Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.173.567ON56954822290.0
Skud_7.233.567ON56454821040.0
Smik_7.173.567ON56554920490.0
YGL244W (RTF1)3.567ON55854820470.0
TDEL0D063503.567ON56555014840.0
KNAG0I002303.567ON57156114710.0
NDAI0I032403.567ON56355214410.0
KAFR0J028803.567ON55554914380.0
ZYRO0E09526g3.567ON56054214060.0
TPHA0A060003.567ON54954213920.0
CAGL0H07711g3.567ON56656113520.0
Kpol_507.103.567ON46146513201e-178
AFR266W3.567ON56255312971e-173
KLTH0G00726g3.567ON56154212881e-172
Kwal_47.192653.567ON56747612721e-169
Ecym_25973.567ON56248112711e-169
NCAS0E002603.567ON55831611611e-153
SAKL0F00814g3.567ON57431511431e-150
KLLA0A00737g3.567ON58231510561e-137
TBLA0E002203.567ON57031710391e-134
Skud_14.1112.16ON58297742.4
Suva_14.1172.16ON581109724.1
Kpol_1054.581.530ON40162698.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.17
         (569 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)   863   0.0  
Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)   815   0.0  
Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)   793   0.0  
YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit ...   793   0.0  
TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa] ...   576   0.0  
KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567...   571   0.0  
NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {O...   559   0.0  
KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {...   558   0.0  
ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {...   546   0.0  
TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa] ...   540   0.0  
CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly...   525   0.0  
Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON} (57107..5...   513   e-178
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...   504   e-173
KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar ...   500   e-172
Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]...   494   e-169
Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {O...   494   e-169
NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567...   451   e-153
SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar ...   444   e-150
KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar ...   411   e-137
TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567...   404   e-134
Skud_14.111 Chr14 complement(211532..213280) [1749 bp, 582 aa] {...    33   2.4  
Suva_14.117 Chr14 complement(216958..218703) [1746 bp, 581 aa] {...    32   4.1  
Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON} (1443...    31   8.5  

>Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)
          Length = 569

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/548 (80%), Positives = 439/548 (80%)

Query: 22  QVLTSTSAKRAKNNDQSISKKRRIEVGSAXXXXXXXXXXXXYNPYSVGNTGYGSXXXXXX 81
           QVLTSTSAKRAKNNDQSISKKRRIEVGSA            YNPYSVGNTGYGS      
Sbjct: 22  QVLTSTSAKRAKNNDQSISKKRRIEVGSAEEEEEEDEEEDDYNPYSVGNTGYGSEEEEEV 81

Query: 82  XXXXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQ 141
                   GKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQ
Sbjct: 82  EPNPFPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQ 141

Query: 142 RKRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXXXXXXXX 201
           RKRA                HATGHSDIKASKLSQLKKQRARKN                
Sbjct: 142 RKRARDDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDSEDEQDDQEEY 201

Query: 202 XXXXXKNXXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNKLRIG 261
                KN            NPFDRKGVYDKR                   ISDFNKLRIG
Sbjct: 202 REDDYKNDEGSEYGDDEEYNPFDRKGVYDKREEEVEWAEEEEDELDRDPEISDFNKLRIG 261

Query: 262 RSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQ 321
           RSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQ
Sbjct: 262 RSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQ 321

Query: 322 YFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVN 381
           YFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVN
Sbjct: 322 YFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVN 381

Query: 382 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 441
           TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF
Sbjct: 382 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 441

Query: 442 EKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRL 501
           EKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRL
Sbjct: 442 EKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRL 501

Query: 502 KTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLERMIGEL 561
           KTRTKVYYQEIQKEENAKAKEMAQQEKLQ               AQFRRLGGLERMIGEL
Sbjct: 502 KTRTKVYYQEIQKEENAKAKEMAQQEKLQEDRESKERREKELLLAQFRRLGGLERMIGEL 561

Query: 562 DIKFDFKF 569
           DIKFDFKF
Sbjct: 562 DIKFDFKF 569

>Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)
          Length = 564

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/548 (75%), Positives = 430/548 (78%), Gaps = 5/548 (0%)

Query: 22  QVLTSTSAKRAKNNDQSISKKRRIEVGSAXXXXXXXXXXXXYNPYSVGNTGYGSXXXXXX 81
           QVLTSTSAKRAKNNDQS+SKKRRIEV SA            YNPYSVGN GYGS      
Sbjct: 22  QVLTSTSAKRAKNNDQSVSKKRRIEVDSAEEEDEEDEEEDDYNPYSVGNAGYGSEGEEAN 81

Query: 82  XXXXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQ 141
                   GK+KDE+DREHLESLPEMERETLLFERSQIMQKYQERKLFRARG+DMKEQQQ
Sbjct: 82  PFPLE---GKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQ 138

Query: 142 RKRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXXXXXXXX 201
           R  A                HATGHSDIKASKLSQLKKQRARKN                
Sbjct: 139 R--AKDKEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDNEDEEDDEDEY 196

Query: 202 XXXXXKNXXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNKLRIG 261
                KN            NPFDRK +YDKR                   ISD+NKLRIG
Sbjct: 197 REDNYKNEEESEYEDDEEYNPFDRKDLYDKREEEVEWAEEGEDELDREPEISDYNKLRIG 256

Query: 262 RSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQ 321
           RSFVAKFCFYPGFEDVVKGCYGRVN+GTDKRTGKTSYRMVRIER+FLQKPY+MGKF+TNQ
Sbjct: 257 RSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQ 316

Query: 322 YFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVN 381
           YFGVTQGKDRKVFQMNYFSDG F DDEY+RYFKALD SHMVKPSLH+LSNKTKEV+DFVN
Sbjct: 317 YFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVN 376

Query: 382 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 441
           TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF
Sbjct: 377 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 436

Query: 442 EKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRL 501
           EKRMS+YEKHHENDQSDIKTLGELTSKNRKLN+SNIRNAEHVKKED SNFDSKSDPFSRL
Sbjct: 437 EKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRL 496

Query: 502 KTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLERMIGEL 561
           KTRTKVYYQEIQKEENAKAKE+AQQEKLQ               AQFRRLGGLERMIGEL
Sbjct: 497 KTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKEAKDKREKELLLAQFRRLGGLERMIGEL 556

Query: 562 DIKFDFKF 569
           DIKFDFKF
Sbjct: 557 DIKFDFKF 564

>Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)
          Length = 565

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/549 (74%), Positives = 427/549 (77%), Gaps = 6/549 (1%)

Query: 22  QVLTSTSAKRAKNNDQSISKKRRIEVGSAXXXXXXXXXXXX-YNPYSVGNTGYGSXXXXX 80
           QVLT+TSAKRAKNNDQS+SKKRRIEVG+A             YNPYSVGN  YGS     
Sbjct: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGNAEEDDEEDEDEEDDYNPYSVGNASYGSEEVEE 81

Query: 81  XXXXXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQ 140
                    GKYK+ESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARG+DMKEQQ
Sbjct: 82  PNPFPLE--GKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQ 139

Query: 141 QRKRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXXXXXXX 200
           QR  A                HATGHSDIKASKLSQLKKQRARKN               
Sbjct: 140 QR--AKNDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEGEVDDEDE 197

Query: 201 XXXXXXKNXXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNKLRI 260
                 K+            NPFDR  +YDKR                   ISDFNK+RI
Sbjct: 198 YREDDYKDDEGSEYGDDEEYNPFDRGDLYDKREEEVEWAEEEDELDREPE-ISDFNKVRI 256

Query: 261 GRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTN 320
           GRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIER+FLQKPYNMGKF+TN
Sbjct: 257 GRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTN 316

Query: 321 QYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFV 380
           QYFGVTQGKDRKVFQMNYFSDGLF DDEYQRY +ALD S +VKPSLH+L+NKTKEV+DFV
Sbjct: 317 QYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFV 376

Query: 381 NTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRN 440
           NTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRN
Sbjct: 377 NTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRN 436

Query: 441 FEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSR 500
           FEKRMSVYEKHHENDQSDIK LGELTSKNRKLN+SNIRNAEHVKKED +NFDSKSDPFSR
Sbjct: 437 FEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSR 496

Query: 501 LKTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLERMIGE 560
           LKTRTKVYYQEIQKEENAKAKE+AQQEKLQ               AQFRRLGGLERMIGE
Sbjct: 497 LKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGE 556

Query: 561 LDIKFDFKF 569
           LDIKFDFKF
Sbjct: 557 LDIKFDFKF 565

>YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit of
           RNAPII-associated chromatin remodeling Paf1 complex;
           regulates gene expression by directing cotranscriptional
           histone modification, influences transcription and
           chromatin structure through several independent
           functional domains; directly or indirectly regulates
           DNA-binding properties of Spt15p and relative activities
           of different TATA elements; involved in transcription
           elongation as demonstrated by the G-less-based run-on
           (GLRO) assay
          Length = 558

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/548 (74%), Positives = 425/548 (77%), Gaps = 11/548 (2%)

Query: 22  QVLTSTSAKRAKNNDQSISKKRRIEVGSAXXXXXXXXXXXXYNPYSVGNTGYGSXXXXXX 81
           QVLT+TSAKRAKNNDQS+SKKRRIEVGS             YNPYSVGN  YGS      
Sbjct: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGSVEDDDEEDD----YNPYSVGNADYGSEEEEEA 77

Query: 82  XXXXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQ 141
                   GKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARG+DMKEQQQ
Sbjct: 78  NPFPLE--GKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQ 135

Query: 142 RKRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXXXXXXXX 201
           R  A                HATGHSDIKASKLSQLKKQRARKN                
Sbjct: 136 R--AKNDEDSRKTRASTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEDEDDEEDYR 193

Query: 202 XXXXXKNXXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNKLRIG 261
                K+            NPFDR+  YDKR                   ISDFNKLRIG
Sbjct: 194 EEDY-KDDEGSEYGDDEEYNPFDRRDTYDKREEVEWAEEEDEQDREPE--ISDFNKLRIG 250

Query: 262 RSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQ 321
           RSFVAKFCFYPGFED VKGCYGRVNVGTDKRTGKTSYRMVRIER+FLQKPYNMGKF+TNQ
Sbjct: 251 RSFVAKFCFYPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQ 310

Query: 322 YFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVN 381
           YFGVTQGKDRKVFQMNYFSDGLF +DEYQRY +ALD S M+KPSLH+LSNKTKEV+DFVN
Sbjct: 311 YFGVTQGKDRKVFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNKTKEVMDFVN 370

Query: 382 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 441
           TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF
Sbjct: 371 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 430

Query: 442 EKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRL 501
           EKRMSVYEKHHENDQSDIK LGELTSKNRKLN+SNIRNAEHVKKED++NFDSKSDPFSRL
Sbjct: 431 EKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDSNNFDSKSDPFSRL 490

Query: 502 KTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLERMIGEL 561
           KTRTKVYYQEIQKEENAKAKE+AQQEKLQ               AQFRRLGGLERM+GEL
Sbjct: 491 KTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKDAKDKREKELLVAQFRRLGGLERMVGEL 550

Query: 562 DIKFDFKF 569
           DIKFD KF
Sbjct: 551 DIKFDLKF 558

>TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa]
           {ON} Anc_3.567 YGL244W
          Length = 565

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/550 (55%), Positives = 370/550 (67%), Gaps = 14/550 (2%)

Query: 23  VLTSTSAKRAKNNDQSISKKRRIEV-GSAXXXXXXXXXXXXYNPYSV----GNTGYGSXX 77
           VLT TSAKR K +D + SK+R+I V G+             YNP +V    G        
Sbjct: 23  VLT-TSAKRNKTSDNASSKRRKIAVEGAEEDEDEDEDEEDDYNPAAVQTESGRYSEEDEE 81

Query: 78  XXXXXXXXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMK 137
                       GKYKD++DR HLE LPEMERETLLFERSQIMQKY +R+LFR RG++MK
Sbjct: 82  DEEEEENPFPLEGKYKDDNDRAHLEGLPEMERETLLFERSQIMQKYHDRRLFRERGRNMK 141

Query: 138 EQQQRKRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXXXX 197
           EQQ+ ++                 HATGHSD+KASKLSQL+KQR +K             
Sbjct: 142 EQQKNRQLREGNKTRSSARTT---HATGHSDLKASKLSQLRKQREQKGHRANRDRDFEEE 198

Query: 198 XXXXXXXXXKNXXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNK 257
                     +             P++RK   D R                   I+DFNK
Sbjct: 199 EEEEEDRYEGSEYEDEDEEDYD--PYNRKSHRDARKGRRSGMGRDQLDREAD--ITDFNK 254

Query: 258 LRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKF 317
           ++IGRSFVAKFCFYPGF DVVKG YGRVNVG DKR+G+T YRMV+IE++F QKPYNMG F
Sbjct: 255 IKIGRSFVAKFCFYPGFNDVVKGHYGRVNVGVDKRSGQTQYRMVKIEKVFFQKPYNMGNF 314

Query: 318 FTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVI 377
           FTNQYFGVTQGKDRKVFQMN+FSDG FT  EY RY +ALDG H+ KPS+++L NK KE+ 
Sbjct: 315 FTNQYFGVTQGKDRKVFQMNFFSDGNFTQSEYDRYLRALDGVHITKPSMYSLDNKAKEMN 374

Query: 378 DFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQ 437
            FV+ PLTDK TD++VR+RM FNKKLSG+NAVLEKTVL+EKL+YA+ET N++DIAKYS+Q
Sbjct: 375 AFVSQPLTDKLTDDIVRNRMLFNKKLSGSNAVLEKTVLKEKLRYAQETGNDRDIAKYSSQ 434

Query: 438 LRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDP 497
           LRN  KRMS YEKHHE DQS IK LG LTSKNRK+N+  IRNAEH+KKED  NFD+KSDP
Sbjct: 435 LRNLVKRMSAYEKHHETDQSGIKKLGALTSKNRKVNMDRIRNAEHIKKEDV-NFDAKSDP 493

Query: 498 FSRLKTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLERM 557
           FSRLKTRTKVYYQEIQKEEN +A+++A+Q++L                + F+RLGGLER+
Sbjct: 494 FSRLKTRTKVYYQEIQKEENERAQDIARQKQLDESEEAIARREKELLSSDFKRLGGLERV 553

Query: 558 IGELDIKFDF 567
           IG++ + F F
Sbjct: 554 IGQMQLPFTF 563

>KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567
           YGL244W
          Length = 571

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/561 (53%), Positives = 368/561 (65%), Gaps = 28/561 (4%)

Query: 22  QVLTSTSAKRAKNNDQSISKKRRIEVGSAXX-----XXXXXXXXXXYNPYSVGNTGYGSX 76
           +VLTST +KR+K +D + SKKRRI  GS                  YNP+ VGN   G  
Sbjct: 22  RVLTSTVSKRSKQSDATASKKRRIYEGSEEEVYDDEADDVDEEEDDYNPHEVGNYDTGDD 81

Query: 77  XXXXXXXXXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDM 136
                        GKYKDE DRE+LESLPE+ERET+LF+RSQ M+KYQERKLFR R    
Sbjct: 82  EAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRER---- 137

Query: 137 KEQQQRKRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXXX 196
           K QQ+ K                  H+TGHSD+KASKLSQLK+QR +K            
Sbjct: 138 KRQQEAK---------PTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQRSDDEYEE 188

Query: 197 XXXXXXXXXXKN--------XXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXX 248
                                           NP   K  YD+                 
Sbjct: 189 DEEEEEEDDYNGYGDDLNEDAEYQEDEDEEDYNPLAIKSKYDELEEEEDDDVKWAEDNDR 248

Query: 249 XXXISDFNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFL 308
              ++DFNKLRIGRSFVAKFCFYPGF D+V GCYGRVNVG DKR+G+T YRMV+IE++FL
Sbjct: 249 VSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFL 308

Query: 309 QKPYNMGKFFTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHT 368
           QKPYNMGKF+TNQYFGVTQGKDRKVFQMN+FSDG FT +EY+RY ++L+ +++ +PS H 
Sbjct: 309 QKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHI 368

Query: 369 LSNKTKEVIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNE 428
           LSNK+KE++ F+  PLT+K TDE+VR+RM FNKKLSGTNAVLEKTVLR KLQYA+E+NNE
Sbjct: 369 LSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNE 428

Query: 429 KDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDT 488
           +D+AKYSAQLRNFEKRM+ YEKHHEND +  K LG LTSKNRK+N+   +N +H KKED+
Sbjct: 429 RDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDS 488

Query: 489 S--NFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXA 546
           +    DSKSDPFSRLKTRTK+YYQE+QKEEN KAK +AQQ++++               A
Sbjct: 489 AGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELLLA 548

Query: 547 QFRRLGGLERMIGELDIKFDF 567
           QFRRLGGLE MI ++++ FD 
Sbjct: 549 QFRRLGGLENMISKINVNFDI 569

>NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {ON}
           Anc_3.567 YGL244W
          Length = 563

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/552 (54%), Positives = 359/552 (65%), Gaps = 22/552 (3%)

Query: 24  LTSTSAKRAKNNDQSISKKRRIEVGSAXXXXXXXXXXXXYNPYSVGNTGYGSXXXXXXXX 83
           L +TS KRAKN+DQ  SK+++IEV S             YNPY     G  S        
Sbjct: 24  LLTTSGKRAKNHDQVGSKRKKIEVDSEAEEEEEDD----YNPYG----GNQSEEEEIDEP 75

Query: 84  XXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQRK 143
                  KYKDE DREHLESLPEMERETLLFERSQ+M+KYQERKLFR R +++KEQQ+R 
Sbjct: 76  NPFPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKEQQERN 135

Query: 144 RAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARK------NXXXXXXXXXXXX 197
                             HATGHSD+KASKLSQLKKQR RK      N            
Sbjct: 136 ELEEEGKKTRSSTRAT--HATGHSDLKASKLSQLKKQRERKTRDQDYNDVEDEDDLDDYA 193

Query: 198 XXXXXXXXXKNXXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNK 257
                                  NP+  +  YD                     + DFNK
Sbjct: 194 PDDNYKHEDSEYEEEGEEDEEDYNPYATRKSYD---MDKDEVEWAEEQTDREAELDDFNK 250

Query: 258 LRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKF 317
           +++GRSF+AK+CFYPGF D++KGCYGRVNVGTD+RTG +SYRMV+IE++FL+ PY MG F
Sbjct: 251 VKVGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDF 310

Query: 318 FTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVI 377
           FTNQY GVTQG DRKV QMN FSDGLFT  E+ RY +AL+ SH+ KPS+H L  K+KE+ 
Sbjct: 311 FTNQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQ 370

Query: 378 DFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQ 437
            FV+ PLT K TD +VR+RM FNKKLSGTNAVLEKTVL++KL+YA+E NNE+D+AKYS+Q
Sbjct: 371 AFVSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQ 430

Query: 438 LRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDP 497
           LRN EKRMSVYEKHHENDQ  +  LG LTSKNRK+N+  IRNAEH+KKED    DSKSDP
Sbjct: 431 LRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKED-HGLDSKSDP 489

Query: 498 FSRLKTRTKVYYQEIQKEENAKAKEMAQ--QEKLQXXXXXXXXXXXXXXXAQFRRLGGLE 555
           FSRLKTRTK+YYQE+QKEEN KA+ MA+  Q++LQ               A+F+RLGGLE
Sbjct: 490 FSRLKTRTKIYYQEVQKEENEKAQAMAEAKQKQLQENKALNEHKEKELLLARFKRLGGLE 549

Query: 556 RMIGELDIKFDF 567
            +I  LDI   F
Sbjct: 550 NLIQNLDINVTF 561

>KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {ON}
           Anc_3.567 YGL244W
          Length = 555

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/549 (54%), Positives = 375/549 (68%), Gaps = 21/549 (3%)

Query: 23  VLTSTSAKRAKNNDQSISKKRRIEVGSAXXXXXXXXXXXXYNPYSVGNTGYGSXXXXXXX 82
           VLT TS +  ++ D S +KKRRIE  S             YNP ++ + G G+       
Sbjct: 22  VLT-TSKRTKQSGDSSANKKRRIESDSDEDEDD-------YNPAAI-DGGDGAYNENDDE 72

Query: 83  XXXXXX----XGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKE 138
                      GKYK+E DR++LESLPEMERET+L++RSQ M+KY+ER+ F+ R K++K 
Sbjct: 73  EEYEENPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKR 132

Query: 139 QQQRKRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXXXXX 198
           Q++R                   HATGH+D+KASKLSQLKKQR +KN             
Sbjct: 133 QKER---NEDDEALKTRSSGRATHATGHTDLKASKLSQLKKQREKKNKSRQYSDYEEEEE 189

Query: 199 XXXXXXXXKNXXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNKL 258
                   +             NP++RK  Y                      ++DFNKL
Sbjct: 190 EDEEEFEDEYREGSEYEEEEDYNPYERKTAY---KDEEDEEVEWAEDTDRDTELNDFNKL 246

Query: 259 RIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFF 318
           RIGRSFVAKFCFYP F ++VKGCYGRVNVG DKRTG+TSYRMV+IERIFLQKPY+MGKFF
Sbjct: 247 RIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFF 306

Query: 319 TNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVID 378
           TNQYFGVTQGKDRKVFQM++FSDGL T  EY+RY ++L+ SH+ KP+++TL +K+KE++ 
Sbjct: 307 TNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVS 366

Query: 379 FVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQL 438
           FV+ PLT+K T+E+VR+RM FNKKLSGTNAVLEKTVL+EKLQYA+ETNNE+D+AKYSAQL
Sbjct: 367 FVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQL 426

Query: 439 RNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPF 498
           RNFEKRM++YEKHHENDQ+  K LG LTSKN+K+N+  +RNAEHVKKED      KSDPF
Sbjct: 427 RNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLP--IDKSDPF 484

Query: 499 SRLKTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLERMI 558
           SRLKTRTK+YYQEIQKEEN +AK +AQQ+K++               AQFRRLGGLE+MI
Sbjct: 485 SRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMI 544

Query: 559 GELDIKFDF 567
             L+I+FD 
Sbjct: 545 SGLNIEFDL 553

>ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244W RTF1 Subunit of the RNA polymerase II-associated
           Paf1 complex directly or indirectly regulates
           DNA-binding properties of Spt15p (TATA box-binding
           protein) and relative activities of different TATA
           elements
          Length = 560

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/542 (53%), Positives = 361/542 (66%), Gaps = 8/542 (1%)

Query: 24  LTSTSAKRAKNNDQSISKKRRIEVGSAXXXXXXXXXXXXYNPYSVGNTGYGSXXXXXXXX 83
           + ++SAKR+  +D++ SKKRRIE                YNP + G              
Sbjct: 23  VLASSAKRSGKSDRASSKKRRIE--VEGGEDDEDEDEDDYNPAASGAGTGDYDDEEEEEE 80

Query: 84  XXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQRK 143
                 GKYKDE+DR++L  LPEMERET+LFERSQIMQKYQ+RK+FR RGK++KEQQQR 
Sbjct: 81  NPFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLKEQQQRS 140

Query: 144 RAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXXXXXXXXXX 203
           +                  ATGHSDIKASKLSQL+KQR +K+                  
Sbjct: 141 KQQEEGKKTRSSTRSTV--ATGHSDIKASKLSQLRKQREKKSQNRPYSDEEEEGEDEGDD 198

Query: 204 XXXKNXXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNKLRIGRS 263
              ++            +P+ R+  +++                    ++DFNK +IGRS
Sbjct: 199 YGYEDKKYSDEEDEEEYDPYSRRSRFEE---DEDEVQWAEEALDREANVADFNKAKIGRS 255

Query: 264 FVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQYF 323
           FVA FCFYPGF D+V+G YGRVNVGTDKR+G+T YRMV+IE++FLQKPYNMGKF TNQYF
Sbjct: 256 FVANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYF 315

Query: 324 GVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVNTP 383
           GVTQGKDRKVFQM YFSDG  T  E++RY  AL+  H+  PS+++L NK KE+  FV+ P
Sbjct: 316 GVTQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQP 375

Query: 384 LTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEK 443
           LT++ T+++VR+RM FNKKLSG NAVLEKTVL+EKLQYA ET NE+DIAKYS+QLR+FEK
Sbjct: 376 LTEQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEK 435

Query: 444 RMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRLKT 503
           RMS YEK HEND+  I  L  LT+KNR++NI  ++NAE VKKEDTS FDSKSDPFSRLKT
Sbjct: 436 RMSTYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTS-FDSKSDPFSRLKT 494

Query: 504 RTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLERMIGELDI 563
           RTK YYQEIQKEEN KAK  A+Q++L+               A+FRRLGGL+++IG +D 
Sbjct: 495 RTKFYYQEIQKEENEKAKNDAEQKQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDF 554

Query: 564 KF 565
           +F
Sbjct: 555 QF 556

>TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa]
           {ON} Anc_3.567 YGL244W
          Length = 549

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/542 (52%), Positives = 353/542 (65%), Gaps = 20/542 (3%)

Query: 23  VLTSTSAKRAKNNDQSISKKRRIEVGSAXXXXXXXXXXXXYNPYSVGNTGYGSXXXXXXX 82
           V+ S+++KR ++N+ S+SKKR I VG              YNP S G    G        
Sbjct: 23  VVISSTSKRGRSNEDSVSKKRHINVGE--------DDEDDYNPASAG---LGDDDDNDDE 71

Query: 83  XXXX-XXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQ 141
                   GKY+DE DR++LESLPEMERETLLFERSQ+MQKY++R LFR R + +K Q++
Sbjct: 72  EEAPFPLEGKYRDERDRDYLESLPEMERETLLFERSQLMQKYKDRMLFRERQRTLKRQRE 131

Query: 142 RKRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXXXXXXXX 201
                                 TGHSD+K+SKLSQLKKQR RKN                
Sbjct: 132 ------SSENRKVRSSTRSSKVTGHSDVKSSKLSQLKKQRERKNNHHYSDEDDEDEYEEE 185

Query: 202 XXXXXKNXXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNKLRIG 261
                              +P+ RK  Y +                    ++DFNK++IG
Sbjct: 186 ENIYEDKYEEGSEYEDESYDPYKRKSTYAE--ESEEEDVKWADDTDRESNVNDFNKIKIG 243

Query: 262 RSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQ 321
           RSFVAK+CFYPGF D+VK CYGRVNVG +K T +  YRMV+IE++FLQKPY+MG FFTNQ
Sbjct: 244 RSFVAKYCFYPGFNDIVKDCYGRVNVGVNKNTNQVMYRMVKIEKVFLQKPYSMGNFFTNQ 303

Query: 322 YFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVN 381
           YFGVTQGKDRKVFQM +FSDG  T DEY+RY +AL+ S++  PS + LSNK KEV +FVN
Sbjct: 304 YFGVTQGKDRKVFQMKFFSDGAITQDEYERYVRALESSNLTIPSTYALSNKFKEVDEFVN 363

Query: 382 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 441
            P+T K TDEVVR+RM FNKKLSGTNAVLEKTVLREKL +AK+ N+E+DIAKYS+QLRN 
Sbjct: 364 EPMTVKLTDEVVRNRMIFNKKLSGTNAVLEKTVLREKLNFAKQNNSERDIAKYSSQLRNL 423

Query: 442 EKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRL 501
           EKR+  YEKHHENDQ   K LG+LTSKNRKLN+  I+  E+VK++   +FD K+DPFSRL
Sbjct: 424 EKRLMTYEKHHENDQQGAKKLGKLTSKNRKLNMDKIKYGENVKEDRDESFDIKTDPFSRL 483

Query: 502 KTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLERMIGEL 561
           KTRTKVYYQEIQ+EEN KAKE+A+Q+K+Q               A+FRRLGGLE ++  L
Sbjct: 484 KTRTKVYYQEIQEEENEKAKELARQKKMQENKEAIEQKERELLLAKFRRLGGLESIVHNL 543

Query: 562 DI 563
           DI
Sbjct: 544 DI 545

>CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244w RTF1
          Length = 566

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/561 (53%), Positives = 366/561 (65%), Gaps = 32/561 (5%)

Query: 23  VLTSTSAKRAKNNDQSISKKRRIEVGSAXXXXXXXXXXXXYNPYSVGNTGY-----GSXX 77
           VLT+T+ KR K +  S  KKRRIEV S             YNP    + GY         
Sbjct: 22  VLTTTN-KRTKGSSNSQVKKRRIEVDSEDEEDD-------YNP----DDGYEPVDVSDKE 69

Query: 78  XXXXXXXXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMK 137
                       GKYKD +DR+HLESLPEMERET+LFERSQ+M+KYQERKLFR RG+++K
Sbjct: 70  EEEEEENPFPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK 129

Query: 138 EQQQRKRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQL-----KKQRARKNXXXXXXX 192
           +Q    +                  ATGHSDIKASKLSQL     +K + R++       
Sbjct: 130 QQ----KIQAGEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESD 185

Query: 193 XXXXXXXXXXXX---XXKNXXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXX-XX 248
                             +            +P+ RK  Y +                  
Sbjct: 186 EDNYGDEDEFKDDFIEEDSDYKENDDDEEGYDPYARKSKYAQDNDEEEDEEVEWAEQLDR 245

Query: 249 XXXISDFNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFL 308
              + DFNK+RIGRSFVAK+CFYPGF ++++GCYGRVNVG DKRTG  +YRMV+IE++FL
Sbjct: 246 DAEVQDFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFL 305

Query: 309 QKPYNMGKFFTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHT 368
           QKPYNMGKFFTNQYFGVTQGKDRKVFQMN+FSDG F + E++RY KALD S++ KPS + 
Sbjct: 306 QKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYN 365

Query: 369 LSNKTKEVIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNE 428
           +  K KE+ +F++ PLT+K TDE+VR+RM  NKKLSGTNAVLEKT+L++KL+YAKE  NE
Sbjct: 366 IKTKFKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNE 425

Query: 429 KDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDT 488
            DIAKYS QLRNFEKRM++YEKHHENDQ+DIK L  LTSKNRKLN++ IRNAE +KKE+ 
Sbjct: 426 HDIAKYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEED 485

Query: 489 SNFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQF 548
            NFDSKSDPFSRLKTRTKVYYQEIQKEEN KAKE A QE+L+               A+F
Sbjct: 486 VNFDSKSDPFSRLKTRTKVYYQEIQKEENEKAKEEAAQEQLKIDEETKKEKEKQLMLAEF 545

Query: 549 RRLGGLERMIGEL--DIKFDF 567
           RRLGGL+++IG +  DIK D 
Sbjct: 546 RRLGGLQKIIGSINVDIKLDI 566

>Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON}
           (57107..58492) [1386 nt, 462 aa]
          Length = 461

 Score =  513 bits (1320), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 260/465 (55%), Positives = 322/465 (69%), Gaps = 8/465 (1%)

Query: 107 MERETLLFERSQIMQKYQERKLFRARGKDMKEQQQRKRAXXXXXXXXXXXXXXXXHATGH 166
           MERETLLFERSQ+MQKYQ+RKLFR R +++K QQ+   +                 ATGH
Sbjct: 1   MERETLLFERSQLMQKYQDRKLFRERQRNLKRQQRNNTSAQEGKKTRTSTRST--QATGH 58

Query: 167 SDIKASKLSQLKKQRA----RKNXXXXXXXXXXXXXXXXXXXXXKNXXXXXXXXXXXXNP 222
           SD+KASKLSQLK+QR     R+                       +            +P
Sbjct: 59  SDVKASKLSQLKRQREKNKNRQYSESEGEYEEEEDEDDYDTGYKYDGSEYEEDDEEEYDP 118

Query: 223 FDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNKLRIGRSFVAKFCFYPGFEDVVKGCY 282
           + RK  Y +                    + DFNK++IGRSFVA++CF+P F ++VKGCY
Sbjct: 119 YSRKPRY-REEEEEEDVKWAEESTNRESQVDDFNKIKIGRSFVARYCFHPDFNEIVKGCY 177

Query: 283 GRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNYFSDG 342
           GRVNVG D+RT +T+YRMV+IE++FLQKPYNMGKFFTNQYFGVTQGKDRKVFQMN+FSDG
Sbjct: 178 GRVNVGVDRRTNQTAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDG 237

Query: 343 LFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVNTPLTDKTTDEVVRHRMQFNKK 402
             T +E+ RY ++LD S+  KPS+++L+ K KE+ +FV+ P+TDK TDE+VR+RM FNKK
Sbjct: 238 PITIEEFDRYQRSLDASNASKPSVYSLTQKLKEINEFVSEPMTDKLTDEIVRNRMVFNKK 297

Query: 403 LSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKTL 462
           LSGTNAVLEKTVLR KLQYAKE NNE+DIAKYS QLRN EKR+S YEKHHENDQ+  + L
Sbjct: 298 LSGTNAVLEKTVLRGKLQYAKENNNERDIAKYSTQLRNLEKRLSTYEKHHENDQAGARKL 357

Query: 463 GELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKE 522
           G LTSKNRK+N+   +N EHVK+ED  NFDSK+DPFSRLKTRTK+YYQE+QKEEN KAKE
Sbjct: 358 GALTSKNRKVNMDKAKNVEHVKEEDI-NFDSKADPFSRLKTRTKIYYQEVQKEENEKAKE 416

Query: 523 MAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLERMIGELDIKFDF 567
           +AQQ+KL+               A+FRRLGGLE +I  +DI+   
Sbjct: 417 LAQQKKLEEDREAIAKKERELLLAKFRRLGGLESIISSIDIELSI 461

>AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL244W (RTF1)
          Length = 562

 Score =  504 bits (1297), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 280/553 (50%), Positives = 356/553 (64%), Gaps = 31/553 (5%)

Query: 27  TSAKRAKNNDQSISKKRRI--------EVGSAXXXXXXXXXXXXYNP---YSVGNTGYGS 75
           TS KR+K+ D S SKKRR+        E                YNP   Y   + G+ +
Sbjct: 27  TSQKRSKH-DSSGSKKRRVMDEESGDDEDNDNDAGDEEDEDEDDYNPGTEYGF-DEGHEA 84

Query: 76  XXXXXXXXXXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKD 135
                         GKY+D++DREH+E++PEMERETLLFERSQ MQKYQERK+ R R K+
Sbjct: 85  SEDEVEEENPYPLLGKYRDDADREHIENMPEMERETLLFERSQEMQKYQERKVLRERAKN 144

Query: 136 MKEQQQRKRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXX 195
           ++ QQQR++                   TGHSD++ SKLS+L+KQRA+K+          
Sbjct: 145 IRAQQQRRQQKDGSALRSSGRST---RTTGHSDLRDSKLSELRKQRAKKSGNYDYSAGED 201

Query: 196 XXXXXXXXXXXKNXXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDF 255
                       N            +P D + +Y                      + DF
Sbjct: 202 DSDHSDDYVDSDNEDDY--------DPHDGRQLY---REEADEVKWAEDDLDRDAELDDF 250

Query: 256 NKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMG 315
           NK+++GRSFVAKFCFYP F   V+GCYGRVN+G DK TG+  YRMV+IE++FLQKPYNMG
Sbjct: 251 NKIKVGRSFVAKFCFYPEFNQRVQGCYGRVNIGVDKHTGQAMYRMVKIEKVFLQKPYNMG 310

Query: 316 KFFTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKE 375
           KFFTNQYFGVTQGKDRKVFQMN+FSDG     EY+RY   +    + KPSL+TL+NK K+
Sbjct: 311 KFFTNQYFGVTQGKDRKVFQMNFFSDGPILQPEYERYLNQIAKHDINKPSLYTLNNKAKD 370

Query: 376 VIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYS 435
           + +FV+ P+T K TD++VR+RMQFNKKL+GTNAVLEKTVLR+KLQYA++TNNEKDIAKYS
Sbjct: 371 LTNFVSQPMTPKLTDQIVRNRMQFNKKLTGTNAVLEKTVLRDKLQYARDTNNEKDIAKYS 430

Query: 436 AQLRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKS 495
           +QL+N EKRMS YEKHHENDQ+ I+ L  LTSKNRK+N+  IR+ E+VKKED++  + K+
Sbjct: 431 SQLKNLEKRMSSYEKHHENDQTGIRKLDALTSKNRKVNLDKIRHVENVKKEDSATLNVKT 490

Query: 496 DPFSRLKTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLE 555
           DPFSRLKTRTK+YYQEIQ+EEN KA+E+A+Q+  Q               A+FRRLGGLE
Sbjct: 491 DPFSRLKTRTKIYYQEIQQEENEKAQELAKQK--QQQDKEEKHDRKQQLLAKFRRLGGLE 548

Query: 556 RMIGELD--IKFD 566
             + +LD  IK D
Sbjct: 549 DALSKLDFRIKLD 561

>KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II- associated Paf1
           complex directly or indirectly regulates DNA-binding
           properties of Spt15p (TATA box-binding protein) and
           relative activities of different TATA elements
          Length = 561

 Score =  500 bits (1288), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 271/542 (50%), Positives = 352/542 (64%), Gaps = 9/542 (1%)

Query: 23  VLTSTSAKRAKNNDQSISKKRRIEVGSAXXXXXXXXXXXXYNPYSVGNTGYGSXXXXXXX 82
           V   +S KR++++ QS SK+R ++                YNP    +    S       
Sbjct: 24  VQIGSSKKRSRSDHQSSSKRRIVDEDEEQDDDEEEGEEDDYNP-EAASYDMDSEEDEDEE 82

Query: 83  XXXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQR 142
                  GKYK+E DR +LESLPEMERET+LFERSQ MQKYQER++ + R K++++QQQ+
Sbjct: 83  PNPFPLEGKYKNEEDRSYLESLPEMERETMLFERSQTMQKYQERRVLKERAKNIRDQQQK 142

Query: 143 KRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXXXXXXXXX 202
           ++                   TGHSD+K S+LS+LKKQRA+K                  
Sbjct: 143 RQLQQEGKKTRSSTRST--RTTGHSDLKESRLSELKKQRAKKKGTYEYSEEEEEEGQNEE 200

Query: 203 XXXXKNXXXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNKLRIGR 262
                              P  +KG   K                    + DFN+++IGR
Sbjct: 201 DEY--GYQDQEDESEDDYEPMYKKG---KTEDEEELKWAEDEDLDREPELGDFNRIKIGR 255

Query: 263 SFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQY 322
           SFVAKFCFYP F D++KGCYGRVNVG DKR+G+T YRMV+IE++FLQKPYNMGKFFTNQY
Sbjct: 256 SFVAKFCFYPEFNDMIKGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYNMGKFFTNQY 315

Query: 323 FGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVNT 382
           FGVTQGK+RKVFQMN+FSDG  T  E++RY ++L+ S + KPSL+ ++NK+ E+  FV+ 
Sbjct: 316 FGVTQGKNRKVFQMNFFSDGAITQPEFERYLRSLETSEINKPSLYIINNKSNEINSFVSQ 375

Query: 383 PLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFE 442
           P+T K TDE+VR+RM FNKKLSGTNAVLEKT+L++KLQYAKE+ +E+D+AKYS+QLRN E
Sbjct: 376 PVTSKLTDELVRNRMIFNKKLSGTNAVLEKTILKDKLQYAKESGSERDVAKYSSQLRNLE 435

Query: 443 KRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRLK 502
           KR+S YEKHHENDQ+  K LG LTSKNR++N+   +N E  KKEDT  FD+K+DPFSRLK
Sbjct: 436 KRLSSYEKHHENDQAGSKKLGALTSKNRRVNLDKGKNVEVTKKEDTP-FDAKTDPFSRLK 494

Query: 503 TRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLERMIGELD 562
           TRTK+YYQEIQ+EEN KAKE+A+QE+LQ               A+F+ LGGLE +I  +D
Sbjct: 495 TRTKIYYQEIQREENEKAKELARQEQLQKDDLNLVEKERKLLLAKFKNLGGLEDIISNMD 554

Query: 563 IK 564
            +
Sbjct: 555 FQ 556

>Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]
           {ON} YGL244W (RTF1) - Nuclear protein [contig 344] FULL
          Length = 567

 Score =  494 bits (1272), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 258/476 (54%), Positives = 329/476 (69%), Gaps = 5/476 (1%)

Query: 90  GKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQRKRAXXXX 149
           GKYKDE DRE+LESLPEMERETLLF+RSQ MQKY+ER++ + R ++++ QQQ+++     
Sbjct: 93  GKYKDERDREYLESLPEMERETLLFDRSQEMQKYRERRVLKERARNIRAQQQKRQLQQES 152

Query: 150 XXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXXXXXXXXXXXXXKNX 209
                         TGHSD+K S+LS+LKKQRA+K+                      + 
Sbjct: 153 TKTRSSTRST--RTTGHSDLKESRLSELKKQRAKKSGTYDYSEDEDDGGRDEEDDYGYDD 210

Query: 210 XXXXXXXXXXXNPFDRKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNKLRIGRSFVAKFC 269
                       P  +K   D+                    +SDFNK++IGRSFVAKFC
Sbjct: 211 QDEEEESEDDYQPGYKKDKIDE--DDEEVKWAEEDDLDRDPELSDFNKVKIGRSFVAKFC 268

Query: 270 FYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQYFGVTQGK 329
           FYP F D+++GCYGRVNVG DKR  +T YRMV+IER+FLQKPYNMGKFFTNQYFGVTQGK
Sbjct: 269 FYPEFNDLIRGCYGRVNVGVDKRNNQTLYRMVKIERVFLQKPYNMGKFFTNQYFGVTQGK 328

Query: 330 DRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVNTPLTDKTT 389
           DRKVFQMN+FSDG  T  E++RY K+LD S +  PSL+TL+NK+ E+  FV+ P+T K T
Sbjct: 329 DRKVFQMNFFSDGAITQPEFERYMKSLDASGINPPSLYTLNNKSNEINGFVSQPVTPKLT 388

Query: 390 DEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVYE 449
           DE+VR+RM FNKKLSGTNAVLEKT+LR+KLQYAKET +E+D+AKYS+QLR+ E+R++ YE
Sbjct: 389 DELVRNRMLFNKKLSGTNAVLEKTILRDKLQYAKETGSERDVAKYSSQLRSLERRLTSYE 448

Query: 450 KHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRLKTRTKVYY 509
           KHHENDQ+  K LG LTS+NR+ N+   +N +  KKEDT  FD+K+DPFSRLKTRTK+YY
Sbjct: 449 KHHENDQAGSKKLGALTSRNRRANMDKGKNVDTTKKEDTP-FDAKTDPFSRLKTRTKIYY 507

Query: 510 QEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLERMIGELDIKF 565
           QEIQKEEN KAKE+A+ E+L+               A+F+ LGGLE ++  +D K 
Sbjct: 508 QEIQKEENEKAKELARIEQLEKGNSDLAEKERKLLLARFKNLGGLEEVVSGIDFKL 563

>Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR266W
          Length = 562

 Score =  494 bits (1271), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 257/481 (53%), Positives = 324/481 (67%), Gaps = 15/481 (3%)

Query: 90  GKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQRKRAXXXX 149
           GKYKDE DR  ++ +PEMERETLLFERSQ MQKYQERK+ R R K ++ QQQ+++     
Sbjct: 96  GKYKDEEDRNRIQDMPEMERETLLFERSQEMQKYQERKVLRQRAKSIRAQQQQRQLQKDS 155

Query: 150 XXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNXXXXXXXXXXXXXXXXXXXXXKNX 209
                         TGHS+++ SKLS+L+KQRA+K+                      + 
Sbjct: 156 TKRSSGRST---RTTGHSELRTSKLSELRKQRAKKSGNYDYSESEEDESDQSDNYAESDN 212

Query: 210 XXXXXXXXXXXNPFD-RKGVYDKRXXXXXXXXXXXXXXXXXXXISDFNKLRIGRSFVAKF 268
                      + +D   G  D                     + DFNK++IGRSFVAKF
Sbjct: 213 -----------DDYDPHHGHKDGFSDHDNEVKWAEEDLDRDAELEDFNKVKIGRSFVAKF 261

Query: 269 CFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQYFGVTQG 328
           CFYP F + V+ CYGRVN+G DK TG   YRMV+IER+FLQKPY+MGKFFTNQYFGVTQG
Sbjct: 262 CFYPDFAERVQACYGRVNIGLDKHTGLPMYRMVKIERVFLQKPYSMGKFFTNQYFGVTQG 321

Query: 329 KDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVNTPLTDKT 388
           KDRKVFQMNYFSDG  T  E++RY   +    M KPSL+TL+NK KE+ +FV+ P+T K 
Sbjct: 322 KDRKVFQMNYFSDGPITQPEFERYLNQMAKYDMNKPSLYTLNNKAKELFNFVSQPMTMKL 381

Query: 389 TDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVY 448
           TD++VR+RM FNKKL+GTNAVLEK+VL++KLQYAK+TNNE  +AKY+AQL+N EKRMS Y
Sbjct: 382 TDQIVRNRMVFNKKLTGTNAVLEKSVLKDKLQYAKDTNNESAVAKYAAQLKNLEKRMSSY 441

Query: 449 EKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRLKTRTKVY 508
           EKHHENDQ+ I+ LG LTSKNRK+N+  IR AE+V+KED+SN D+KSDPFSRLKTRTK+Y
Sbjct: 442 EKHHENDQTGIRKLGALTSKNRKVNMDKIRLAENVRKEDSSNVDAKSDPFSRLKTRTKIY 501

Query: 509 YQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRLGGLERMIGELDIKFDFK 568
           YQEIQ+EEN KA E+A+Q+  +               A+FRRLGGLE ++  +  K +  
Sbjct: 502 YQEIQQEENEKAMELAKQKHQEQDKETQENKERQLLLAKFRRLGGLEEIVSSIPFKIELG 561

Query: 569 F 569
           F
Sbjct: 562 F 562

>NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567
           YGL244W
          Length = 558

 Score =  451 bits (1161), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 208/316 (65%), Positives = 259/316 (81%), Gaps = 1/316 (0%)

Query: 252 ISDFNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKP 311
           + DFNK++IGRSFVAK+CFYPGF +++KGCYG+VNVGTD+RTG TSYRMV+IE+IFLQKP
Sbjct: 242 LDDFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKP 301

Query: 312 YNMGKFFTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSN 371
           Y MG+FFTNQYFGVTQG +RKVFQMN+FSDGLFT DE++RY ++LD SH+ KPS++TL N
Sbjct: 302 YRMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKN 361

Query: 372 KTKEVIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 431
           K KE+  F++ PLT++  D +VR+RM FNKKLSGTNAVLEKTVLR+KL+YA+E NNE+D+
Sbjct: 362 KAKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDV 421

Query: 432 AKYSAQLRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNF 491
           AKYS+QLRN EKR+SVYEKHHENDQ     LG LTSKNRK+N+  I+N  H KKE+   F
Sbjct: 422 AKYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEIG-F 480

Query: 492 DSKSDPFSRLKTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRL 551
           DSKSDPFSRLKTRTK+YYQE+Q+EEN KAK +A +++L+               A+FRRL
Sbjct: 481 DSKSDPFSRLKTRTKIYYQEVQQEENEKAKALAAEKQLKENNEAQARKENELLLAKFRRL 540

Query: 552 GGLERMIGELDIKFDF 567
           GGLE MI  L++  +F
Sbjct: 541 GGLENMINSLNLDVNF 556

 Score =  132 bits (331), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 101/165 (61%), Gaps = 14/165 (8%)

Query: 22  QVLTSTSAKRAKNNDQSISKKRRIEVGSAXXXXXXXXXXXXYNPYSVGNTGYG--SXXXX 79
           QVLT TS KRAKN++ + SK+++IEV S              + Y  GN G G  S    
Sbjct: 22  QVLT-TSNKRAKNHEHASSKRKKIEVDSEAEEE---------DDYDPGNFGAGNISEEEE 71

Query: 80  XXXXXXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQ 139
                     GKYKDE+DRE LESLPEMERETLLFERSQ M+KYQERKLFR R +++KEQ
Sbjct: 72  EMEQNPFPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQ 131

Query: 140 QQRKRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARK 184
           QQR                   HATGHSD+KASKLSQLKKQR RK
Sbjct: 132 QQRNAP--SEEGTKTRTSTRTTHATGHSDLKASKLSQLKKQRERK 174

>SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 574

 Score =  444 bits (1143), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 264/315 (83%), Gaps = 1/315 (0%)

Query: 252 ISDFNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKP 311
           ++DFNK++IGRSFVAKFCFYPGF ++V+  YGRVNVG DK TG+T+YRMV+IE++FLQKP
Sbjct: 258 LADFNKVKIGRSFVAKFCFYPGFNELVQNSYGRVNVGIDKHTGQTAYRMVKIEKVFLQKP 317

Query: 312 YNMGKFFTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSN 371
           YNMGKFFTNQYFGVTQGKDRKVFQMN+FSDG  T  EY+RY K+L+   + KPS++ L+N
Sbjct: 318 YNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGAITQVEYERYLKSLEKYGINKPSVYNLNN 377

Query: 372 KTKEVIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 431
           K+KE+ +FV+ P+T K TD++VR+RM FNKKLSGTNAVLEKTVL+EKLQYAKET+NE+DI
Sbjct: 378 KSKEISEFVSQPMTSKLTDDIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYAKETSNERDI 437

Query: 432 AKYSAQLRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNF 491
           AKYS+QL+N EKR+S YEKHHENDQ+ IK LG LTSKNRKLNI  I++AE V+K+D  NF
Sbjct: 438 AKYSSQLKNLEKRISSYEKHHENDQAGIKKLGVLTSKNRKLNIDRIKHAELVQKDDV-NF 496

Query: 492 DSKSDPFSRLKTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRRL 551
           D+KSDPFSRLKTRTK+YY+E+Q++EN KAKE A+Q++L+               A+FR L
Sbjct: 497 DAKSDPFSRLKTRTKIYYKEVQQQENEKAKEAARQKQLEEDKGTATRKENELLLAKFRSL 556

Query: 552 GGLERMIGELDIKFD 566
           GGLE +IG +D++ +
Sbjct: 557 GGLEEIIGGIDLQIN 571

 Score =  100 bits (248), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (72%), Gaps = 2/96 (2%)

Query: 90  GKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQRKRAXXXX 149
           GKYKDE DR  LESLPEMERE+LLFERSQIMQ+YQER+  + R K++++QQQ+++     
Sbjct: 99  GKYKDEQDRTQLESLPEMERESLLFERSQIMQQYQERRFLKQRAKNIRDQQQKRQQ--QQ 156

Query: 150 XXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKN 185
                        ATGHSD+K SKLS+LKKQRA+K+
Sbjct: 157 EGKQVRSSTRTTRATGHSDVKTSKLSELKKQRAKKS 192

>KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 582

 Score =  411 bits (1056), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 248/315 (78%), Gaps = 2/315 (0%)

Query: 252 ISDFNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKP 311
           + D+NK++IGRSFVAKFCFYP F  +V+GCYGRVN+G DK TG + YRMV+IER+FLQKP
Sbjct: 265 LDDYNKIQIGRSFVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNSMYRMVKIERVFLQKP 324

Query: 312 YNMGKFFTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSN 371
           YNMGKFFTNQYFGVTQGKDRK+FQM+YFSD   T  EY+RY  +L+   + +PS + L+N
Sbjct: 325 YNMGKFFTNQYFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSLEKYDITQPSPYILNN 384

Query: 372 KTKEVIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 431
           K+K V +FV  PLT K  D++VR+RM FNKKLSGTNAV+EK VL+EKLQ++K++ + +  
Sbjct: 385 KSKAVNEFVCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLKEKLQFSKQSGDIESE 444

Query: 432 AKYSAQLRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSN- 490
           +KY+ QL+  EKR+S YEKHHENDQ+DIKTLG LTSKNRKLNI  IR+AE +K+E+  N 
Sbjct: 445 SKYANQLKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDRIRHAETIKREEGVNK 504

Query: 491 FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRR 550
            D+KSDPFSRLKTRTK+YYQEIQ+EEN KA+E A+++ L+               A+FRR
Sbjct: 505 VDAKSDPFSRLKTRTKIYYQEIQQEENEKAREEAKRQ-LEVDQEAEEQKKKELLLAKFRR 563

Query: 551 LGGLERMIGELDIKF 565
           LGGLE +IG LD+K 
Sbjct: 564 LGGLEEIIGSLDLKL 578

 Score =  104 bits (259), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 90  GKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQRKRAXXXX 149
           GKYKDE DRE LE LPEMERE++LFERSQ MQKYQERKL R   K +K+QQQ +R     
Sbjct: 94  GKYKDEKDREKLELLPEMERESILFERSQQMQKYQERKLLRQHAKSIKQQQQLQR----E 149

Query: 150 XXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKN 185
                         TGHSD+K SKLS+LKKQRA+K+
Sbjct: 150 GSKSTRASTRSSRTTGHSDLKQSKLSELKKQRAKKS 185

>TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567
           YGL244W
          Length = 570

 Score =  404 bits (1039), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 191/317 (60%), Positives = 243/317 (76%), Gaps = 4/317 (1%)

Query: 252 ISDFNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQK- 310
           + DFNK++IGRSF  KFCFYP F D+VK CY +VNV  D+   K  YRMV+IE++FL K 
Sbjct: 255 VQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVFLDKR 312

Query: 311 PYNMGKFFTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLS 370
           P++MGKFFTNQ FGVTQG +RKV+ M YFSD   T  E+ RY + L+  H+ +PS++ ++
Sbjct: 313 PHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSVYAIN 372

Query: 371 NKTKEVIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKD 430
           NK KE+  F   PLTDK TD++VR+RM+FNKKLSGTNAVLEKTVLR KLQ+AKET NE+D
Sbjct: 373 NKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETGNERD 432

Query: 431 IAKYSAQLRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSN 490
           + KYSAQLRN EKR+S+YEKHHENDQ+  K LG+LTS+NRKLN+   RN EH KK + + 
Sbjct: 433 VTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEH-KKVELAG 491

Query: 491 FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEMAQQEKLQXXXXXXXXXXXXXXXAQFRR 550
           FD+K+DPFSRLKTRTK+YYQEIQKEEN KA+E+A +++L+               A+F+ 
Sbjct: 492 FDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAEFKC 551

Query: 551 LGGLERMIGELDIKFDF 567
           LGGLE+M+G L+ KFDF
Sbjct: 552 LGGLEKMVGSLNFKFDF 568

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 74/166 (44%), Positives = 89/166 (53%), Gaps = 13/166 (7%)

Query: 23  VLTSTSAKRAKNNDQSISKKRRIEVGSAXXXXXXXXXXXXYNPY---SVGNTGYGSXXXX 79
            L  +S KRA+NND S SK+R+IEV +             YNP        + Y +    
Sbjct: 22  TLMVSSKKRARNNDSS-SKRRKIEVDNEDEEEEDD-----YNPVFNEDNNQSTYNTMDGE 75

Query: 80  XXXXXXXXXXGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQ 139
                     GKYKDE DRE +ES+PEMERETLLFERSQIMQKYQERK+FR R +    +
Sbjct: 76  REEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR----K 131

Query: 140 QQRKRAXXXXXXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKN 185
           Q                     H TG SD K+SKLSQLK+QR R+N
Sbjct: 132 QMSLNNNSNLTGQKTRTSTRVTHTTGLSDAKSSKLSQLKRQRERRN 177

>Skud_14.111 Chr14 complement(211532..213280) [1749 bp, 582 aa] {ON}
           YNL225C (REAL)
          Length = 582

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query: 371 NKTKEVIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKT--VLREKLQYAKETNNE 428
           N T E+ D  N     KT  + +R R   N  L GTN  L K    L EK  + K +N+E
Sbjct: 325 NATSEINDLRNELENKKTEIQTMRER---NNNLLGTNKTLSKQNKALCEK--FDKLSNDE 379

Query: 429 KDIAK-----YSAQLRNFEKRMSVYEKHHENDQSDIK 460
           K+I K        +L +  +R+  +EK  EN ++ +K
Sbjct: 380 KNILKGCNEEIKIKLESLNERLGSWEKSKENYEASLK 416

>Suva_14.117 Chr14 complement(216958..218703) [1746 bp, 581 aa] {ON}
           YNL225C (REAL)
          Length = 581

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 20/109 (18%)

Query: 387 KTTDEVVRHRMQFNKKLSGTNAVLEKT--VLREKLQYAKETNNEKDIAK-----YSAQLR 439
           K+  +V+R R   N  L GTN  L K   VL +K  + K +N+EK++ K       A+L 
Sbjct: 340 KSEIQVIRER---NNNLLGTNKTLSKQNKVLCDK--FEKLSNDEKEMLKGCNEEIKAKLE 394

Query: 440 NFEKRMSVYEKHHENDQSDIK----TLGELTSKNRKLNISNIRNAEHVK 484
           +  +R+  +EK  EN ++ +K    T+GE   K   ++    R   H+K
Sbjct: 395 SLNERLGSWEKSKENYEAALKDKDQTIGEFEKKANSMS----REINHLK 439

>Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON}
           (144394..145599) [1206 nt, 402 aa]
          Length = 401

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 378 DFVNTPLTDKT--TDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYS 435
           + ++  LT++T   DE+V+ R    KK++    + E   LREKL Y  E N  +    Y 
Sbjct: 77  ELISDVLTEQTRQADELVKQRKLLEKKVAELKQMPESGSLREKLAYTFEYNTARKFPAYI 136

Query: 436 AQ 437
            Q
Sbjct: 137 WQ 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,391,498
Number of extensions: 1934746
Number of successful extensions: 9834
Number of sequences better than 10.0: 233
Number of HSP's gapped: 10331
Number of HSP's successfully gapped: 255
Length of query: 569
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 454
Effective length of database: 40,294,809
Effective search space: 18293843286
Effective search space used: 18293843286
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)