Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.183.566ON38538519380.0
Skud_7.243.566ON39138415160.0
YGL243W (TAD1)3.566ON40038514230.0
Smik_7.183.566ON38538514050.0
KAFR0J028703.566ON3843868871e-117
ZYRO0E09504g3.566ON3773838771e-115
TDEL0D063403.566ON4023888731e-114
SAKL0F00836g3.566ON3833908671e-114
NCAS0E002703.566ON3883868581e-112
Kpol_380.73.566ON3853858411e-110
NDAI0I032303.566ON3863898271e-107
TPHA0G036403.566ON3963898241e-107
KLTH0G00748g3.566ON3853918031e-104
Kwal_47.192633.566ON3833897981e-103
Ecym_25963.566ON3873867811e-101
KNAG0I002403.566ON3913867781e-100
CAGL0H07733g3.566ON3853947679e-99
TBLA0E002303.566ON3943957653e-98
KLLA0A00759g3.566ON3803827512e-96
AFR267W3.566ON3853966982e-88
Smik_1.108singletonON61571022e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.18
         (385 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)   751   0.0  
Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)   588   0.0  
YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}  TAD1tRNA-spe...   552   0.0  
Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)   545   0.0  
KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {...   346   e-117
ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {...   342   e-115
TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa] ...   340   e-114
SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar ...   338   e-114
NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566...   335   e-112
Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON} ...   328   e-110
NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {O...   323   e-107
TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {O...   322   e-107
KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar ...   313   e-104
Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]...   311   e-103
Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {O...   305   e-101
KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566...   304   e-100
CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} simila...   300   9e-99
TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566...   299   3e-98
KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar ...   293   2e-96
AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic ho...   273   2e-88
Smik_1.108 Chr1 complement(176076..176135,176139..176261) [183 b...    44   2e-05

>Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/385 (94%), Positives = 364/385 (94%)

Query: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60
           MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS
Sbjct: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60

Query: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEI 120
           IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEI
Sbjct: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEI 120

Query: 121 PPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTILR 180
           PPKFRLKDKWELALYISKLPCGDASMDFLNDNCRS           TFQYVDPDVKTILR
Sbjct: 121 PPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSDDDFLEIDDDDTFQYVDPDVKTILR 180

Query: 181 GRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVI 240
           GRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQ          ALFAQPVFLRYIVI
Sbjct: 181 GRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQSSSILNSLNSALFAQPVFLRYIVI 240

Query: 241 PNLDEKTRHTLEQSFHNRLPFCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMNDST 300
           PNLDEKTRHTLEQSFHNRLPFCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMNDST
Sbjct: 241 PNLDEKTRHTLEQSFHNRLPFCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMNDST 300

Query: 301 VEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQTER 360
           VEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQTER
Sbjct: 301 VEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQTER 360

Query: 361 NQLITLIKGALSPDGWIPTKTDDVK 385
           NQLITLIKGALSPDGWIPTKTDDVK
Sbjct: 361 NQLITLIKGALSPDGWIPTKTDDVK 385

>Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)
          Length = 391

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/384 (71%), Positives = 316/384 (82%)

Query: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60
           M +K+ELAE+IS KVIGEYSKLK+VC+P TRP+GI+EWTILAGV  INR+  A+N++VLS
Sbjct: 7   MSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLS 66

Query: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEI 120
           +ATGVK+LPDSELQRS GKLLHDCHAEILALRGANTV L HIKD+D  NG D IESNNEI
Sbjct: 67  VATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESNNEI 126

Query: 121 PPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTILR 180
           P +F LKD WELALYIS+LPCGDASMDFLND+C++            FQYVDP VKTILR
Sbjct: 127 PIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILR 186

Query: 181 GRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVI 240
           GRLNF KKSVVRTKPGRYDSNITLSKSCSDKL M+Q           LF QPV+L+YIVI
Sbjct: 187 GRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVI 246

Query: 241 PNLDEKTRHTLEQSFHNRLPFCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMNDST 300
           P++++KT+H LE+SFHNRLP   H+ EFLNCHTPFYDD+ DEN +PS MCS KLF+NDS+
Sbjct: 247 PDIEDKTKHILERSFHNRLPCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVNDSS 306

Query: 301 VEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQTER 360
            EEAI NGMKNGFYTK  KPLRKHC+S +SRFAQWELF QI+P++K  SYL FK+QQ ER
Sbjct: 307 TEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQQKER 366

Query: 361 NQLITLIKGALSPDGWIPTKTDDV 384
           N+LIT  K ALSPDGWI T+ DDV
Sbjct: 367 NRLITTAKNALSPDGWISTRIDDV 390

>YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}
           TAD1tRNA-specific adenosine deaminase, deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 400

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/385 (67%), Positives = 313/385 (81%), Gaps = 1/385 (0%)

Query: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60
           MP++D+L E+IST+VI EYSKLK+ CRP+ RPSGIREWTILAGVAAINR+  A+ I++LS
Sbjct: 17  MPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILS 76

Query: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEI 120
           IATGVK+LPDSELQRS GK+LHDCHAEILALRGANTV LN I++++ ++GD  I+ N+EI
Sbjct: 77  IATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEI 136

Query: 121 PPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTILR 180
           P +F LK+ WELALYIS+LPCGDASM FLNDNC++            FQYVD  VKTILR
Sbjct: 137 PARFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSD-EFQYVDRSVKTILR 195

Query: 181 GRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVI 240
           GRLNF +++VVRTKPGRYDSNITLSKSCSDKLLM+Q           LF +PVFL+YIVI
Sbjct: 196 GRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255

Query: 241 PNLDEKTRHTLEQSFHNRLPFCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMNDST 300
           PNL+++T+H LEQSFH RLP   +  +FLNC  PFYDDK DE  VP LMCS KLFM+D +
Sbjct: 256 PNLEDETKHHLEQSFHTRLPNLDNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMDDFS 315

Query: 301 VEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQTER 360
            EEAILNG++NGFYTK  KPLRKHC+S +SRFAQWELF +I+PEY+  SYL+FK++Q +R
Sbjct: 316 TEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSRQKKR 375

Query: 361 NQLITLIKGALSPDGWIPTKTDDVK 385
           +QLI  IK  LSPDGWIPT+TDDVK
Sbjct: 376 SQLIIAIKNILSPDGWIPTRTDDVK 400

>Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/385 (66%), Positives = 306/385 (79%)

Query: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60
           M ++DEL ++IST+VI EYSKLK +CRPVTRP+G++EWT+LAG+ AINR    +NI VLS
Sbjct: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60

Query: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEI 120
           +ATGVK++PDSEL+RS GK+LHDCHAEILALRG NTV LNHIK+++  NG D I+SN+E 
Sbjct: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET 120

Query: 121 PPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTILR 180
           PP+F+LKD WELALYISKLPCGDAS+DFLNDNC++            FQYV+  VKTILR
Sbjct: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180

Query: 181 GRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVI 240
           G LNF +K+VVRTKPGRYDSNITLSKSCSDKLLM++           LF QPVFL+Y+VI
Sbjct: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240

Query: 241 PNLDEKTRHTLEQSFHNRLPFCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMNDST 300
           P L+ + +H L+QSFH+RLP  +H   F++C+T FYDDK  E  VPSLMCS KLFMND T
Sbjct: 241 PGLENEVKHVLKQSFHDRLPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMNDHT 300

Query: 301 VEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQTER 360
            EEAILNG+KNGFYTK  KPLRKHC+S +SRFAQWELF QI+PEY+  SYLQFK+ Q  R
Sbjct: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKRR 360

Query: 361 NQLITLIKGALSPDGWIPTKTDDVK 385
            +LI  IK  LSPDGWIPTK DDV+
Sbjct: 361 TRLIIAIKDILSPDGWIPTKIDDVQ 385

>KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {ON}
           Anc_3.566 YGL243W
          Length = 384

 Score =  346 bits (887), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 182/386 (47%), Positives = 246/386 (63%), Gaps = 13/386 (3%)

Query: 5   DELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATG 64
           D L ++I+  V  EY +LKA  +PVTR +G +EWT+LA V AIN NA   ++K+++I+TG
Sbjct: 3   DSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTG 62

Query: 65  VKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEIPPKF 124
           VK++P++ L RS G++LHDCHAEILALRG N V L +++D         ++ + +   KF
Sbjct: 63  VKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQ-GGKF 121

Query: 125 RLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTILRGRLN 184
           R K KW+LALY+S+LPCGDASMD L D   +             QY+DP    ILRGR+N
Sbjct: 122 RWKSKWKLALYVSRLPCGDASMDHLED---ASELDIEMSEDDRLQYIDPGKSKILRGRMN 178

Query: 185 FGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVIPNLD 244
           F +K  VRTKPGR DS+ITLSKSCSDKL ++Q           L   PV+L+Y+VIP L+
Sbjct: 179 FKRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELN 238

Query: 245 EKTRHTLEQSFHNRLPFCS-----HRFEFLNCHTPFYDDKKDENSVPSLMCSTKLF-MND 298
           +  +  L + FH RL  CS      RF+FL     F DDK  ++ +PS     K+F   +
Sbjct: 239 DTDKKALIRCFHTRL--CSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQE 296

Query: 299 STVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDT-SYLQFKAQQ 357
            T+E+AILNG+KNGFYTK  KPLR+ CES LSR++QW L+  +K + ++  SYLQFKA+Q
Sbjct: 297 HTIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQ 356

Query: 358 TERNQLITLIKGALSPDGWIPTKTDD 383
            +R  L+   K  LS   WI T  DD
Sbjct: 357 EQRRDLVENAKICLSHGSWIATLKDD 382

>ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {ON}
           similar to uniprot|P53065 Saccharomyces cerevisiae
           YGL243W TAD1 tRNA-specific adenosine deaminase
           deaminates adenosine-37 to inosine in tRNA-Ala
          Length = 377

 Score =  342 bits (877), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 183/383 (47%), Positives = 245/383 (63%), Gaps = 15/383 (3%)

Query: 7   LAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATGVK 66
           L  +I+ KV+  Y KL + C+P TR +G++EWT+LAG+ AI++  S  +++++SIATGVK
Sbjct: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNS--DLRLISIATGVK 63

Query: 67  SLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIK--DWDLTNGDDLIESNNEIPPKF 124
           +LPD+ L RS GK++HDCHAEILALR  N V L+ I   + +  N  DL+E  +E    F
Sbjct: 64  ALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASE-DQLF 122

Query: 125 RLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTILRGRLN 184
             KD WELA+YIS LPCGDASMD L   C+              Q+VDP V +I+RGR N
Sbjct: 123 HFKDNWELAIYISTLPCGDASMDLL---CQDESIIEMQDDD-PIQFVDPAVTSIVRGRFN 178

Query: 185 FGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVIPNLD 244
           + ++ VVRTKPGR+DS ITL KSCSDKL  RQ           L  +PV+L+Y+V PN  
Sbjct: 179 YSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPN-- 236

Query: 245 EKTRHTLEQSFHNRLPFCSHR-FEFLNCHTPFYDDKKDENSVPSLMCSTKLFMN-DSTVE 302
             T   L QSF++R+    +   + L C   F  DK      PS M S KL+   +STVE
Sbjct: 237 --TTDLLHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTVE 294

Query: 303 EAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQTERNQ 362
           +A+LNG+KNGFYTK  KPLR++CE  +SR+AQW+LF  ++PE+ + +YLQFKA   +RN 
Sbjct: 295 QALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNA 354

Query: 363 LITLIKGALSPDGWIPTKTDDVK 385
           LI   +  LSP GWI T  DD +
Sbjct: 355 LIQDCRKLLSPKGWISTSRDDCE 377

>TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa]
           {ON} Anc_3.566 YGL243W
          Length = 402

 Score =  340 bits (873), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 183/388 (47%), Positives = 247/388 (63%), Gaps = 11/388 (2%)

Query: 5   DELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATG 64
           D L ++I+     EY KL + C+PV R +G +EWT+L+G+ AI+  +    ++++SI TG
Sbjct: 8   DRLGDRIAKLFEDEYLKLSSACKPVIRSNGSKEWTVLSGIVAIDHLSVDKKLRLVSIGTG 67

Query: 65  VKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDW--DLTNGDDLIESNNEIPP 122
           VK+LPD+ L+RS G+++HDCHAEILALRG NTV L H+     +     DLIE       
Sbjct: 68  VKALPDATLERSHGRMVHDCHAEILALRGFNTVLLEHMNYMVTEQCGETDLIERTT--AG 125

Query: 123 KFRLKDKWELALYISKLPCGDASMDFL---NDNCRSXXXXXXXXXXXTFQYVDPDVKTIL 179
              LK KW+LALYIS LPCGDASM  L   N+   +             Q++D  +++IL
Sbjct: 126 VCILKSKWKLALYISTLPCGDASMKDLQTYNNTDTNRKQELTFEENTEIQWIDQKIRSIL 185

Query: 180 RGRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIV 239
           RGR N+ +  VVRTKPGRYDS IT SKSCSDKL ++Q          +L AQPVFL Y+V
Sbjct: 186 RGRFNYDRLGVVRTKPGRYDSQITFSKSCSDKLCIKQVTSILNSLTWSLMAQPVFLDYLV 245

Query: 240 IPNLDEKTRHTLEQSFHNRLPFCSHR-FEFLNCHTPFYDDKKDENSVPSLMCSTKLFMN- 297
           IPNL       +  SF +RL     +  E L C+ PF+D+K  ++  PS M S KLF++ 
Sbjct: 246 IPNLAVDRCQGVHHSFQDRLGRLPQKSLELLECNVPFFDNKSSKSEEPSSMSSVKLFLDL 305

Query: 298 --DSTVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKA 355
                 E+AILNG+KNGFYTK  KPLRK+CES +SR AQW+++  I+P+ K  +YL+FKA
Sbjct: 306 PERKCTEQAILNGLKNGFYTKGNKPLRKNCESAVSRLAQWKIYVNIRPDAKQQTYLEFKA 365

Query: 356 QQTERNQLITLIKGALSPDGWIPTKTDD 383
             +ERN++I  +K  LSPDGWI T+ DD
Sbjct: 366 GLSERNRIIQEVKKVLSPDGWISTRNDD 393

>SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 383

 Score =  338 bits (867), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 186/390 (47%), Positives = 243/390 (62%), Gaps = 22/390 (5%)

Query: 5   DELAEQISTKVIGE-YSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIAT 63
           +E  EQ S+K+I E Y++LK +C+P  R +GI+EWT+LAG+ AIN     + ++++S+ T
Sbjct: 4   EEFVEQGSSKLINEAYARLKPICKPTVRSNGIKEWTVLAGIIAINERK--NTMRLVSLGT 61

Query: 64  GVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGD----DLIESNNE 119
           GVK+ P+ EL+RS+GK++HDCHAEILALRG NTV L  + +  LT G     DL+E   +
Sbjct: 62  GVKATPNEELKRSKGKIVHDCHAEILALRGFNTVLLMQVSE--LTQGKHERVDLVEKAVD 119

Query: 120 IPPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTIL 179
               F++ D W  ALYISKLPCGD+SMD L +                 QY++ +  T+L
Sbjct: 120 -GLSFKVPDHWSFALYISKLPCGDSSMDTLEE---EDLNSFNIENTDACQYLEQNNHTLL 175

Query: 180 RGRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIV 239
           RGR N+ KK  VRTKPGR DS ITLSKSCSDKL +RQ           LF  P++L+YI+
Sbjct: 176 RGRFNYQKKGFVRTKPGRKDSKITLSKSCSDKLSIRQVTSMLNSINWELFDTPIYLKYII 235

Query: 240 IPNLDEKTRHTLEQSFHNRLPFCSH----RFEFLNCHTPFYDDKKDENSVPSLMCSTKLF 295
           IPNLDE     LE+SF      C+H       FL+    F DDK  ++  PS M S  L 
Sbjct: 236 IPNLDEHALVGLERSFER---LCNHPSFNALRFLSGSQTFCDDKITQDQQPSSMSSISLN 292

Query: 296 M--NDSTVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQF 353
           +  N    +EAILNG+KNGFY K  KPLRK+CES +SR +QW+L+  I    +  +YLQF
Sbjct: 293 VHNNGEEFQEAILNGVKNGFYVKNKKPLRKNCESIVSRLSQWQLYNTISSNTEHETYLQF 352

Query: 354 KAQQTERNQLITLIKGALSPDGWIPTKTDD 383
           K+ Q ERN L    K  LSPDGWIPT  DD
Sbjct: 353 KSTQVERNILKNEAKLCLSPDGWIPTGVDD 382

>NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566
           YGL243W
          Length = 388

 Score =  335 bits (858), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 247/386 (63%), Gaps = 16/386 (4%)

Query: 7   LAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATGVK 66
           L ++++  V  EY+KLK   +PV R +G++EWT+LA    ++ N    N+K++S++TGVK
Sbjct: 7   LPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTG--NLKMISLSTGVK 64

Query: 67  SLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGD----DLIESNNEIPP 122
           +LPD EL RS GK++HDCHAEILALRG NTV L   KD D  N +    DL+E + +   
Sbjct: 65  ALPDKELSRSGGKMIHDCHAEILALRGFNTVLL---KDIDNMNQNLRQSDLLEIS-DANG 120

Query: 123 KFRLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTILRGR 182
           K+ L+ KW+L LYIS+LPCGDASM  L+++  +            FQY+DP++ TILRGR
Sbjct: 121 KYHLRAKWKLILYISRLPCGDASMRTLSNSSPTSSSLKSIDDSDEFQYIDPNIPTILRGR 180

Query: 183 LNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVIPN 242
           LNF +  VVRTKPGR DS  TLSKSCSDKL +RQ          +L   PVF+ Y++IP 
Sbjct: 181 LNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQ 240

Query: 243 LDEKTRHTLEQSFHNRLPFCS----HRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMND 298
           L+   ++ L  SF NRL  CS       ++L     F +DK      PS M S KLF+  
Sbjct: 241 LNYDNKNDLLLSFQNRLK-CSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQ 299

Query: 299 S-TVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQ 357
             T+EEA+LNG+KNG YTK  KPLRK+CES +SR+AQW ++ +I P Y  TSYL+FK  Q
Sbjct: 300 GETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQ 359

Query: 358 TERNQLITLIKGALSPDGWIPTKTDD 383
           T R +LI      LS +GW+PT+ DD
Sbjct: 360 TARLELIKYTNEILSSEGWLPTQPDD 385

>Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON}
           complement(11933..13090) [1158 nt, 386 aa]
          Length = 385

 Score =  328 bits (841), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 170/385 (44%), Positives = 244/385 (63%), Gaps = 15/385 (3%)

Query: 7   LAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATGVK 66
           L ++IS  +  EYSKLK+  +P TR + ++EWT+LA + AI+ +   + I  ++I+TGVK
Sbjct: 6   LGDKISNIIFEEYSKLKSSSKPTTRSNNVKEWTVLAAIVAISNDE--NEIIPITISTGVK 63

Query: 67  SLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEIPPKFRL 126
           + P+ EL+RS GK+LHDCH+EIL+LR  NT  L  ++   ++ GD   +S   +P K   
Sbjct: 64  ATPNDELERSSGKILHDCHSEILSLRAFNTYLLQSVQR--VSEGD---KSKFILPAKADG 118

Query: 127 KDKW----ELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTILRGR 182
           K  W    ++ALYISKLPCGDASMD LN++               +Q++DP +KT++RGR
Sbjct: 119 KYNWNENYKIALYISKLPCGDASMDTLNEDLEDNEQNFTIEDNDAYQFIDPKIKTVIRGR 178

Query: 183 LNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVIPN 242
           LN+ KK+VVRTKPGRYDSN+TLSKSCSDKL M+Q           LF  P+FL Y++IP 
Sbjct: 179 LNYSKKNVVRTKPGRYDSNVTLSKSCSDKLCMKQAKSILNSLNWDLFENPIFLAYVIIPT 238

Query: 243 LDEKTRHTLEQSFHNRLPFCS---HRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFM-ND 298
           L ++    L + F  RL           FL C   F DDK +  + P+L+ S K+ +  +
Sbjct: 239 LKDELLLKLNKEFPERLRGIGIPIMPLTFLTCVEKFIDDKTEIKTEPALVSSIKILLPRE 298

Query: 299 STVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQT 358
             +E++I+NG++NG YTK  KPL+K+C+S +S+++QW+LF  +K E    SY+++K  QT
Sbjct: 299 HQIEQSIVNGVRNGSYTKKNKPLKKNCQSDISKYSQWQLFKTLKEEQLAKSYIEYKKSQT 358

Query: 359 ERNQLITLIKGALSPDGWIPTKTDD 383
            R  L  +IK  LSPDGWI T  DD
Sbjct: 359 LREDLKDIIKSKLSPDGWISTFQDD 383

>NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {ON}
           Anc_3.566 YGL243W
          Length = 386

 Score =  323 bits (827), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 168/389 (43%), Positives = 245/389 (62%), Gaps = 12/389 (3%)

Query: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60
           M  + +LA++I+  +  +Y  LK+  +PV R +GI+EWT+ AG+ AIN +   ++++V+S
Sbjct: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDT--NDLRVIS 58

Query: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGD--DLIESNN 118
           +ATGVK+LP+ EL+RS GK+LHD HAEI+ALRG NTV L  I  + L NG+  DL+  + 
Sbjct: 59  LATGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQI--YQLKNGEETDLVIHSK 116

Query: 119 EIPPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTI 178
           +    +  K   ++ALYIS+LPCGD SM  L +               + QY++ D KTI
Sbjct: 117 D-SEYYSFKSNLKIALYISQLPCGDISMRMLKER-DIAPEELAIKDEDSIQYINQDNKTI 174

Query: 179 LRGRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYI 238
           LRGRLNF KK  VRTKPGR DS +T SKSCSDKL M+Q           L  QPV+L Y+
Sbjct: 175 LRGRLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYM 234

Query: 239 VIPNLDEKTRHTLEQSFHNRLPFC---SHRFEFLNCHTPFYDDKKDENSVPSLMCSTKLF 295
           ++P +  + +  ++  F+ +   C    H   +L+    F D +   +  PS + + K+F
Sbjct: 235 IVPGMTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVF 294

Query: 296 MND-STVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFK 354
           +   +++E+ ILNG+KNG YTK  KPLRK+CE+ +SRF+QW++F +I+P+Y   SYL FK
Sbjct: 295 IGQGNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFK 354

Query: 355 AQQTERNQLITLIKGALSPDGWIPTKTDD 383
             Q ER +LI   +  +SPDGWI T+ DD
Sbjct: 355 QSQHERRKLIDYTRSKMSPDGWISTQEDD 383

>TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {ON}
           Anc_3.566 YGL243W
          Length = 396

 Score =  322 bits (824), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 177/389 (45%), Positives = 240/389 (61%), Gaps = 21/389 (5%)

Query: 7   LAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATGVK 66
           +AE++S  V GEYSKL+   +PV + + + EWT+LAG+ AIN        + ++I TGVK
Sbjct: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETG--EFETIAITTGVK 73

Query: 67  SLPDSELQRSRGKLLHDCHAEILALRGANTVFL---NHIKDWDLTNGDDLIESNNEIPPK 123
           + PD++L RS+GK++HDCHAEILALR  N   L   N I + D T+    +   N     
Sbjct: 74  ATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNS---- 129

Query: 124 FRLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTILRGRL 183
           +    KW+LALYISKLPCGDASMD L                   QY+DP  KT +RGRL
Sbjct: 130 YEWNKKWDLALYISKLPCGDASMDDLMK--VGDTAEFEITDDNPLQYIDPKNKTTIRGRL 187

Query: 184 NFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVIPNL 243
           N+ K+ V+RTKPGRYDS ITLSKSC+DKL M+Q           L   P+FL+YI+IP +
Sbjct: 188 NYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRI 247

Query: 244 DEKTRHTLEQSFHNRL---PFCSHRFEFLNCHTPFYDDKKDENSV--PSLMCSTKLFM-N 297
             K    L+ +F +RL    F    F+F++C   F DD  D   V  P+L+ S K+FM N
Sbjct: 248 SGK-ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDN 306

Query: 298 DSTVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQI---KPEYKDTSYLQFK 354
           +  +E++I+NG+KNGFY+KP KPLRK+CE  +SR+++W L  QI   + E  + SYL+FK
Sbjct: 307 NRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFK 366

Query: 355 AQQTERNQLITLIKGALSPDGWIPTKTDD 383
           +  T+R  L   ++  LSPDGWI TK DD
Sbjct: 367 STLTKRMTLQQEVRSLLSPDGWITTKKDD 395

>KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 385

 Score =  313 bits (803), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/391 (44%), Positives = 237/391 (60%), Gaps = 16/391 (4%)

Query: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60
           M   +E+A++I+      Y KLK   +P  R +G +EW +LA V AINR  + ++++++S
Sbjct: 1   MEVNEEVADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVVAINR--ANEDLRLVS 58

Query: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHI---KDWDLTNGDDLIESN 117
           +ATGVK+ P+ +L+RS G++LHDCHAEILALRG N V L  I   KD       DL+ S+
Sbjct: 59  LATGVKAAPNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLKDSQSHPVPDLVSSS 118

Query: 118 NEIPPKFRLKDKWELALYISKLPCGDASMDFLND-NCRSXXXXXXXXXXXTFQYVDPDVK 176
           ++    +RL ++W  ALYIS+ PCGDASM  L D  C S             QYVD + K
Sbjct: 119 SDNSGIYRLNEEWSFALYISRAPCGDASMGLLYDEGCISFTDDDR------CQYVDDNNK 172

Query: 177 TILRGRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLR 236
           TI+RGR N+ KK  VRTKPGR DS +TLSKSC+DKL  +Q           L   PVFL 
Sbjct: 173 TIIRGRFNYAKKGYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTWDLLEAPVFLE 232

Query: 237 YIVIPNLDEKTRHTLEQSFHNRL--PFCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTKL 294
           YIVIP L        E++F  R+       + + L+C   F DDK  EN  PSLM S  L
Sbjct: 233 YIVIPQLPRVAEADFERAFDTRIKDSVPMEKVQILSCSQRFDDDKTYENQPPSLMSSILL 292

Query: 295 FMNDSTV--EEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQ 352
            + +  V  +++ILNG+K G + KP  PL+K+CE+ +SR +QW LF QIK      +Y +
Sbjct: 293 NIIEGQVTQQQSILNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQIKGGVDSQTYRE 352

Query: 353 FKAQQTERNQLITLIKGALSPDGWIPTKTDD 383
           FK+QQT+RN L   I+ ALS DGW+ T++DD
Sbjct: 353 FKSQQTDRNALKERIRLALSKDGWVGTESDD 383

>Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]
           {ON} YGL243W (TAD1) - tRNA-specific adenosine deaminase
           1 (TAD1); Tad1p/scADAT1 [contig 344] FULL
          Length = 383

 Score =  311 bits (798), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/389 (44%), Positives = 229/389 (58%), Gaps = 14/389 (3%)

Query: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60
           M    +LA++IS      Y KLK   +PV R +G++EW +LA V AI  +     ++++S
Sbjct: 1   MDQPHDLADKISDLAFSYYEKLKPSAKPVIRSNGVKEWNVLACVIAIGPD---QGLRLVS 57

Query: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIK---DWDLTNGDDLIESN 117
           +ATGVKS P+ EL+RS G++LHDCHAEILALRG N V L  I+   D       DL+  +
Sbjct: 58  LATGVKSTPNDELKRSNGRILHDCHAEILALRGFNMVLLKQIQMLVDPKAAVVPDLVSPS 117

Query: 118 NEIPPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKT 177
           ++   KF+L D W  ALYIS++PCGDASMD L                 + QYV+P  +T
Sbjct: 118 SDEDGKFKLGDDWSFALYISRIPCGDASMDLLQSE-----SDMEFSEDTSCQYVNPCNRT 172

Query: 178 ILRGRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRY 237
           ILRGR N+ K+  VRTKPGR DS++TLSKSCSDKL  RQ           L   P+FL+Y
Sbjct: 173 ILRGRFNYNKRGYVRTKPGRKDSSLTLSKSCSDKLCYRQVMSILNAMTWDLMESPIFLKY 232

Query: 238 IVIPNLDEKTRHTLEQSFHNRL-PFCSHR-FEFLNCHTPFYDDKKDENSVPSLMCSTKLF 295
           IV+P +    R   E +F +RL  F   +  E L C   F DDK + N VPS +    L 
Sbjct: 233 IVVPKVSNTARRGFESAFKDRLREFPGIKSVELLECPKQFPDDKFELNQVPSSVSGILLN 292

Query: 296 MNDSTVE-EAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFK 354
            ND   E ++ILNG+K+G Y +  KPLRK+CE+ +SR AQW LF ++K      SY  FK
Sbjct: 293 TNDGQPEQQSILNGVKSGAYVREPKPLRKNCETMISRLAQWTLFKKVKDYSDKKSYQAFK 352

Query: 355 AQQTERNQLITLIKGALSPDGWIPTKTDD 383
            +Q  RN L   ++ +LS DGWI T  DD
Sbjct: 353 GEQVARNVLKNKVRSSLSSDGWISTGPDD 381

>Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {ON}
           similar to Ashbya gossypii AFR267W
          Length = 387

 Score =  305 bits (781), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 170/386 (44%), Positives = 234/386 (60%), Gaps = 17/386 (4%)

Query: 7   LAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATGVK 66
           LAE +S  VI +Y  LK   +P  + +GI+EWT+LAG+ AI+ N   + ++++S+ATGVK
Sbjct: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENT--NELRLISVATGVK 65

Query: 67  SLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIK--DWDLTNGDDLIESNNEIPPKF 124
           +LP+ EL+RS G++LHD HAEILALR  N V L  +     + T   DL+E  N   P +
Sbjct: 66  ALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHP-Y 124

Query: 125 RLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTILRGRLN 184
           R++ +W++ALYIS+ PCGD SMD L ++                QY++P ++T LRGR N
Sbjct: 125 RMRKRWKIALYISRPPCGDCSMDILGED---DTNYMQFSFDDCCQYINPGIRTTLRGRFN 181

Query: 185 FGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVIP-NL 243
           +  K V RTKPGR DS ITLSKSCSDKL  +Q           L   PVFL Y+V+P + 
Sbjct: 182 YDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHH 241

Query: 244 DEKTRHTLEQSFHNRLPFCS--HRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMN---- 297
            EK      ++FH RL   +  H  E + C   F  DK++E+  P  +  + +++N    
Sbjct: 242 REKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPI--SGVYINIKPM 299

Query: 298 DSTVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQ 357
           +  +EE ILNG+ NGFY K  +PLRK+CES LSR + W LFTQ+       SYL FK++Q
Sbjct: 300 EMDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQ 359

Query: 358 TERNQLITLIKGALSPDGWIPTKTDD 383
           T RNQL   ++  LS DGWIPT  DD
Sbjct: 360 TSRNQLKEQVRLHLSSDGWIPTSADD 385

>KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566
           YGL243W
          Length = 391

 Score =  304 bits (778), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 159/386 (41%), Positives = 235/386 (60%), Gaps = 8/386 (2%)

Query: 5   DELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATG 64
           D L  +I+  V  EY +L    +P  R +G +EWTIL+G+ A+  +     ++++S+ TG
Sbjct: 3   DLLGNEIADLVYSEYDRLSTSSKPAVRSNGTKEWTILSGLVAVPLHPGP-QLRLISLTTG 61

Query: 65  VKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEIPPKF 124
           VK+ P+ +L+RS+G++LHDCHAEILALRG N V L  ++     +  DLI    +   KF
Sbjct: 62  VKATPNQDLERSQGRVLHDCHAEILALRGFNYVLLRQMQAARNNDRCDLILPGIQDTNKF 121

Query: 125 RLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTILRGRLN 184
           RL  +++LAL+IS+LPCGD SM+ L +                 QY+DP+ +++LRGR N
Sbjct: 122 RLNPEYQLALFISRLPCGDGSMNSLQEQGGLGQDTNGIDDDDPVQYIDPNNRSLLRGRFN 181

Query: 185 FGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVIPNLD 244
           + KK  VRTKPGR DS IT SKSCSDKL   Q           L  + V++ Y+++PN+ 
Sbjct: 182 YAKKGCVRTKPGRMDSKITYSKSCSDKLCCHQATSILNACTWPLIEEAVYIDYLIVPNIS 241

Query: 245 EKTRHTLEQSFHNRLP---FCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMNDS-T 300
              R+ LE+ F  RL    F  H+ + L+C   F DD++DE+  PS +   KL++ +  T
Sbjct: 242 ASDRNALERCFTTRLSSATFPVHKMQILSCGQSFADDQQDEDEQPSSISCVKLYITEGET 301

Query: 301 VEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEY--KDTSYLQFKAQQT 358
           +E+A+L+G++NGF+TK  KPLR +CE+ +SR +QW LF  + PE   K TSY  FK++  
Sbjct: 302 LEQAVLSGIRNGFFTKVSKPLRNNCETAVSRLSQWRLFCTLNPEASNKYTSYRDFKSKLV 361

Query: 359 ERNQLITLIKGALS-PDGWIPTKTDD 383
            R +LIT  +  L+    WIPT +DD
Sbjct: 362 PRAELITRTRSLLTNGQPWIPTCSDD 387

>CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53065 Saccharomyces cerevisiae YGL243w TAD1
          Length = 385

 Score =  300 bits (767), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 173/394 (43%), Positives = 231/394 (58%), Gaps = 20/394 (5%)

Query: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60
           M  +D+   +I+  V+ EY KL A  RPVTR +G +E TI+A V A   +   D   +L+
Sbjct: 1   MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIA--SDTRTDKHSILT 58

Query: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESN--N 118
           I TGVKS P+ EL RS+GK+LHDCHAEILALRG N + L HIK        + IESN  +
Sbjct: 59  ITTGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIK-----RSMEGIESNLIH 113

Query: 119 EIPPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTI 178
             P  F   ++ EL L+ISKLPCG+ SM  L +                 QY+ P++KTI
Sbjct: 114 NTPNGFEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTI 173

Query: 179 LRGRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYI 238
           LRGR NF K++ VRTKPGR DS  T SKSCSDKL +R            +   P+++   
Sbjct: 174 LRGRCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNY 233

Query: 239 VIPNLDEKTRHTLEQS--FHNR---LPFCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTK 293
           VIPN++    H +E+   + NR   L   + R      H  F DD   E + PS M + K
Sbjct: 234 VIPNINS---HQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPE-TPPSSMSALK 289

Query: 294 LFMNDSTV-EEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQ 352
           +  ND+ + EE ILNG+KNG+YTK  KPLRK+CES +SR++ W LF  +  E+KD +YL+
Sbjct: 290 ILFNDNDIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLE 349

Query: 353 FKAQQ-TERNQLITLIKGALSPDGWIPTKTDDVK 385
           FK +   ER +LI  IK +LS DGW+ T  DD +
Sbjct: 350 FKRRYCAERAELIRSIKSSLSSDGWLSTAEDDCQ 383

>TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566
           YGL243W
          Length = 394

 Score =  299 bits (765), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 165/395 (41%), Positives = 238/395 (60%), Gaps = 18/395 (4%)

Query: 4   KDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIAT 63
           K EL ++I+  +  EY+KLK   +P+ + +GI+EWTI++G+ A++ N   + IKV+S+AT
Sbjct: 3   KRELGDKIAALLFREYNKLKKSNKPIKKSNGIKEWTIISGIVAVS-NKDTNIIKVISLAT 61

Query: 64  GVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHI--KDWDLTNGDDLI-ESNNEI 120
           GVK+ PDSEL+RS+G ++HDCHAEILA+RG NT  L  I  K+ D TN  DLI +  N  
Sbjct: 62  GVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSK 121

Query: 121 PPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSXXXXXXXXXXXTFQYVDPDVKTILR 180
             K+   D+++L LYISKLPCGD+SM+   +N                QYVDP ++TILR
Sbjct: 122 CKKYSWNDEYDLGLYISKLPCGDSSME--EENSLESNSLIQFQENDLTQYVDPTIRTILR 179

Query: 181 GRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVI 240
           GR+N+ K   VRTKPGR DS IT SKSCSDK+ ++Q           L   P++++Y+V 
Sbjct: 180 GRINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVLSLLNSLNTELLESPIYIKYLVC 239

Query: 241 PNLDEKTRHTLEQSFHNRL---------PFCSHRFEFLNCHTPFYDDKKDENSVPSLMCS 291
           P++  +    L++SF NR+          +  H   F+     F D K ++   PS    
Sbjct: 240 PDIKPQNLILLKKSF-NRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSV 298

Query: 292 TKLFMNDST--VEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTS 349
            K+F ++    +E++I+NG+K G YTK  KPL K+  + +SR  QW +F  I PE++  S
Sbjct: 299 VKIFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYS 358

Query: 350 YLQFKAQQTERNQLITLIKGALSPDGWIPTKTDDV 384
           YL FK  QT+R +    I+  LS DGWI T  DD+
Sbjct: 359 YLTFKRFQTDRIETRNRIRKCLSQDGWISTFNDDI 393

>KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 380

 Score =  293 bits (751), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 161/382 (42%), Positives = 223/382 (58%), Gaps = 12/382 (3%)

Query: 7   LAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATGVK 66
           +A++I+  VI  Y KL    +P  R +G+ EWT+L+G+ A +     D  + +S+ TGVK
Sbjct: 4   IADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAFDE--LNDRYEPISLGTGVK 61

Query: 67  SLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDD--LIESNNEIPPKF 124
           + P+ ELQRS G+++HDCHAE++ LR  N + L  I   DL NG    LIE + +    +
Sbjct: 62  ATPNEELQRSNGQIVHDCHAEVICLRAFNALLLKEI--CDLQNGQKSFLIEKSAD---GY 116

Query: 125 RLKDKWELALYISKLPCGDASMDFLN--DNCRSXXXXXXXXXXXTFQYVDPDVKTILRGR 182
           ++KD W+ A+YIS++PCGDASM+ L   D                 QYV P++ TI+RGR
Sbjct: 117 KVKDVWKFAMYISRIPCGDASMNLLEAEDKSECENCQQVGNIFINGQYVHPEIDTIIRGR 176

Query: 183 LNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFAQPVFLRYIVIPN 242
            N+  + VVRTKPGR DS ITLSKSCSDKL M+Q          +L   PV+L +IV+P 
Sbjct: 177 ANYKLRKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNALTWSLLQSPVYLEWIVLPK 236

Query: 243 LDEKTRHTLEQSFHNRLPFCSHR-FEFLNCHTPFYDDKKDENSVPSLMCSTKLFMNDSTV 301
             +  +  LE +F  RL       F+FL C+  F  D+ + +  PSL     L+ ++  V
Sbjct: 237 QYQYEQVQLEDTFWLRLKNQQFLPFKFLFCNETFSADRTNLSQQPSLSSCVSLYGSNEAV 296

Query: 302 EEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQTERN 361
            E ILNG+KNGFY K  KPLRK C+S +SR AQW  F +IK    DT Y  FK+   +RN
Sbjct: 297 SEVILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKIKAMPSDTDYYGFKSSVVDRN 356

Query: 362 QLITLIKGALSPDGWIPTKTDD 383
            +I+  K  LS  GWI T  D+
Sbjct: 357 HIISKAKATLSASGWISTCRDN 378

>AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL243W (TAD1)
          Length = 385

 Score =  273 bits (698), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 163/396 (41%), Positives = 215/396 (54%), Gaps = 39/396 (9%)

Query: 5   DELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATG 64
           D+LAE I  +VI +Y   K   +P  R +G  EWT+LAGV  ++R  +    +++S ATG
Sbjct: 4   DKLAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVVLVDRQTA--ECRLVSAATG 61

Query: 65  VKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGD----DLIESNNEI 120
           VK+LPD EL+RS G+++HD HAEILALRG N V L   K   +T+G     DL+E   + 
Sbjct: 62  VKALPDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKL--VTDGRSAECDLVE-QAKT 118

Query: 121 PPKFRLKDKWELALYISKLPCGDAS----------MDFLNDNCRSXXXXXXXXXXXTFQY 170
             +FRL  +W+ ALYISK PCGD S          M F  D+                QY
Sbjct: 119 QDRFRLASRWQAALYISKAPCGDCSMDMADDDADEMTFSPDD--------------PIQY 164

Query: 171 VDPDVKTILRGRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQXXXXXXXXXXALFA 230
           V     T+LRGR N+ +K V RTKPGR DS ITLSKSCSDKL  +            LF 
Sbjct: 165 VAEHNYTMLRGRFNYSRKGVARTKPGRADSQITLSKSCSDKLASKTVMSLLSSMTWELFE 224

Query: 231 QPVFLRYIVIPNLDEKTRHTLEQSFHNRLPFC--SHRFEFLNCHTPFYDDKKDENSVPSL 288
           +PVFL Y+V+P+         E+ F  RL     +H    L CHT F  D+      P+L
Sbjct: 225 EPVFLDYLVLPHTIATA--GFERCFAERLAGLEGTHMPRLLCCHTAFPGDRAAPQQPPAL 282

Query: 289 MCSTKL-FMNDSTVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKD 347
             S  L       VE+A+LNG++NG Y +P + L  H E+ +SR A W +F Q+  +   
Sbjct: 283 TASVYLNITAKKHVEQALLNGVRNGAYVRPPRALAAHAETIVSRAALWRVFMQLH-QAPP 341

Query: 348 TSYLQFKAQQTERNQLITLIKGALSPDGWIPTKTDD 383
            SY  FK QQ  RN+L   ++  LSPDGW  T+ DD
Sbjct: 342 LSYAAFKRQQHARNRLKRHVRHRLSPDGWPTTRVDD 377

>Smik_1.108 Chr1 complement(176076..176135,176139..176261) [183 bp,
           61 aa] {ON} YGL243W (REAL)
          Length = 61

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 79  KLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEIPPKFRLKDKWELALY 135
           KL    +  IL LRGAN V LN++K     N +D   SN+  P +F+LK   ELAL+
Sbjct: 6   KLYTIVYPGILTLRGANKVLLNYVKGCKPANDNDFF-SNHGTPSRFKLKGNCELALF 61

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,259,810
Number of extensions: 1761276
Number of successful extensions: 3928
Number of sequences better than 10.0: 22
Number of HSP's gapped: 3926
Number of HSP's successfully gapped: 22
Length of query: 385
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 274
Effective length of database: 40,753,473
Effective search space: 11166451602
Effective search space used: 11166451602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)