chr10 (393967..395511) [1545 bp, 514 aa] {ON}
           RRN7Component of the core factor (CF) rDNA transcription
           factor complex; CF is required for transcription of 35S
           rRNA genes by RNA polymerase I and is composed of Rrn6p,
           Rrn7p, and Rrn11p
          Length = 514

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (48%), Gaps = 8/105 (7%)

Query: 269 FPKEFQVQFKLVAIKDLKNIASMNVNDGPTENEDSLETVQTCSVYIVEFLTTVCSIP-FT 327
           FPKEF+   K++ +K LK I     ND P E E  L+   T ++ I+   +T  S+P +T
Sbjct: 125 FPKEFEHVAKIIWLKILKTI-----NDQPQE-ELKLQLHMTSTISILYLASTHLSLPVYT 178

Query: 328 IEEMKMIIQSLTALCRVDSDTTQLW-IGDFNYFVSKETGLAASYN 371
            + +K I  +     +      + W I   NY+VS   G  + +N
Sbjct: 179 CDYIKWICTAKMPYFQASEILPKSWRIQLPNYYVSILEGSISPFN 223

>KLTH0G00858g Chr7 (59340..62219) [2880 bp, 959 aa] {ON} similar to
           uniprot|P33307 Saccharomyces cerevisiae YGL238W CSE1
           Nuclear envelope protein that mediates the nuclear
           export of importin alpha (Srp1p) homolog of metazoan CAS
           protein required for accurate chromosome segregation
          Length = 959

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 104/234 (44%), Gaps = 27/234 (11%)

Query: 570 SEEVLQAEFHLVFSISSKDPANVQVVVQSQECLEKL--LDNITMGNYMSYIELCLPSFIN 627
           + E+ +   H++ SI SK+P+N +    S  C E L  +      +   ++E+ +P F+ 
Sbjct: 591 AHEIAKQLLHII-SIISKNPSNPRF---SHYCFESLGVVVKFNKQSMSEFMEMMMPQFLE 646

Query: 628 VLEANRPNNYKYTPLLSLVLEFITVFLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDET 687
           +L  +     ++TP     ++ I   +++ P++  LP  + Q L +P+     +      
Sbjct: 647 ILSEDV---QEFTPY---SIQIIAYCIEQLPAASSLPPSVSQ-LCQPILSPAVWE----- 694

Query: 688 LQLATEAFSYL---IFNTDTQVMEPRLMDIMKVLERLLSLEVSDSAAMNVGSLVVTIFTR 744
           L+    A + L   I   D     P L+ ++ V +RL++ +  D     +   +VT    
Sbjct: 695 LKGNIPALTRLLKDILRVDPTAY-PDLVPVLGVFQRLIASKTYDENGFELLEYIVTYLP- 752

Query: 745 FSGEIQPLVERILQAVVIRLVKAQNISTQQNLFSVLCFLTCNDPKQTVDFLCSF 798
               +  +V  + Q  V+ L + QN  T++ +   + FL+    K+  DF+  F
Sbjct: 753 ----LDSIVPYVKQIAVLLLQRLQNSRTEKYVKKFVVFLSIVAYKRGSDFVVDF 802

>YDR251W Chr4 (960614..963106) [2493 bp, 830 aa] {ON}  PAM1Essential
           protein of unknown function; exhibits variable
           expression during colony morphogenesis; overexpression
           permits survival without protein phosphatase 2A,
           inhibits growth, and induces a filamentous phenotype
          Length = 830

 Score = 32.3 bits (72), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 27/39 (69%), Gaps = 3/39 (7%)

Query: 367 AASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSN 405
           +A+YN+ +Q S F  S+S PNLS   ++ +++ VQN+ N
Sbjct: 694 SANYNISNQQSGFVNSISSPNLS---NLENRNTVQNSRN 729

>TBLA0J00470 Chr10 (85713..88823) [3111 bp, 1036 aa] {ON} Anc_8.624
           YPL125W
          Length = 1036

 Score = 32.3 bits (72), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 48/124 (38%), Gaps = 13/124 (10%)

Query: 13  ADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLRKLITMYWSPG 72
           A+ + +  AE QL  W    A      L S+ L     LQ R  A++  +  +  YW   
Sbjct: 26  ANPNAQRLAEQQLKLW--ETALGFHYLLQSIYLDLSNPLQVRWLAVIQFKNGVERYW--- 80

Query: 73  FESYRST--SNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFPDQWPQL 130
               RST  + +  + K SIR               I+N  +    +I+ +DFP  W  L
Sbjct: 81  ----RSTRINAISKDEKASIRNRLFEVLDEQNNQLCIQNAQA--TARIARLDFPSDWTNL 134

Query: 131 LTVI 134
              I
Sbjct: 135 FETI 138

>ACL187W Chr3 (30322..32907) [2586 bp, 861 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR347C (KAP95)
          Length = 861

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 61/137 (44%), Gaps = 5/137 (3%)

Query: 12  SADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSLR-KLITMYWS 70
           S D   R  +E QL +  + +  Q   +L+ +       L++R  A L+L+ +L++    
Sbjct: 16  SPDAGVRLQSETQLRKLSNDNFLQYAGTLSQLLADESVILEARILAALTLKNELVSKDPV 75

Query: 71  PGFE-SYRSTSNVDLNVKESIRXXXXXXXXXXXXXTKIKNGASYCIVQISAVDFP-DQWP 128
            G + + R    VD   +  I+              ++ N ++  I  I+ ++ P D+WP
Sbjct: 76  KGQQFAQRWLGLVDAESRHHIKQFALAALVDKQ--PRVANASAQLIAAIADIELPRDEWP 133

Query: 129 QLLTVIYDAISQHHSIN 145
            L+ ++ +  +QH   N
Sbjct: 134 DLMKILVENTTQHQPEN 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,301,450
Number of extensions: 3625927
Number of successful extensions: 12219
Number of sequences better than 10.0: 81
Number of HSP's gapped: 12466
Number of HSP's successfully gapped: 89
Length of query: 1008
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 888
Effective length of database: 39,721,479
Effective search space: 35272673352
Effective search space used: 35272673352
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)