Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_7.163.569ON70870835020.0
YGL245W (GUS1)3.569ON70870833640.0
Skud_7.223.569ON70870833510.0
Smik_7.163.569ON70870833420.0
NCAS0E002503.569ON70870831860.0
NDAI0I032503.569ON70970630730.0
KAFR0J028903.569ON70670830650.0
TDEL0D063703.569ON70670629810.0
Kpol_507.83.569ON70770829680.0
KNAG0I002203.569ON70770629640.0
CAGL0C01947g3.569ON70570929380.0
TPHA0A060203.569ON70770829170.0
SAKL0F00748g3.569ON70770828670.0
Kwal_47.192723.569ON70470628570.0
KLLA0A00682g3.569ON70870928450.0
ZYRO0E09570g3.569ON70670428380.0
AFR264W3.569ON70770828250.0
TBLA0E001903.569ON70770827940.0
KLTH0G00682g3.569ON70470627720.0
YOR168W (GLN4)6.51ON8093315695e-62
KNAG0M011006.51ON7993495652e-61
Skud_15.3326.51ON8093315616e-61
Smik_15.3486.51ON8103315591e-60
TDEL0G041906.51ON8093345554e-60
ZYRO0C07018g6.51ON8033345554e-60
CAGL0L04532g6.51ON7953375502e-59
SAKL0E02134g6.51ON8013315475e-59
KAFR0G026106.51ON7943315459e-59
AGR259C6.51ON7983345413e-58
Kwal_56.225596.51ON8003345403e-58
NDAI0K028606.51ON8143315397e-58
Suva_8.2236.51ON8213315381e-57
KLTH0C10340g6.51ON8003315371e-57
TBLA0G004506.51ON8083315362e-57
TPHA0J005506.51ON8083375343e-57
Kpol_1037.386.51ON8083315334e-57
NCAS0F002406.51ON8113345301e-56
KLLA0F20449g6.51ON8043245254e-56
Ecym_31356.51ON8043345255e-56
KNAG0L006207.100ON5172321949e-15
NDAI0A084607.100ON5292681877e-14
NCAS0I005607.100ON5273361761e-12
TPHA0L005907.100ON5582691709e-12
TBLA0E021807.100ON5312761628e-11
YOL033W (MSE1)7.100ON5362201573e-10
Kpol_1044.127.100ON5362281573e-10
Suva_15.1347.100ON5353481502e-09
Ecym_26267.100ON5732221502e-09
CAGL0F01133g7.100ON5321111476e-09
KLLA0F07975g7.100ON5422761466e-09
KAFR0D013207.100ON5142291467e-09
Skud_15.1227.100ON5323191458e-09
TDEL0H035007.100ON5342281451e-08
AEL338C7.100ON533651324e-07
Smik_15.1327.100ON5353441314e-07
KLTH0D02794g7.100ON5462351315e-07
SAKL0B09548g7.100ON5542371298e-07
ZYRO0D05808g7.100ON5332371281e-06
Kwal_26.72027.100ON5672271262e-06
Smik_12.4694.236ON89565830.28
CAGL0M07183g4.359ON585105752.0
TBLA0I028804.236ON892144743.0
NDAI0J017304.136ON154688733.9
Suva_13.198na 1ON38269724.3
Skud_4.6905.519ON85531716.3
Skud_5.2388.160aON17837687.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_7.16
         (708 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1353   0.0  
YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}  GUS1Glutamyl...  1300   0.0  
Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1295   0.0  
Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1291   0.0  
NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569     1231   0.0  
NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {O...  1188   0.0  
KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {...  1185   0.0  
TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa] ...  1152   0.0  
Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON} (51597..53...  1147   0.0  
KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569...  1146   0.0  
CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly...  1136   0.0  
TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa] ...  1128   0.0  
SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...  1108   0.0  
Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]...  1105   0.0  
KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly s...  1100   0.0  
ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {...  1097   0.0  
AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic ho...  1092   0.0  
TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569...  1080   0.0  
KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly s...  1072   0.0  
YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}  GLN4Gluta...   223   5e-62
KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6....   222   2e-61
Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168...   220   6e-61
Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168...   219   1e-60
TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.5...   218   4e-60
ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly...   218   4e-60
CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highl...   216   2e-59
SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {...   215   5e-59
KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.5...   214   9e-59
AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}...   213   3e-58
Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {...   212   3e-58
NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6....   212   7e-58
Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W ...   211   1e-57
KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly...   211   1e-57
TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}...   211   2e-57
TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {...   210   3e-57
Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {O...   209   4e-57
NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}...   208   1e-56
KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} high...   206   4e-56
Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar t...   206   5e-56
KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON...    79   9e-15
NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON} Anc_7...    77   7e-14
NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}...    72   1e-12
TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {...    70   9e-12
TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {O...    67   8e-11
YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}  MSE1Mitoc...    65   3e-10
Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {O...    65   3e-10
Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033...    62   2e-09
Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar...    62   2e-09
CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {...    61   6e-09
KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {...    61   6e-09
KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {O...    61   7e-09
Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033...    60   8e-09
TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.1...    60   1e-08
AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON} Syn...    55   4e-07
Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033...    55   4e-07
KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {...    55   5e-07
SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} simila...    54   8e-07
ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {...    54   1e-06
Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {O...    53   2e-06
Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {...    37   0.28 
CAGL0M07183g Chr13 (724616..726373) [1758 bp, 585 aa] {ON} simil...    33   2.0  
TBLA0I02880 Chr9 complement(680214..682892) [2679 bp, 892 aa] {O...    33   3.0  
NDAI0J01730 Chr10 complement(421402..426042) [4641 bp, 1546 aa] ...    33   3.9  
Suva_13.198 Chr13 (321195..322343) [1149 bp, 382 aa] {ON}  YMR03...    32   4.3  
Skud_4.690 Chr4 (1220089..1222656) [2568 bp, 855 aa] {ON} YDR416...    32   6.3  
Skud_5.238 Chr5 (383121..383657) [537 bp, 178 aa] {ON} YER134C (...    31   7.0  

>Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1353 bits (3502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/708 (93%), Positives = 661/708 (93%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKIT 60
           MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFV             TEDVFNKIT
Sbjct: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVDDKKAPAAKLDDATEDVFNKIT 60

Query: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120
           GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA
Sbjct: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180
           DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240
           KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300

Query: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360
           EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV
Sbjct: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540

Query: 541 KKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEG 600
           KKNPAVG                          TLMDWGNVVITKKNADGSMVAKLHLEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHLEG 600

Query: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660
           DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660

Query: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}
           GUS1Glutamyl-tRNA synthetase (GluRS), forms a complex
           with methionyl-tRNA synthetase (Mes1p) and Arc1p;
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1300 bits (3364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/708 (87%), Positives = 652/708 (92%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKIT 60
           MPSTLTINGKAP VAYAELIAARIVNALAPNSIA++ V             TEDVFNKIT
Sbjct: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIKLVDDKKAPAAKLDDATEDVFNKIT 60

Query: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120
            KFAAIFDNG KE+VAKWV LAQ+ELV+KNF KLSQSLETLD+QLNLRTFILGGLKYSAA
Sbjct: 61  SKFAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180
           DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAH+FL+KSL E+KK+ANVG
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSANVG 180

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRF
Sbjct: 181 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDL+LLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300

Query: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360
           EKMREERMDG+ASARRDRSVEENLRIFTEEMKNGTE GLKNCVRAKIDY+ALNKTLRDPV
Sbjct: 301 EKMREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQYDWMLQALRL
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFARINFVRTLLSKRKLQWMVDK+LVGNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTA+VNPVKIHLEG+EAPQEPKIEMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKPKH 540

Query: 541 KKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEG 600
           KKNPAVG                          TLMDWGNV+ITKKN DGSMVAKL+LEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNLEG 600

Query: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660
           DFKKTKHKLTWLADTKD+VPVDLVDFDHL+TKD+LEEDESFEDFLTP+TEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMK+GDI+QFERKGY+RLDALPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1295 bits (3351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/708 (87%), Positives = 652/708 (92%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKIT 60
           MPSTLT+NGKAP+VAYAELIAARIVNALAPNSIA++FV             TE VFNKIT
Sbjct: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVDDKKAPAAKLDDATEGVFNKIT 60

Query: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120
           GKFAAIFDNG KE+V++W  LA++ELVVKNF KLSQSLETLD+QLN+RTFILGGLKYSAA
Sbjct: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180
           DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAH+FLTKSLQE+KK+ANVG
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240
           KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRF
Sbjct: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDL+LLGIKGD+ITYSSDYFQEM+DYCVQMIKDGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300

Query: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360
           E+MREERMDGIASARR+RSVEENLR+FTEEMKNGTE GLKNCVRAKIDYEALNKTLRDPV
Sbjct: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRN QYDWMLQALRL
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFARINFVRTLLSKRKLQWMVDK+LVGNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTA+VNPVKIHLEG EAPQEPK+EMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540

Query: 541 KKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEG 600
           KKNPAVG                          TLMDWGNV+ITKKN DGSMVAKLHLEG
Sbjct: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600

Query: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660
           DFKKTKHKLTWLADTKD+VPVDLVDFDHL+TKD+LEEDESFEDFLTP+TEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMKVGDI+QFERKGY+RLDALPK+GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708

>Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1291 bits (3342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/708 (87%), Positives = 651/708 (91%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKIT 60
           MPSTLTINGKAP VAYAELIAARIVNALAPNSIA+ FV             TEDVF+KIT
Sbjct: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60

Query: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120
           GKFAAIFDNG KE++AKWV LAQ+ELVVKNF KLSQSLE LD+QLNLRTFILGGLKYSAA
Sbjct: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180
           DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAH+FL+KSLQE+KK+ANVG
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240
           KKKETHKANFEIDLP+AK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRF
Sbjct: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDL+LLGIKGD+ITYSSDYFQEMYDYC+QMIKDGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300

Query: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360
           EKMREERMDGIAS+RRDRSVEENLRIFTEEMKNGTE GLKNCVRAKIDY+ALNKTLRDPV
Sbjct: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQYDWMLQALRL
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFARINFVRTLLSKRKLQWMVDK+LVGNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKK+IDPIAPRHTA+VNPVKIHLEG+EAPQEPK E KPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKPKH 540

Query: 541 KKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEG 600
           KKNPAVG                          TLMDWGNV+ITKKN DGSM+AKL+LEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600

Query: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660
           DFKKTKHKLTWLADTKD+VPVDLVDFDHL+TKD+LEEDESFEDFLTP+TEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMK+GDI+QFERKGY+RLDALPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569
          Length = 708

 Score = 1231 bits (3186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/708 (82%), Positives = 626/708 (88%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKIT 60
           M +TL INGKAP VAYAELIAARIVN   PNSI++EFV              +D F KI 
Sbjct: 1   MSATLVINGKAPVVAYAELIAARIVNETKPNSISIEFVDDKKAAPATFNGDNKDAFLKIV 60

Query: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120
            +F+ +F N K+E++ +WVK+A EELV+KNF KLS+SL  LD  LNLRTFILGGLKYSAA
Sbjct: 61  AQFSDVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180
           D+ACWGALRSNGMCGSIIKNKV+VNVSRWYTLLEMDPIFG  HEFLTKSLQE+KK AN G
Sbjct: 121 DIACWGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTANAG 180

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGK+IIRF
Sbjct: 181 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDLELLGIKGDRIT+SSDYFQEMYDYC+QMIK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDTPT 300

Query: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360
           EKMREERMDGIASARRDRSVEENL+IFTEEMKNGTE GLKNCVRAKIDY+ALNKTLRDPV
Sbjct: 301 EKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHHRTG+TWK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WMLQAL L
Sbjct: 361 IYRCNLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQALNL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDP+APRHTA+VNPVKIHLEG + PQ PKIEMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKPKH 540

Query: 541 KKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEG 600
           KKNPAVG                          T+MDWGNV+IT+KNADGS+V KLHLEG
Sbjct: 541 KKNPAVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHLEG 600

Query: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660
           DFKKTKHKLTWLADT D+VPVDLVDFDHL+TKDKLEEDESFEDFLTP TEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIADLN 660

Query: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMKVGDI+QFERKGY+RLDALPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {ON}
           Anc_3.569 YGL245W
          Length = 709

 Score = 1188 bits (3073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/706 (80%), Positives = 610/706 (86%)

Query: 3   STLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKITGK 62
           +TL INGKAP VAY +LIAARI+N   P SI ++FV             ++  F KI   
Sbjct: 4   NTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEG 63

Query: 63  FAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAADV 122
           F  IF    K+ VA+W K+A EELVVKNF KLS+SL  LD QLNLRTFILGGLKYSAAD+
Sbjct: 64  FPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADI 123

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVGKK 182
           ACWGALRSNGMCGSI+KNKVDVNVSRWY+LLEMDP FG  HE LTKSLQE+KK +N GKK
Sbjct: 124 ACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKK 183

Query: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDD 242
           KETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGK+IIRFDD
Sbjct: 184 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDD 243

Query: 243 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302
           TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQ+MY+ CV+MIK+GKAYCDDTPTEK
Sbjct: 244 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEK 303

Query: 303 MREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIY 362
           MREERMDGIASARRDRSVEENLRIF EEMKNGTE GLKNCVRAKIDY+ALNKTLRDPVIY
Sbjct: 304 MREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 363

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
           RCNLTPHHRTG+TWK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQYDWML A+ LRK
Sbjct: 364 RCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRK 423

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 483

Query: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKHKK 542
           QGPSRNVINLEWNLIWAFNKKVIDP+A RHTA+V+PVKIHLEG + PQ PK EMKPKHKK
Sbjct: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKK 543

Query: 543 NPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEGDF 602
           NPAVG                          T+MDWGNV+ITKKNADGSMV KLHL+GDF
Sbjct: 544 NPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDF 603

Query: 603 KKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLNVK 662
           KKTKHKLTWLADT+D+VPVDLVDFDHL++KDKLEEDESFEDFLTP TEFHT AIADLNVK
Sbjct: 604 KKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVK 663

Query: 663 DMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           DMKVGDI+QFERKGY+RLDA+ KDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 664 DMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709

>KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {ON}
           Anc_3.569 YGL245W
          Length = 706

 Score = 1185 bits (3065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/708 (79%), Positives = 609/708 (86%), Gaps = 2/708 (0%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKIT 60
           M +TL INGKAP VAY  LIAAR+VNA  P++I +EFV             +E  FNKI 
Sbjct: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60

Query: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120
             F   F N      ++W+ +A EE +VKNF KL+QSLE LD  LNLRTFI GGL+YSAA
Sbjct: 61  AAFPDAFRNANV--ASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAA 118

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180
           D+A WGALRSNGM GSIIKNKV VNVSRWY+LLEMDP+FG  HEFLTKSLQE+KKNA+ G
Sbjct: 119 DIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAG 178

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRF
Sbjct: 179 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 238

Query: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEK EFQDSILEDLELLGIKGDR+TYSSDYFQEMYD CVQ+IK+G AYCDDTPT
Sbjct: 239 DDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPT 298

Query: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360
           EKMREERMDGIASARRDR+VEENLRIFTEEMKNGTE GLKNCVRAKIDY ALNKTLRDPV
Sbjct: 299 EKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 358

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHHRTG+TWK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WML AL L
Sbjct: 359 IYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHL 418

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFV
Sbjct: 419 RKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 478

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540
           LSQGPSRNVINLEWN+IWAFNKKVIDP+APRHTAVVNPVKIHL G +AP+ PKIEMKPKH
Sbjct: 479 LSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKH 538

Query: 541 KKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEG 600
           KKNPAVG                          TLMDWGN++ITKKNADGSM AK+HLEG
Sbjct: 539 KKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEG 598

Query: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660
           DFKKT HKLTWLADT+D+VPVDLVDFDHL++KDKLEEDESFEDFLTPETEFHT AIADLN
Sbjct: 599 DFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 658

Query: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VK+MKVGD++QFERKGYFRLD+LPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 659 VKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706

>TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa]
           {ON} Anc_3.569 YGL245W
          Length = 706

 Score = 1152 bits (2981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/706 (78%), Positives = 602/706 (85%), Gaps = 1/706 (0%)

Query: 3   STLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKITGK 62
           + L INGKAP VAYAELIAAR+VN + P SI VEFV             +E VF KI   
Sbjct: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61

Query: 63  FAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAADV 122
           F  IF  G  EE+A WVK A  + V+KNF KLS SLE LD  LNLRT+ILGGLKYSAAD+
Sbjct: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVGKK 182
           ACWGALRSNGM GSIIKNKVDVNVSRWYTLLE D  FG AHEFLTKS+Q++KK +NVGKK
Sbjct: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181

Query: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDD 242
           KE HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGK+IIRFDD
Sbjct: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241

Query: 243 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302
           TNPSKEKEEFQDSI+EDL+LLGI+GDR+T+SSDYFQEMYD CV+MIK+GKAYCDDT TEK
Sbjct: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301

Query: 303 MREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIY 362
           MREERMDGIASARRDR VEENLRIFT+EMKNGTE GLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
           RCNLTPHHRTG+T K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQYDWML A+ LRK
Sbjct: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKHKK 542
           QGPSRNVINLEWNLIWAFNKKVIDP+APR TAVVNPVK+HL+G +APQ PK EMKPKHKK
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540

Query: 543 NPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEGDF 602
           NP VG                          TLMDWGNV+ITKKNADGS+  KL+L+GDF
Sbjct: 541 NPDVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600

Query: 603 KKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLNVK 662
           KKTKHKLTWLADT+D+ PVDLVDFDHL++KDKLEEDESFEDFLTPETEFHT AIADLNVK
Sbjct: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660

Query: 663 DMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           D+KVGDI+QFERKGY+RLDAL KDGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706

>Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON}
           (51597..53720) [2124 nt, 708 aa]
          Length = 707

 Score = 1147 bits (2968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/708 (77%), Positives = 602/708 (85%), Gaps = 1/708 (0%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKIT 60
           M +TL I GKAP VAYAELIAARIVN+  P+SI +EFV             + DV +KI 
Sbjct: 1   MSATLVIGGKAPVVAYAELIAARIVNSSKPDSIKIEFVEDKKASPATLNGDSVDVLSKIV 60

Query: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120
              + +F  G      +W+K+A EELVVKNF +L++SLE LD  LNLRT+I GGL ++ A
Sbjct: 61  TANSDVFPEGAANS-TEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFTVA 119

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180
           D+ACWGALRSNGM GSIIKNKV+VNVSRWYTLLE + +FG  HEFLTKSLQE+KK +  G
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKASTAG 179

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRF
Sbjct: 180 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKE  EFQDSILEDLELLGIKGDRIT+SSDYFQEMYDYCVQ+IKDGKAYCDDTPT
Sbjct: 240 DDTNPSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDTPT 299

Query: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360
           EKMR+ERM+GIAS RRDRSVEENL+IFTEEMKNGTE GLKNCVRAKIDYEALNKTLRDPV
Sbjct: 300 EKMRDERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 359

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           I+RCNLTPHHRTGS WK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WML AL+L
Sbjct: 360 IFRCNLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK LV NW+DPRFPT        MTVEGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRNFV 479

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540
           LSQGPSRNVINLEWNLIW+FNKKVIDP+ PR TAVV+PVKIHLEG +APQ  K+EMKPKH
Sbjct: 480 LSQGPSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKPKH 539

Query: 541 KKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEG 600
            KNP VG                          TLM+WGN +ITKKNADGS+ AKLHLEG
Sbjct: 540 PKNPVVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHLEG 599

Query: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660
           DFKKTKHK+TWLADT+D+V VDLVDFDHL++KDKLEEDESFEDFLTPETEFHT AIADLN
Sbjct: 600 DFKKTKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 659

Query: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMKVGDI+QFERKGY+RLD+L  DGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 660 VKDMKVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK 707

>KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1146 bits (2964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/706 (77%), Positives = 597/706 (84%), Gaps = 2/706 (0%)

Query: 3   STLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKITGK 62
           +TL INGKAP VAY  LIAARI N+   +S+A+EFV             +EDV +KI  +
Sbjct: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63

Query: 63  FAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAADV 122
           F  +F   +  +VA WVK A +E VVKNF KL++SL  LD  LNLRTF+LGGLKYS AD+
Sbjct: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVGKK 182
           ACWGALRSNGM GSIIKNKV VNVSRWYTL EM P F  AHEFLTKS+QE+KK +  GKK
Sbjct: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183

Query: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDD 242
           KE+HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRFDD
Sbjct: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243

Query: 243 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302
           TNPSKEKEEFQDSILEDL LLGIKGDR+TYSSDYFQ+MYD C+Q+IK+G AYCDDTPTEK
Sbjct: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303

Query: 303 MREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIY 362
           MREERMDGIASARRDRSVEENL+IFTEEMKNGTE GLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
           RCNLTPHHRTG TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QYDWML AL LRK
Sbjct: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRNFVLS 483

Query: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKHKK 542
           QGPSRNVINLEWNLIWAFNKKVIDP+APRHTAVV+PVK+H+EG  AP+ PK EMKPKHKK
Sbjct: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHKK 541

Query: 543 NPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEGDF 602
           NPAVG                          TLMDWGNV+ITK++ DGS+  KLHLEGDF
Sbjct: 542 NPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDF 601

Query: 603 KKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLNVK 662
           KKTKHKLTWLADT+D+VPVDLVDFDHL+ KD+LEE ESFEDFLTP+TEF T AIADLNVK
Sbjct: 602 KKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVK 661

Query: 663 DMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
            MKVGDI+QFERKGY+RLD+LPKDGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 662 HMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707

>CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245w
          Length = 705

 Score = 1136 bits (2938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/709 (78%), Positives = 602/709 (84%), Gaps = 5/709 (0%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVN-ALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKI 59
           M STL INGKAP VAYAELIAAR+VN + +  S+ VEFV             +++    I
Sbjct: 1   MSSTLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEAI 60

Query: 60  TGKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSA 119
             KF  I   G  EE   W+KLA EELV+KNF KL+QSLE LD QLN RT+I GGLK+ +
Sbjct: 61  VAKFPEIL--GANEESKPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFDS 118

Query: 120 ADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANV 179
           AD+ACWGALRSNGM GSIIKNKV VNVSRWY LLE +P FG++HEFLTKSLQE+KK AN 
Sbjct: 119 ADIACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAANA 178

Query: 180 GKKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIR 239
           GKKKE+HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIR
Sbjct: 179 GKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 238

Query: 240 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTP 299
           FDDTNPSKEK EFQDSILEDLELLGIKGDRITYSSDYFQEMY+ CV++IK+GKAYCDDTP
Sbjct: 239 FDDTNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDTP 298

Query: 300 TEKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDP 359
           TEKMREERMDGIASARR+RSVEENL+IFTE+MKNGTE GLKNCVRAKIDY ALNKTLRDP
Sbjct: 299 TEKMREERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRDP 358

Query: 360 VIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALR 419
           VIYRCNLTPHHRTGS WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQYDW L  L 
Sbjct: 359 VIYRCNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNLN 418

Query: 420 LRKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNF 479
           LRKVHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNF
Sbjct: 419 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNF 478

Query: 480 VLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPK 539
           VLSQGPSRNVINLEWNLIWAFNKKVIDP+APRHTA+VNPVKIH+EG  AP+ PK EMKPK
Sbjct: 479 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHIEG--APESPKTEMKPK 536

Query: 540 HKKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLE 599
           HKKNPAVG                          TLMDWGN++ITKKNADGSM AKLHLE
Sbjct: 537 HKKNPAVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHLE 596

Query: 600 GDFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADL 659
           GDFKKTKHKLTWLADT D V VDLVDFDHL++KDKLEEDESFEDFLTP+TEFHT+AIADL
Sbjct: 597 GDFKKTKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIADL 656

Query: 660 NVKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           NVKDM VGDI+QFERKGY+RLDA  KDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 657 NVKDMIVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK 705

>TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa]
           {ON} Anc_3.569 YGL245W
          Length = 707

 Score = 1128 bits (2917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/708 (76%), Positives = 604/708 (85%), Gaps = 1/708 (0%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKIT 60
           MP+TL I GK+  VAY+ELIAARIVN++ P+SI +EFV             T+DV +KI 
Sbjct: 1   MPATLIIGGKSSVVAYSELIAARIVNSVKPDSITIEFVEDKKAAAASLNGETDDVLSKIV 60

Query: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120
              A +F  G      +WVKLA  ELV+KNF KL+ SL+ LD  LNLRTFI GGL YS A
Sbjct: 61  SANADVFPEGVTGS-EEWVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYSIA 119

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180
           D+ACWGALRSNGM GSIIKNKV+VNVSRWYTL E +PIFGEA+EFLTKSLQE+KK ++ G
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASSAG 179

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFA AYKGK+IIRF
Sbjct: 180 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLIIRF 239

Query: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEK EFQ+SILEDL LLGIKGDRIT+SSDYFQEMYDYC+Q+IK+GKAYCDDTP 
Sbjct: 240 DDTNPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDTPV 299

Query: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360
           +KMREERMDGIASARR+RSVEENL+IFTEEM+NGTE GL+NCVRAKIDYEALNKTLRDPV
Sbjct: 300 DKMREERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRDPV 359

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNL PHHRTG+ WK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQY+WML A+ L
Sbjct: 360 IYRCNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAMNL 419

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDKELV NWDDPRFPT        MT+EGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540
           +SQGPSRNVINLEWNLIWAFNKKVIDP+APR T V+NP+KIHL GA+AP+ P++EMKPKH
Sbjct: 480 ISQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKPKH 539

Query: 541 KKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEG 600
            KNPAVG                          TLM+WGN +I KKNADGS+ A LHLEG
Sbjct: 540 PKNPAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHLEG 599

Query: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660
           DFKKTKHK+TWLA+T+D+  VDLVDFDHL+TKDKLEEDESFE+FLTP TEFHTDAIAD+N
Sbjct: 600 DFKKTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIADVN 659

Query: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMKVGDI+QFERKGY+RLDALPKDGKPY+FFTIPDGK+VNKYGAKK
Sbjct: 660 VKDMKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK 707

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 1108 bits (2867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/708 (76%), Positives = 593/708 (83%), Gaps = 1/708 (0%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKIT 60
           M + L INGKAP VAYAELIAARIVNA   ++I +EFV              +  F+KI 
Sbjct: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60

Query: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120
             +  +F  G +   ++W KLA EE ++KNF KLS SL  LD++LNLRT+IL     + A
Sbjct: 61  NAYQDVFSEGVQGS-SEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPA 119

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180
           D+ACWGALRSNGM GSIIKNKV VNVSRWYT+LE+DP+F  AHEFLTKSLQE+KK +N  
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSN 179

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240
           KKKETHKANFEI LPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRF
Sbjct: 180 KKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEK EFQDSILEDL+LLGIKGD+ITYSSDYF+EMY  CVQ+IK+GKAYCDDTPT
Sbjct: 240 DDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPT 299

Query: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360
           EKMREERMDGIASARRDRSVEENLRIF EEMKNGTE GLKNCVRAKIDY+ALNK LRDPV
Sbjct: 300 EKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPV 359

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           I+RCNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WML AL L
Sbjct: 360 IFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHL 419

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK  V NWDDPRFPT        MTVEGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 479

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDP+APRHTAVV PVK+HLEG + PQ PKIEMK KH
Sbjct: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKH 539

Query: 541 KKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEG 600
           KKNP VG                          TLMDWGNV+ITKKN+DGS+V KLHLEG
Sbjct: 540 KKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEG 599

Query: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660
           DFKKTK KLTWLADT+D V VDLVDFDHL++KDKLEE ++FEDFLTPETEFHT AIADLN
Sbjct: 600 DFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLN 659

Query: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMKVGD++QFERKGY+RLD+L KDGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 660 VKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707

>Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]
           {ON} YGL245W - Protein required for cell viability
           [contig 344] FULL
          Length = 704

 Score = 1105 bits (2857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/706 (75%), Positives = 583/706 (82%), Gaps = 3/706 (0%)

Query: 3   STLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKITGK 62
           + LT+  KAP VAY+ELIAAR+ NA+ P +I ++FV             + DV   I   
Sbjct: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61

Query: 63  FAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAADV 122
           F   F  G  +   KW + A EELVVKNF KLS SL+ LD QLNLRTF+LGG  YS AD+
Sbjct: 62  FPEAFKGGF-DGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVGKK 182
           ACWG+LRSNGM GSIIKN+V VNVSRWYTLLE  P FG AHEFLTK++QE+KK +   KK
Sbjct: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180

Query: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDD 242
           KETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGK+IIRFDD
Sbjct: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240

Query: 243 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302
           TNPSKEKEEFQDSILEDLELLGIKGDR+TYSSDYFQEMY+ CV+MI++GKAYCDDT TE+
Sbjct: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300

Query: 303 MREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIY 362
           MREERMDGIASARRDRSVEENLRIFT EMKNGTE GLKNCVRAKIDYEA NKTLRDPVIY
Sbjct: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
           RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWML AL LRK
Sbjct: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKHKK 542
           QGPSRNVINLEWNLIWAFNKKVIDP+APRHTAVVNPVK H++G  APQ P ++MK KHKK
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKK 538

Query: 543 NPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEGDF 602
           NPAVG                          TLMDWGNV++TKKNADGS+  KLHLEGDF
Sbjct: 539 NPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDF 598

Query: 603 KKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLNVK 662
           KKTK K+TWLADT D V VDLVDFDHL++KDKLEE E F DFLTP+TEFH  AIADLNVK
Sbjct: 599 KKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVK 658

Query: 663 DMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           DMK GDI+QFERKGY+RLDA+    KPYVFF+IPDGKSVNKYGAKK
Sbjct: 659 DMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704

>KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1100 bits (2845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/709 (74%), Positives = 586/709 (82%), Gaps = 2/709 (0%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVNAL-APNSIAVEFVXXXXXXXXXXXXXTEDVFNKI 59
           M ++L I  KAP +AY ELIAAR VNA    N+I + FV             TEDV  K+
Sbjct: 1   MSASLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTKL 60

Query: 60  TGKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSA 119
           +  +  I  N   +  A+W++   ++LV+KNF +L++SL  L+  LNLRT+IL  L+ S 
Sbjct: 61  SAAYPDIL-NDNSDSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPSL 119

Query: 120 ADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANV 179
           AD+A WG LRSNGM GSIIKNKV +NVSRWY+  E+ P FG+AHEFLTKSLQE+KK +NV
Sbjct: 120 ADIAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASNV 179

Query: 180 GKKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIR 239
            KKKETHKANFEI LPDAKVG+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIR
Sbjct: 180 NKKKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 239

Query: 240 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTP 299
           FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIK+GKAYCDDTP
Sbjct: 240 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDTP 299

Query: 300 TEKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDP 359
           TE+MREER +GI S+RR+R+VEENL+IFTEEMKNGTE GLKNCVRAKIDYEALNK +RDP
Sbjct: 300 TERMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRDP 359

Query: 360 VIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALR 419
           VIYRCNLTPHHRTG+ WKIYPTYDFCVPIVD+LEGVTHALRTIEYRDRN QYDWML AL 
Sbjct: 360 VIYRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNALH 419

Query: 420 LRKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNF 479
           LRKVHIWDFAR+NFVRTLLSKRKLQW+VDK++V NWDDPRFPT        MT+EGLRNF
Sbjct: 420 LRKVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRNF 479

Query: 480 VLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPK 539
           VLSQGPSRNVINLEWNLIW+FNKKVIDP+APRHTA+V+PVK+HLEG + PQ P +EMK K
Sbjct: 480 VLSQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKLK 539

Query: 540 HKKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLE 599
           HKKNPA+G                          TLMDWGN +ITKKN DGS  AKLHLE
Sbjct: 540 HKKNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHLE 599

Query: 600 GDFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADL 659
           GDFK TK KLTWLADT D V  DLVDFDHL++KDKLEE E+FEDFLTP+TEFHT A ADL
Sbjct: 600 GDFKTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYADL 659

Query: 660 NVKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           NVKDMKVGDI+QFERKGYFRLD+LPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 660 NVKDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 708

>ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {ON}
           highly similar to uniprot|P46655 Saccharomyces
           cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
           forms a complex with methionyl-tRNA synthetase (Mes1p)
           and Arc1p complex formation increases the catalytic
           efficiency of both tRNA synthetases and ensures their
           correct localization to the cytoplasm
          Length = 706

 Score = 1097 bits (2838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/704 (74%), Positives = 589/704 (83%), Gaps = 1/704 (0%)

Query: 5   LTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKITGKFA 64
           L INGKAP VAYAELIA+RIVNA   ++I VEFV             ++D F KI   + 
Sbjct: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63

Query: 65  AIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAADVAC 124
            +F +   EEVA W+K+A+E+LVVKNF +LSQSLE LD  LNLRTFILGGLK SAAD+ C
Sbjct: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123

Query: 125 WGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVGKKKE 184
           WGALRSNGM GSIIKNKV VNVSRWYTLLE++P FG AHE+LTKS+Q +KK    GKKKE
Sbjct: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183

Query: 185 THKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTN 244
            HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGK+IIRFDDTN
Sbjct: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243

Query: 245 PSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMR 304
           PSKE+ EFQD+ILEDLEL+GIKGD+ITYSSDYFQEMYD CVQ+IK+GKAYCDDT  EKMR
Sbjct: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303

Query: 305 EERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRC 364
           EERM+GI SA+RD SVEENLRIFTEEMKNGTE G KNCVRAKIDY+A NKTLRDPVIYRC
Sbjct: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363

Query: 365 NLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVH 424
           NLTPHHRT   WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQYDWML+ALRLRKVH
Sbjct: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423

Query: 425 IWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQG 484
           IWDFAR+NF+RTLLSKRKLQWMVD  LV NWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVISQG 483

Query: 485 PSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKHKKNP 544
           PS+NVINLEWNLIWA NKK+IDP+APRHTAVV+PV+I LEG  AP+ PK+E+KPKHKKNP
Sbjct: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543

Query: 545 AVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEGDFKK 604
           AVG                          TLMDWGN++IT KNADGS+VAK +L GDFKK
Sbjct: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603

Query: 605 TKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLNVKDM 664
           TKHK+TWLA+T D VPV++VDFDHL+TKDKLEEDE+F DF+TP+TEFHT A+ D+NVKDM
Sbjct: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662

Query: 665 KVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           KVGDI+QFERKGY RLD+  +  KPY+FFTIPDGKSVN+YGAKK
Sbjct: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706

>AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL245W (GUS1)
          Length = 707

 Score = 1092 bits (2825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/708 (73%), Positives = 583/708 (82%), Gaps = 1/708 (0%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKIT 60
           M STL I  K+PAVAYAELIAAR VN    +++A++F              +++   ++ 
Sbjct: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60

Query: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120
            K+  +      EE A W+  A+ +LVVK+F KLS SLE LD  LNLRTF+LGG++ + A
Sbjct: 61  EKYPDVL-GSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVA 119

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180
           DVA WGALRSNG  GSIIKNKV VNVSRWYT LE+ P FG AHEFL KSL+E+K   NV 
Sbjct: 120 DVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVN 179

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRF
Sbjct: 180 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKE+ EFQDSILEDLELLGIKGDRIT+SSDYFQEMYDYCVQMIK+GKAYCDDTPT
Sbjct: 240 DDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPT 299

Query: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360
           E+MREERM+GIASARR+RSVEENL+IFTEEMKNGTE GLKNCVRAK DY ALNKTL+DPV
Sbjct: 300 ERMREERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPV 359

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           +YRCNLTPHHRTG+ WKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WML AL+L
Sbjct: 360 LYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQW+VDK++V NWDDPRFPT        MT+EGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHT V NPVK+HL GA+ PQ P  EMKPKH
Sbjct: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKH 539

Query: 541 KKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEG 600
           KKNPAVG                          TLMDWGN +I  KN DGS+ A L+LEG
Sbjct: 540 KKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEG 599

Query: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660
           DFKKTK KLTWLADT D VPVDLVDFDHL++KD+LEE+++FEDFLTPETEFHT AIADLN
Sbjct: 600 DFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLN 659

Query: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMKVGD++QFER GY+RLD +    KP+VFFTIPDGK+VNKYGAKK
Sbjct: 660 VKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707

>TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1080 bits (2794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/708 (75%), Positives = 598/708 (84%), Gaps = 1/708 (0%)

Query: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKIT 60
           M + L ++GKA AVAY ELIAARIVN  + N++ + FV             ++DV  KI 
Sbjct: 1   MSTKLILSGKAQAVAYGELIAARIVNNSSANAVDISFVEDKKAAPATLDGSSDDVLAKIV 60

Query: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120
               + F +  KE+VA W KLAQE+LVVKNF +L+Q+LE LD QLNLR+F+LGGL +SAA
Sbjct: 61  ALSPSSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180
           DVA WGALRSNGM GSIIKNKV VNVSRWY+ LE++P FGE+HEFLTKSLQE+KK AN G
Sbjct: 121 DVAVWGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAANAG 180

Query: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240
           KKKE+HKANFEIDL DAK+G+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGK+IIRF
Sbjct: 181 KKKESHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEF++SI+EDL LLGIKGDR+T+SSDYFQEMYDYC+QMIK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDTPT 300

Query: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360
           EKMREERM+G  SARR+RSVEENL+IFTE+M NGTE GLKNCVRAKIDY+ALNKTLRDPV
Sbjct: 301 EKMREERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHH TG  WK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQY+WML AL+L
Sbjct: 361 IYRCNLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDALKL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           R VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        M++EGLRNFV
Sbjct: 421 RHVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540
           LSQGPSRNVINLEWNLIWAFNKKVIDP APRHTAVVNP K+HLEG+E PQ  KIEMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKPKH 540

Query: 541 KKNPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEG 600
           KKNP VG                          TLMDWGN +ITKK+A+ S+ AKLHLEG
Sbjct: 541 KKNPDVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIITKKDAN-SITAKLHLEG 599

Query: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660
           DFKKTKHK+TWLADTKD+V VDLVDFDHLL KD++EE ESFEDFLT +TEFHT AIADLN
Sbjct: 600 DFKKTKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIADLN 659

Query: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMK+GD +QFERKGY+RLD+LPK+G PYVFFTIPDGK+VNKYGAKK
Sbjct: 660 VKDMKIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK 707

>KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 704

 Score = 1072 bits (2772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/706 (75%), Positives = 578/706 (81%), Gaps = 3/706 (0%)

Query: 3   STLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVXXXXXXXXXXXXXTEDVFNKITGK 62
           + L I  KAP VAY+ELIAAR+VN+   ++I +EFV              +DV  +I   
Sbjct: 2   AKLIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSPATFEDSCDDVLKRIVQT 61

Query: 63  FAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAADV 122
           +  +F +G  E   +W KLA EEL VKNF KLS SL  LD  LN RTFILGG  +SAAD+
Sbjct: 62  YPEVFKHGF-ENCDEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFSAADI 120

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVGKK 182
           ACWG+LRSNGM GSIIKNKV VNVSRWYTLLE  P FG AHEFL K+LQE+KK +   KK
Sbjct: 121 ACWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKASTSNKK 180

Query: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDD 242
           KETHKANFEIDL DAKVG+VVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGK+IIRFDD
Sbjct: 181 KETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240

Query: 243 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302
           TNPSKEKEEFQDSILEDLELLGIKGDR+TYSSDYFQEMYD CV+MI++G AYCDDTPT+K
Sbjct: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDTPTDK 300

Query: 303 MREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIY 362
           MREERMDG+ASARRDRSVEENLRIFT+EMKNGTE GLKNCVRAKIDY+ALNKTLRDPVIY
Sbjct: 301 MREERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 360

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
           RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY WML AL LRK
Sbjct: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDALHLRK 420

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKHKK 542
           QGPSRNVINLEWNLIWAFNKKVIDP+APRHTA+V PVK H+EG  APQ P +++K KHKK
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHVEG--APQTPDVQIKLKHKK 538

Query: 543 NPAVGXXXXXXXXXXXXXXXXXXXXXXXXXXTLMDWGNVVITKKNADGSMVAKLHLEGDF 602
           NPAVG                          TLMDWGN ++TKKNADGS+  KLHLEGDF
Sbjct: 539 NPAVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHLEGDF 598

Query: 603 KKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLNVK 662
           KKTK KLTWLADT D V VDLVDFDHL+TKDKLEE E F D+LTP+TEFH  A+ADLNVK
Sbjct: 599 KKTKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVADLNVK 658

Query: 663 DMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           DMK GDI+QFERKGY+RLD+     KPYVFF IPDGKSVNKYGAKK
Sbjct: 659 DMKKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK 704

>YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}
           GLN4Glutamine tRNA synthetase, monomeric class I tRNA
           synthetase that catalyzes the specific glutaminylation
           of tRNA(Glu); N-terminal domain proposed to be involved
           in enzyme-tRNA interactions
          Length = 809

 Score =  223 bits (569), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 191/331 (57%), Gaps = 10/331 (3%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 260 LELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDGI----- 311
           +  LG K  +ITYSSDYF E+Y     +IK+GKAY   C     ++ R  + DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 369

Query: 312 -ASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   RD+S+E+NL+ F  +M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 370 YACKHRDQSIEQNLQEF-RDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAYRVLNAPHP 428

Query: 371 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG+ W+IYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 429 RTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 431 INFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +VD++ V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           N++     +  +K ++   PR   V++PV++
Sbjct: 549 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEV 579

>KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6.51
           YOR168W
          Length = 799

 Score =  222 bits (565), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 122/349 (34%), Positives = 195/349 (55%), Gaps = 10/349 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATAGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 305

Query: 257 LEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREER---MDG--- 310
              +  LG +  +ITYSSDYF ++Y+    +IK+GK Y      E++R  R    DG   
Sbjct: 306 KRMVSWLGFEPWKITYSSDYFDKLYELAKVLIKNGKGYICHCTAEEIRRGRGIKEDGQPG 365

Query: 311 ---IASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
                   R+ S+E+NL  F E MK G     +  +R K D+ + +  + D + YR    
Sbjct: 366 GERFGCKHRENSIEKNLEEF-ENMKEGKYQPGEATLRMKQDFSSPSPQMWDLIAYRVLNA 424

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWD 427
           PH RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    +
Sbjct: 425 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 428 FARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +V++++V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTILSKRKIAKLVEEKIVRGWDDPRLYTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEM 536
           +V N++     +  +K ++   PR   V++P+++ ++      E  +E+
Sbjct: 545 SVTNIQAVRFESAIRKYLEETTPRLMFVLDPIEVVVDNLPEDHEELVEV 593

>Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168W
           (REAL)
          Length = 809

 Score =  220 bits (561), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 188/331 (56%), Gaps = 10/331 (3%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYARYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 260 LELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDG------ 310
           +  LG K  +ITYSSDYF E+Y     +I +GK Y   C     ++ R  + DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYGLAEVLINNGKGYVCHCTGEEIKRSRGIKEDGTPGGER 369

Query: 311 IASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   RD+S+E NL+ F  +M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 370 FACKHRDQSIELNLKEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 371 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG+ WKIYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 431 INFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +VD++ V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           N++     +  +K ++   PR   V++P+++
Sbjct: 549 NIQVIRFESAVRKYLEDTTPRLMFVLDPIEV 579

>Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168W
           (REAL)
          Length = 810

 Score =  219 bits (559), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 188/331 (56%), Gaps = 10/331 (3%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 310

Query: 260 LELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREER---MDG------ 310
           +  LG    +ITYSSDYF E+Y     +IK+GK Y      E+++  R    DG      
Sbjct: 311 VSWLGFMPWKITYSSDYFDELYGLAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGQR 370

Query: 311 IASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   RD+S+E NL+ F  +M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 371 FACKHRDQSIELNLQEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 429

Query: 371 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG+ WKIYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 431 INFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +VD++ V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           N++     +  +K ++   PR   V++PV++
Sbjct: 550 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEV 580

>TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.51
           YOR168W
          Length = 809

 Score =  218 bits (555), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 123/334 (36%), Positives = 189/334 (56%), Gaps = 10/334 (2%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G+  +RFDDTNP  E  E+ +SI   
Sbjct: 252 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNGGETYLRFDDTNPEAEAPEYFESIKRM 311

Query: 260 LELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREER---MDG------ 310
           +  LG K  +ITYSSDYF ++Y+    +IK GK Y     +E+++  R    DG      
Sbjct: 312 VSWLGFKPFKITYSSDYFDKLYELAEVLIKSGKGYVCHCTSEEVKAGRGIKEDGTPGGER 371

Query: 311 IASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   RDRS+EE L  F  +M+NG     +  +R K D  + +  + D V YR    PH 
Sbjct: 372 FACKDRDRSIEETLDEF-RKMRNGFYKPGEATLRMKQDLSSPSPQMWDLVAYRVLNAPHP 430

Query: 371 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 431 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGR 490

Query: 431 INFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V+++ V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 491 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 550

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLE 524
           N++     +  +K ++   PR   V++PV++ L+
Sbjct: 551 NIQVVRFESAIRKYLEDSTPRLMFVLDPVEVVLD 584

>ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 803

 Score =  218 bits (555), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 120/334 (35%), Positives = 188/334 (56%), Gaps = 10/334 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSI 256
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATHGLVHTRFPPEPNGYLHIGHSKAIMVNFGYAKFHGGHCYLRFDDTNPEAEAPEYFESI 305

Query: 257 LEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREER---MDGI-- 311
           +  +  LG    +ITYSSDYF ++Y+   ++I  GK Y  +   E+++  R    DG   
Sbjct: 306 IRMVNWLGFHPWKITYSSDYFDQLYELAERLISKGKGYVCNCAAEEIKASRGIKPDGTPG 365

Query: 312 ----ASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               A   R RSVEENL  F  +MK+G     +  +R K D  + +  + D + YR    
Sbjct: 366 GERHACKHRSRSVEENLTEF-RKMKDGHYQPGEATLRMKQDLSSPSPQMWDLIAYRVLNA 424

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWD 427
           PH RTG+ W+IYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    +
Sbjct: 425 PHPRTGNKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVDVFRPTQRE 484

Query: 428 FARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +VD++ V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTVLSKRKIAKLVDEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           +V N++     +  +K ++   PR   +++PV++
Sbjct: 545 SVTNIQLVRFESAIRKYLEDTTPRLMFILDPVEV 578

>CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168w GLN4
          Length = 795

 Score =  216 bits (550), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 119/337 (35%), Positives = 190/337 (56%), Gaps = 10/337 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 238 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 297

Query: 257 LEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREER---MDGI-- 311
              +  LG K  ++TYSSDYF ++Y+    +IK+GK Y      E+++  R    DG   
Sbjct: 298 KRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPG 357

Query: 312 ----ASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               A   RD+SVE+NL  F   M++G     +  +R K + E+ +  + D + YR    
Sbjct: 358 GERHACKHRDQSVEKNLEEF-RAMRDGKYKPGEAILRMKQNLESPSPQMWDLIAYRVLNA 416

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWD 427
           PH RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    +
Sbjct: 417 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 476

Query: 428 FARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 477 YGRLNITGTVLSKRKIAKLVDEHFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 536

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLE 524
           +  N++     +  +K ++   PR   +++P+++ +E
Sbjct: 537 STTNIQVVRFESAIRKYLEDSTPRLMMILDPIEVVVE 573

>SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {ON}
           highly similar to uniprot|P13188 Saccharomyces
           cerevisiae YOR168W GLN4 Glutamine tRNA synthetase
           monomeric class I tRNA synthetase that catalyzes the
           specific glutaminylation of tRNA(Glu) N-terminal domain
           proposed to be involved in enzyme-tRNA interactions
          Length = 801

 Score =  215 bits (547), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 187/331 (56%), Gaps = 10/331 (3%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 246 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGVCYLRFDDTNPEAEAPEYFESIKRM 305

Query: 260 LELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREER---MDG------ 310
           +  LG +  +ITYSSDYF ++YD    +IK+GKAY      E+++  R    DG      
Sbjct: 306 VSWLGFEPWKITYSSDYFDKLYDLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 365

Query: 311 IASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
           +A   RDR +EENL  F  +M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 366 VACVHRDRPIEENLEEF-RKMRDGVYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 424

Query: 371 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG  WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 425 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 484

Query: 431 INFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V++ +V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 485 LNITGTVLSKRKIAKLVNEGIVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 544

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           N++     +  +K ++    R   V++PV+I
Sbjct: 545 NIQVVRFESAIRKYLEDTTARLMFVLDPVEI 575

>KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.51
           YOR168W
          Length = 794

 Score =  214 bits (545), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 183/331 (55%), Gaps = 10/331 (3%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + GK  +RFDDTNP  E  E+ +SI   
Sbjct: 247 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHFGGKCYLRFDDTNPEAEAPEYFESIKRM 306

Query: 260 LELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDGI----- 311
           +  LG K  +ITYSSDYF ++YD    +IK  K Y   C     ++ R  + DG      
Sbjct: 307 VSWLGFKPWKITYSSDYFDKLYDLAEFLIKSDKGYICHCTAEEIKRGRGIKEDGTPGGER 366

Query: 312 -ASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A A R R +EE+L  F  +MK+G     K  +R K D ++ N  + D + YR    PH 
Sbjct: 367 SACAHRSRPIEESLAEF-RKMKDGFYEPGKAILRMKQDLQSPNPQMWDLIAYRVLNAPHP 425

Query: 371 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG  W+IYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 426 RTGDKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 485

Query: 431 INFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 486 LNITGTILSKRKIAKLVELHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSDT 545

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           N++        +K ++   PR   +++P++I
Sbjct: 546 NIQVARFETAVRKYLEETTPRLMFILDPIEI 576

>AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR168W
           (GLN4)
          Length = 798

 Score =  213 bits (541), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 119/334 (35%), Positives = 186/334 (55%), Gaps = 10/334 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 242 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHHGGVCYLRFDDTNPEAEAPEYFESI 301

Query: 257 LEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREER---MDG--- 310
              +  LG    +ITYSSDYF ++Y+    +IK+GK Y      E++R  R    DG   
Sbjct: 302 ERMVAWLGFSPWKITYSSDYFDQLYELAEVLIKNGKGYICHCTAEEIRRGRGIKEDGTPG 361

Query: 311 ---IASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
              +  A R+R +EENL  F   M++G     +  +R K D  + +  + D V YR    
Sbjct: 362 GERLPCAHRERPIEENLAEF-RNMRDGKYAPGEAILRMKQDLSSPSPQMWDLVAYRVLNA 420

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWD 427
           PH RTGS W+IYPTYDF   +VD+LE +TH+L T E+      Y+W+   + + +    +
Sbjct: 421 PHPRTGSKWRIYPTYDFTHCLVDSLENITHSLCTAEFYLSRESYEWLCDQVHVFRPAQRE 480

Query: 428 FARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +V ++ V  WDDPR  T        +    + +F+ + G + 
Sbjct: 481 YGRLNITGTVLSKRKIAKLVHEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 540

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           +  N++     +  +K ++    R   V++P+++
Sbjct: 541 STTNIQVVRFESAIRKYLEDTTARLMFVLDPIEV 574

>Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {ON}
           YOR168W (GLN4) - glutaminyl-tRNA synthetase [contig 185]
           FULL
          Length = 800

 Score =  212 bits (540), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 120/334 (35%), Positives = 185/334 (55%), Gaps = 10/334 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI
Sbjct: 242 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESI 301

Query: 257 LEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDGI-- 311
              +  LG K  +ITYSSDYF ++Y+    +I + KAY   C     ++ R  + DG   
Sbjct: 302 KNMVAWLGFKPWKITYSSDYFDKLYELAEVLISNSKAYVCHCSGEEIKRGRGIKEDGTPG 361

Query: 312 ----ASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               A   R RSVEENL  F  +M++G     +  +R K D E+ +  + D + YR    
Sbjct: 362 GERRACVHRSRSVEENLTEF-RKMRDGHYKPGEAILRMKQDLESPSPQMWDLIAYRVLNA 420

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWD 427
           PH RTG  WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    +
Sbjct: 421 PHPRTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 480

Query: 428 FARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 481 YGRLNITGTVLSKRKIAKLVNEHYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 540

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           +  N++     +  +K ++   PR   +++PV++
Sbjct: 541 STTNIQVVRFESAIRKYLEDNTPRLMMILDPVEV 574

>NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6.51
           YOR168W
          Length = 814

 Score =  212 bits (539), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 116/331 (35%), Positives = 184/331 (55%), Gaps = 10/331 (3%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 255 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 314

Query: 260 LELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDGI----- 311
           +  LG    +ITYSSDYF ++YD    +I +GK Y   C     ++ R  + DG      
Sbjct: 315 VHWLGFTPWKITYSSDYFDKLYDLAELLINNGKGYICHCTAEEIKRGRGIKEDGTPGGER 374

Query: 312 -ASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   RDR +EENL+ F   M++G     +  +R K D  + +  + D + YR     H 
Sbjct: 375 HACKHRDRPIEENLQEF-RNMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAAHP 433

Query: 371 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 434 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 493

Query: 431 INFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +VD++ V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 494 LNITGTVLSKRKIAKLVDEKFVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 553

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           N++     +  +K ++   PR   +++P+++
Sbjct: 554 NIQVVRFESAIRKYLEDTTPRLMFILDPIEV 584

>Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W
           (REAL)
          Length = 821

 Score =  211 bits (538), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 116/331 (35%), Positives = 185/331 (55%), Gaps = 10/331 (3%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 260 LELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDG------ 310
           +  LG +  +ITYSSDYF E+Y     +I + K Y   C     ++ R  + DG      
Sbjct: 310 VSWLGFEPWKITYSSDYFDELYRLAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGER 369

Query: 311 IASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   RD+ +E NL+ F   M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 370 FACKHRDQPIELNLQEF-RNMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 371 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG+ WKIYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 431 INFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +VD++ V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           N++     +  +K ++   PR   V++P+++
Sbjct: 549 NIQVVRFESAIRKYLEDTTPRLMFVLDPIEV 579

>KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 800

 Score =  211 bits (537), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 185/331 (55%), Gaps = 10/331 (3%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKSM 304

Query: 260 LELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREER---MDGI----- 311
           +  LG K  +ITYSSDYF ++Y+   ++I +GKAY      E+++  R    DG      
Sbjct: 305 VSWLGFKPWKITYSSDYFDKLYELAEKLITNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 364

Query: 312 -ASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   R RSVEENL  F  +M++G     +  +R K D E+ +  + D + YR     H 
Sbjct: 365 HACVHRGRSVEENLAEF-RKMRDGAYKPGEATLRMKQDLESPSPQMWDLIAYRVLNASHP 423

Query: 371 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG  WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 431 INFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V++  V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTILSKRKIAKLVNEHYVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           N++     +  +K ++   PR   V++PV++
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMVLDPVEV 574

>TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  211 bits (536), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/331 (34%), Positives = 184/331 (55%), Gaps = 10/331 (3%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 260 LELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREERM---------DG 310
           +  LG K  +ITYSSDYF ++Y+    +I + K Y      E+++  R          D 
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGDR 370

Query: 311 IASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   R+R +EENL+ F   M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 371 FACVHRNRPIEENLKEF-RSMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 371 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 431 INFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V+++ V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 549

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           N++     +  +K ++   PR   +++P+++
Sbjct: 550 NIQVTRFESAIRKYLEDSTPRLMFILDPIEV 580

>TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  210 bits (534), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 115/337 (34%), Positives = 186/337 (55%), Gaps = 10/337 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYWNGVCYLRFDDTNPEAEAPEYFESI 307

Query: 257 LEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDGI-- 311
              +  LG K  ++TYSSDYF ++Y+    +IK+ K Y   C     ++ R  + DG   
Sbjct: 308 QRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNDKGYICHCTAEEIKRGRGIKEDGTPG 367

Query: 312 ----ASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               A   RDR +EE+L+ F   M+ G     +  +R K D  + +  + D + YR   +
Sbjct: 368 GERSACKHRDRPIEESLQEF-RNMREGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNS 426

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWD 427
           PH RTG  WKIYPTYDF   +VD+ E ++H+L T E+      Y+W+   + + +    +
Sbjct: 427 PHPRTGDKWKIYPTYDFTHCLVDSFENISHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 428 FARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIAKLVEGSYVRGWDDPRLYTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLE 524
           +  N++     +  +K ++   PR   +++P+++ +E
Sbjct: 547 STTNIQVARFESAIRKFLEDTTPRLMFILDPIEVIVE 583

>Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {ON}
           complement(93063..95489) [2427 nt, 809 aa]
          Length = 808

 Score =  209 bits (533), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 116/331 (35%), Positives = 184/331 (55%), Gaps = 10/331 (3%)

Query: 200 GQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYWDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 260 LELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDGI----- 311
           +  LG K  +ITYSSDYF ++Y+    +I++ + Y   C     ++ R  + DG      
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEILIQNDRGYICHCTAEEIKRGRGIKEDGTPGGER 370

Query: 312 -ASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH 370
            A   RDR VEE+L+ F   M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 371 SACKHRDRPVEESLKEF-RNMRDGVYQPGEATLRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 371 RTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 430 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 431 INFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEGNYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 491 NLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           N++     +  +K ++   PR   V++P+++
Sbjct: 550 NIQVVRFESAVRKFLEDTTPRLMFVLDPIEV 580

>NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}
           Anc_6.51 YOR168W
          Length = 811

 Score =  208 bits (530), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 117/334 (35%), Positives = 182/334 (54%), Gaps = 10/334 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G  I+RFDDTNP  E  E+ +SI
Sbjct: 251 ATGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNDGVCILRFDDTNPEAEAPEYFESI 310

Query: 257 LEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDGI-- 311
              +  LG    +ITYSSDYF ++YD    +I + + Y   C     ++ R  + DG   
Sbjct: 311 KRMVSWLGFVPWKITYSSDYFDKLYDLAEVLINNDRGYICHCTAEEIKRGRGIKEDGTPG 370

Query: 312 ----ASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               A   R  S+E NL+ F   M++G     +  +R K D  + +  + D + YR    
Sbjct: 371 GERSACVHRSNSIETNLKEF-RNMRDGVYKPGEATLRMKQDLTSPSPQMWDLIAYRVLNA 429

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWD 427
           PH RTG+ WKIYPTYDF   +VD+ E +TH+L T E+R     Y+W+   + + +    +
Sbjct: 430 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFRLSRESYEWLCDQVHVFRPAQRE 489

Query: 428 FARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 490 YGRLNITGTVLSKRKIAKLVDEHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 549

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
           +  N++        +K ++   PR   +++P++I
Sbjct: 550 STTNIQVARFENSIRKYLEDSTPRLMFILDPIEI 583

>KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 804

 Score =  206 bits (525), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 117/324 (36%), Positives = 177/324 (54%), Gaps = 10/324 (3%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  FA+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGFAKYHNGVCYLRFDDTNPEAEAPEYFESI 305

Query: 257 LEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDGI-- 311
              +  LG K  + TYSSDYF E+Y     +IK+GKAY   C     ++ R  + DG   
Sbjct: 306 KSMVSWLGFKPWKTTYSSDYFDELYQLAETLIKNGKAYVCHCSAEEIKRGRGIKEDGTPG 365

Query: 312 ----ASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               A   R+R +EE+L  F  +M++G     +  +R K D  + +  + D + YR    
Sbjct: 366 GERKACVSRERPIEESLTEF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 424

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWD 427
           PH RTG  WKIYPTYDF   +VD+LE +TH+L T E+      Y+W+   + + +    +
Sbjct: 425 PHPRTGDKWKIYPTYDFTHCLVDSLENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 428 FARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +V    V  W+DPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTVLSKRKIAKLVTGGYVSGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 488 NVINLEWNLIWAFNKKVIDPIAPR 511
           +  N++     +  +K ++   PR
Sbjct: 545 STTNIQVVRFESAIRKYLEDTTPR 568

>Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar to
           Ashbya gossypii AGR259C
          Length = 804

 Score =  206 bits (525), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 115/334 (34%), Positives = 186/334 (55%), Gaps = 10/334 (2%)

Query: 197 AKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSI 256
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGICYLRFDDTNPEAEAPEYFESI 307

Query: 257 LEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDGI-- 311
              +  LG K  +ITYSSDYF ++YD    +I++ K Y   C     ++ R  + DG   
Sbjct: 308 ERMVTWLGFKPWKITYSSDYFDQLYDLAEVLIQNNKGYVCHCTGEEIKRGRGIKEDGTPG 367

Query: 312 ----ASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLT 367
               + + R+RS+ ENL  F  +M++G     +  +R K D  + +  + D + YR    
Sbjct: 368 GERKSCSHRERSITENLAAF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 426

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWD 427
           PH RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    +
Sbjct: 427 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 428 FARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 487
           + R+N   T+LSKRK+  +V+++ V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIARLVNEKYVRGWDDPRLFTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 488 NVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKI 521
              N++     +  +K ++    R   +++P+++
Sbjct: 547 TTTNIQVVRFESAIRKYLEDTTARLMFLLDPIEV 580

>KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON}
           Anc_7.100 YOL033W
          Length = 517

 Score = 79.3 bits (194), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 102/232 (43%), Gaps = 26/232 (11%)

Query: 199 VGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILE 258
           V  VVTRF P P+G LH+G  + AL N   A+   GK I+R +DT+  +   E + +IL+
Sbjct: 38  VAPVVTRFAPSPTGLLHLGSLRTALYNYLLAKNTGGKFILRLEDTDRKRYHAEAEQNILD 97

Query: 259 DLELLGIKGDRITY-SSDYFQE-MYD-YCVQMIKDGKAY---CDDTPTEKMREERMDGIA 312
            L+   IK D   Y  SD  +E +Y  Y  Q++K G AY   C       +REE  D   
Sbjct: 98  TLDWCHIKWDGPMYRQSDRAREGLYTRYAEQLVKGGFAYKCFCSKERLNNLREEGYDRHC 157

Query: 313 SARRDRSVEEN------LRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNL 366
           +   D+ V         +R    E+ +  +  L   VR  I          DPV+ + + 
Sbjct: 158 THLSDQEVNAFQGTPYVIRFKAPEVYDAVDDLLHGSVR--IQPRRDRHGFDDPVLLKSDR 215

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQAL 418
                       +PTY     + D L GVTH +R  E+     ++  M +A 
Sbjct: 216 ------------FPTYHLANVVDDHLMGVTHVIRGEEWLPSTPKHIAMYKAF 255

>NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON}
           Anc_7.100 YOL033W
          Length = 529

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 116/268 (43%), Gaps = 47/268 (17%)

Query: 203 VTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLEL 262
           +TRF P P+G LH+G  + AL N   A++  GK I+R +DT+ S+   E   +I E L+ 
Sbjct: 43  ITRFAPSPTGLLHLGSLRTALYNYLLARSTNGKFILRLEDTDQSRIHPEAISNIYETLKW 102

Query: 263 LGIKGDR-ITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDGIASARRDR 318
            GI  D      SD     + Y   ++  G AY   C     E++R +  +   S   DR
Sbjct: 103 CGINYDEGFIKQSDRLPIYHKYIKILLDSGAAYHCFCTKDRLEQLRRKNSNTPNSPSYDR 162

Query: 319 S--------VEENLRI---FTEEMKNGTEV-GLKNCVRAKIDYEALNKTLR-----DPVI 361
           +        VE NL     +T  +K+        + +  ++D + LN+  R     DP++
Sbjct: 163 NCYHLDTEIVESNLTANLPYTIRLKSPDRYPPFTDLLHGQVDIQ-LNQKERGVWFDDPIL 221

Query: 362 YRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLR 421
            + +             YPTY F   + D L G+TH +R  E+     ++      + L 
Sbjct: 222 IKSD------------GYPTYHFANVVDDHLMGITHVIRGEEWLPSTPKH------VALY 263

Query: 422 KVHIWDFARINFVRTL-------LSKRK 442
           ++  WD  +   +  L       LSKRK
Sbjct: 264 QLFGWDMPKFIHIPLLTSIDDKKLSKRK 291

>NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}
           Anc_7.100 YOL033W
          Length = 527

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 80/336 (23%), Positives = 138/336 (41%), Gaps = 51/336 (15%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLE 261
           V+TRF P P+G LH+G  + AL N   A+   GK I+R +DT+ ++   E   +I + L+
Sbjct: 46  VITRFAPSPTGLLHLGSLRTALYNYLLAKNTNGKFILRLEDTDQTRLHPEALKNIFDTLK 105

Query: 262 LLGIKGDRITYSSDYFQEMY-DYCVQMIKDGKAYCDDTPTEKMREERMDGIA--SARRDR 318
              ++ D           +Y +Y  +++K G AY      E++ + R   +A  S   DR
Sbjct: 106 WCNMEYDEGPIEQSQRLPIYQEYIKKLLKSGHAYYCFCSRERLEQLRTGNMAPGSLSYDR 165

Query: 319 SVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIY-----RCNLTPHHRTG 373
                + +  E +K   + G+   +R K          R P+I+       N+ P++R G
Sbjct: 166 KC---IHLDEETIKVNLDKGIPYTIRMK-------SPERYPLIHDLLHGELNIQPNNREG 215

Query: 374 STW---------KIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVH 424
             W           +PTY F   + D L  VTH +R  E+     ++  + Q        
Sbjct: 216 -MWFDDPILIKSDGFPTYHFANVVDDHLMKVTHVIRGEEWLPSTPKHVALYQYFGWA--- 271

Query: 425 IWDFARINFVRTL----LSKR---------KLQWMVDKELVG-----NWDDPRFPTXXXX 466
           I  F  I  + ++    LSKR         K Q ++ + L+       W  PR       
Sbjct: 272 IPKFIHIPLLTSIDDKKLSKRKGDFSVFGLKEQGILPEALINFCALLGWSPPR--NVAQE 329

Query: 467 XXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK 502
                T++ L         ++  + +++  +W FNK
Sbjct: 330 THECFTLDELERLFNLNHLTKGNVKVDYKKLWFFNK 365

>TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {ON}
           Anc_7.100 YOL033W
          Length = 558

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 117/269 (43%), Gaps = 36/269 (13%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLE 261
           V TRF P P+G++H+G  + AL N   A++  G+ ++R +DT+  +  E  ++ I E L+
Sbjct: 46  VRTRFAPSPTGFMHLGSLRTALYNYLLAKSTGGQFLLRLEDTDQKRLVEGAEEDIYETLK 105

Query: 262 LLGIKGDRITYSSDYFQEMYDYCVQ-------------MIKDGKAY---CDDTPTEKMRE 305
             GI+ D      +   E Y    Q             ++++G AY   C     ++M+E
Sbjct: 106 WCGIEYDE---GPNVNSEAYGPFRQSERTKIYAKHIKVLLENGDAYKCFCTKERLDEMKE 162

Query: 306 --ERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKI--DYEALNKTLRDPVI 361
             ++++  +SA  DR     L +  EE+K    +     +R K    Y      L   + 
Sbjct: 163 SAQKLNPPSSASYDRHC---LHLNEEEIKQKELLNSPYTIRLKSPEKYPEFEDLLHGKLS 219

Query: 362 YRCNLTPHHRTGSTWKI-----YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQ 416
            +    PH +T     +      PTY F   + D L  +TH +R  E+     ++  M  
Sbjct: 220 IQIQYNPHKKTYDDPILIKSDGLPTYHFANVVDDHLMKITHVIRGEEWLPSTPKHISMYN 279

Query: 417 AL---RLRKVHIWDFARINFVRTLLSKRK 442
           AL     + +HI     IN  +  LSKRK
Sbjct: 280 ALGWQAPKYIHIPLLTSINDKK--LSKRK 306

>TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {ON}
           Anc_7.100 YOL033W
          Length = 531

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 119/276 (43%), Gaps = 50/276 (18%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLE 261
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+  +  +  +++I   L+
Sbjct: 44  VRTRFAPSPTGSLHLGSLRTALYNYLLARNTGGQFILRIEDTDQKRLVKGAEENIYSSLK 103

Query: 262 LL---------GIKGDRITYSSDYFQEMYD-YCVQMIKDGKAY---CDDTPTEKMRE--E 306
            L         GI G    Y       +Y  Y  +++ +GKAY   C       ++E  +
Sbjct: 104 WLGLQFDEGPNGINGPYGPYKQSERSSIYQKYINELLDNGKAYRCFCSKERLTGLKESAQ 163

Query: 307 RMDGIASARRDR--------SVEENL--------RIFTEEMKNGTEVGLKNCVRAKIDYE 350
           ++    +A  DR         +EENL        R+ + ++    E  L   +  +  Y 
Sbjct: 164 KLKPPTTASYDRKCTNLTKSQIEENLKNKVPYTVRLLSPDLYPAFEDLLHGKLNIQPQYN 223

Query: 351 ALNKTLRDPVIYRC-NLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNA 409
           ++++   DPV+ +  NL             PTY F   + D L  ++H +R  E+     
Sbjct: 224 SIDRRFDDPVLMKSDNL-------------PTYHFANVVDDHLMKISHVIRGEEWLPSTP 270

Query: 410 QYDWMLQALRLRK---VHIWDFARINFVRTLLSKRK 442
           ++  + +A   +    +HI     +N  +  LSKRK
Sbjct: 271 KHIAIYEAFGWKPPKYIHIPLLTTLNDKK--LSKRK 304

>YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}
           MSE1Mitochondrial glutamyl-tRNA synthetase, predicted to
           be palmitoylated
          Length = 536

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 95/220 (43%), Gaps = 24/220 (10%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLE 261
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +  E  +++I E L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILK 104

Query: 262 LLGIKGDRITYSSDYFQEMYD-YCVQMIKDGKAYCDDTPTEKMREERMDGI-----ASAR 315
              I  D         + +YD Y   ++  GKAY      E++ + R   +     + A 
Sbjct: 105 WCNINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 316 RDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHHRTGST 375
            DR       +  EE+K+    G+   VR K        T  D +  + NL P  +    
Sbjct: 165 YDRCCAH---LGEEEIKSKLAQGIPFTVRFKSPERY--PTFTDLLHGQINLQP--QVNFN 217

Query: 376 WKIY-----------PTYDFCVPIVDALEGVTHALRTIEY 404
            K Y           PTY     + D L G+TH +R  E+
Sbjct: 218 DKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEW 257

>Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {ON}
           complement(21668..23278) [1611 nt, 537 aa]
          Length = 536

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 100/228 (43%), Gaps = 25/228 (10%)

Query: 199 VGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILE 258
           +  V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +  ++ +++I E
Sbjct: 38  ISPVRTRFAPSPTGFLHLGSLRTALYNYLLAKNTGGQFLLRLEDTDRKRLVKDAEENIYE 97

Query: 259 DLELLGIKGDRITYS----------SDYFQEMYDYCVQMIKDGKAYCDDTPTEKM----- 303
            L+  GI  D    S          SD  +    Y  +++ +G AY    P E++     
Sbjct: 98  SLKWCGIDYDEGPNSQNQQFGPYRQSDRTKIYQKYIDKLLDNGHAYRCFCPKERLDSLRD 157

Query: 304 REERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKID--YEALNKTLRDPVI 361
             +++    +   DR+    L +  +E++N    G+   VR K    Y   +  L   + 
Sbjct: 158 SAQKLQPPTTVSYDRNC---LHLNHDEIQNNINNGVSYTVRMKSPEIYPPFDDLLHGHIN 214

Query: 362 YRCNLTPHHRTGSTWKI-----YPTYDFCVPIVDALEGVTHALRTIEY 404
            +  +  + R      +      PTY F   I D L  +TH +R  E+
Sbjct: 215 IQPQINSNDRRYDDPILMKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 80/348 (22%), Positives = 135/348 (38%), Gaps = 54/348 (15%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLE 261
           V TRF P P+G+LH+G  + AL N   A+  KG+ ++R +DT+  +     +++I E L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTKGQFLLRLEDTDQKRLVPGAEENIYEVLK 104

Query: 262 LLGIKGDRITYSSDYFQEMYD-YCVQMIKDGKAYCDDTPTEKMREERMDGI-----ASAR 315
              I  D         + +YD Y   ++  G AY      E++ + R   +     + A 
Sbjct: 105 WCKISYDETPVKQSERKSVYDKYVKILLSSGMAYRCFCSKERLNDLRRSAMELKPPSMAS 164

Query: 316 RDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPH-----H 370
            DR       +  EE+++     +   VR K   +    T  D +    NL P       
Sbjct: 165 YDRCCAH---LAKEEIESKLAQDMPFTVRFKSPEQY--PTFTDVLHGEINLQPQVNYNDR 219

Query: 371 RTGSTWKI----YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIW 426
           R      +     PTY     + D L G+TH +R  E+     ++  +  A        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 427 DFARINFVRTL-------LSKRKL---------QWMVDKELVG-----NWDDPRFPTXXX 465
           D+ +   +  L       LSKRK          Q ++ + LV       W  PR      
Sbjct: 274 DYPKFIHIPLLTTVGDKKLSKRKGDMSISSLKNQGILPEALVNFCALFGWSPPR--DLAS 331

Query: 466 XXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK-----KVIDPI 508
                 ++E L       G ++    ++   +W FNK     ++ DP+
Sbjct: 332 KKHECFSMEDLEKLFNLNGLTKGNAKVDDKKLWFFNKHFLQERISDPV 379

>Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AEL338C
          Length = 573

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 99/222 (44%), Gaps = 24/222 (10%)

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLELL 263
           TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+ ++     + ++ +  + L
Sbjct: 62  TRFAPSPTGFLHLGSLRTALFNYLLAKKTGGQFLLRLEDTDRTRLVPGSEQNLYDSFKWL 121

Query: 264 GIK-----GDRITY----SSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREERMDGIA-- 312
           GI+     G   TY     SD  +    Y  Q+I  G AY      E+++  R   +A  
Sbjct: 122 GIQYDEGPGVNETYGPYRQSDRTEIYKKYSDQLISTGHAYRCFCSKERLKGLRDSAMALK 181

Query: 313 ---SARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKID--YEALNKTLRDPVIYRCNLT 367
              +   DR      ++  E++++  ++G+   +R K    YE     L + +  +  + 
Sbjct: 182 PPTNVTYDRHCA---KLSKEDIRSKIKMGVPYTIRLKSPEIYEPFEDLLHNEINLQPQIN 238

Query: 368 P-HHRTGSTWKI----YPTYDFCVPIVDALEGVTHALRTIEY 404
           P   R      I     PTY F   I D L  +TH +R  E+
Sbjct: 239 PIDVRYDDPILIKSSGLPTYHFAHVIDDHLMEITHVIRGQEW 280

>CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033w MSE1
          Length = 532

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 57/111 (51%), Gaps = 1/111 (0%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLE 261
            VTRF P P+G LH+G  + AL N   A+   GK I+R +DT+ S+ K+   D+I   L+
Sbjct: 46  AVTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYNSLK 105

Query: 262 LLGIKGDRITYSSDYFQEMY-DYCVQMIKDGKAYCDDTPTEKMREERMDGI 311
              +K D   Y      ++Y  +   +I+ G+AY      E++ + R   +
Sbjct: 106 WCNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCTKERLDDLRQSAL 156

>KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 542

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 113/276 (40%), Gaps = 51/276 (18%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLE 261
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     + S+ + L+
Sbjct: 51  VRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAEQSLYDALK 110

Query: 262 LLGIKGD------------RITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREE--- 306
              IK D            R +  +  +QE  +  V+     K +C     + +RE    
Sbjct: 111 WCNIKYDEGPGVNEIYGPYRQSDRTKIYQEYINTLVEKGDAYKCFCSKERLDALRESAQK 170

Query: 307 -------RMDGIASARRDRSVEENLRI---FTEEMKNGTEV-GLKNCVRAKIDYE----A 351
                    D   S   D+ VE NL+    FT   K+  +    ++ +  K+D +     
Sbjct: 171 LQPPTTVSYDRHCSKLSDQEVEANLKAGIPFTVRFKSPDKYPPFEDLLHGKLDIQPQVNP 230

Query: 352 LNKTLRDPVIYRC-NLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQ 410
           L+    DP++ +  NL             PTY F   I D L  +TH +R  E+     +
Sbjct: 231 LDIRYDDPILMKSDNL-------------PTYHFANVIDDHLMKITHVIRGEEWLPSTPK 277

Query: 411 YDWMLQALRLRKVHIWDFARINFVRTL----LSKRK 442
           +  + +A      H   +  I  + T     LSKRK
Sbjct: 278 HTALYEAYGWTPPH---YVHIPLLTTTSDKKLSKRK 310

>KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {ON}
           Anc_7.100 YOL033W
          Length = 514

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 97/229 (42%), Gaps = 23/229 (10%)

Query: 201 QVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDL 260
           +VVTRF P P+G LHIG  + AL N   A++  GK I+R +DT+ ++ K   +  I + L
Sbjct: 39  RVVTRFAPSPTGLLHIGSLRTALYNFLLARSTNGKFILRIEDTDRTRLKSGAEQDICDIL 98

Query: 261 ELLGIKGD-RITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMREERMDGIASARR 316
               +K D      SD      +Y  ++++ G AY   C       MR    D       
Sbjct: 99  NWCNLKYDVGPIRQSDRIPIYEEYANKLLETGAAYRCFCTKDRLSTMRAHGYDRHCLHLS 158

Query: 317 DRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRCNLTPHH-RTGST 375
           D  V    R+F       T   L+  +++   Y++    L   V    N+     R G  
Sbjct: 159 DNDVR---RLFDA---GHTRPVLR--LKSPNKYDSFQDMLHGTV----NIQERKDRVGFD 206

Query: 376 WKI------YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQAL 418
             I      +PTY F   + D L  VTH +R  E+     ++  + +AL
Sbjct: 207 DPILMKSDGFPTYHFANVVDDHLMEVTHVIRGDEWLPSTPKHIALYKAL 255

>Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033W
           (REAL)
          Length = 532

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 125/319 (39%), Gaps = 46/319 (14%)

Query: 144 VNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVGKKKETHKANFEIDLPDAKVGQVV 203
           + + R +  L + P  G     L KSL   K       K++ H ++            V 
Sbjct: 4   LRIPRRFYCLSLKPTKGVGPSSLNKSLLSRKT------KEDIHPSS-----------PVR 46

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLELL 263
           TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     +++I + L+  
Sbjct: 47  TRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIPGAEENIYDVLKWC 106

Query: 264 GIKGDRITYSSDYFQEMYD-YCVQMIKDGKAYCDDTPTEKMREERMDGI-----ASARRD 317
            I  D         + +YD Y   ++  G AY      E++ E R   +     + A  D
Sbjct: 107 KINYDETAVKQSERKPIYDKYVKILLSSGMAYRCFCSKERLNELRRSAMELKPPSMASYD 166

Query: 318 RSVEENLRIFTEEMKNGTEVGLKNCVRAKI--DYEALNKTLRDPVIYRCNLTPHHRTGST 375
           R       +  EE+ +    G+   VR K    Y      L   +  +  +  + R    
Sbjct: 167 RCCS---YLGEEEVNSKLSQGMPFTVRFKSPEKYPLFADLLHGEINLQPQVNFNDRRYDD 223

Query: 376 WKI-----YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWD--- 427
             +      PTY     + D L G+TH +R  E+     ++  +  A        WD   
Sbjct: 224 LILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------WDCPK 277

Query: 428 FARINFVRTL----LSKRK 442
           F  I  + T+    LSKRK
Sbjct: 278 FIHIPLLTTVGDKKLSKRK 296

>TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.100
           YOL033W
          Length = 534

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 101/228 (44%), Gaps = 31/228 (13%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLE 261
           V TRF P P+G LHIG  + AL N   A+  +G+ ++R +DT+ ++  +  +++I + L+
Sbjct: 41  VRTRFAPSPTGMLHIGSLRTALYNYLLAKNTRGQFLLRLEDTDQNRLIQGAEENIYDSLK 100

Query: 262 LLGIKGD-------------RITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMRE 305
             GI+ D             R +  ++ +Q+  D    ++K G AY   C     + +RE
Sbjct: 101 WCGIEYDEGPGVNDEKFGPYRQSERTEIYQQHVD---GLLKSGHAYRCFCSKERLDGLRE 157

Query: 306 --ERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKID--YEALNKTLRDPVI 361
             +R+    +   DR  E    +   E++      + + +R K    Y A +  L   V 
Sbjct: 158 SAKRLKPPTTVTYDRKCES---LSQGEIEERLAQQIPHTIRLKAPERYPAFHDLLHGTVD 214

Query: 362 YRCNLTPHHRTGSTWKI-----YPTYDFCVPIVDALEGVTHALRTIEY 404
            +  +  + R      +      PTY F   I D L  +TH +R  E+
Sbjct: 215 IQPQVNVNDRRYDDPILIKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL033W
           (MSE1)
          Length = 533

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 40/65 (61%)

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLELL 263
           TRF P P+GYLH+G  + AL N   A+   G+ ++R +DT+  +   + + +I + L+ L
Sbjct: 45  TRFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQWL 104

Query: 264 GIKGD 268
           GI+ D
Sbjct: 105 GIQFD 109

>Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 128/344 (37%), Gaps = 57/344 (16%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLE 261
           V TRF P P+G LH+G  + AL N   A+   G+ ++R +DT+  +     +  I + L 
Sbjct: 45  VRTRFAPSPTGLLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVPGAEKDIYDVLN 104

Query: 262 LLGIKGDRITYSSDYFQEMYD-YCVQMIKDGKAYCDDTPTEKMREERMDGI-----ASAR 315
              I+ D         + +YD Y   ++  G AY      E++ + R   +     + A 
Sbjct: 105 WCKIEYDETVVRQSERKLVYDKYVKILLSSGMAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 316 RDRSVEENLRIFTEEMKNGTEVGLKNCVRAKI--DYEALNKTLRDPVIYRCNLTPHHRTG 373
            DR       +  EE+ +    G+   VR K    Y      L   V    NL P  +  
Sbjct: 165 YDRCCAH---LKEEEINSNLTQGIPFTVRFKSPEQYPVFTDLLHGEV----NLQP--QVN 215

Query: 374 STWKIY-----------PTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
              K Y           PTY     + D L G+TH +R  E+     ++  +  A     
Sbjct: 216 FNDKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG--- 272

Query: 423 VHIW---DFARINFVRTL----LSKR---------KLQWMVDKELVG-----NWDDPRFP 461
              W    F  I  + T+    LSKR         K Q ++ + L+       W  PR  
Sbjct: 273 ---WVCPKFIHIPLLTTVGDKKLSKRKGDMSISSLKKQGVLPEALINFCALFGWSPPR-- 327

Query: 462 TXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVI 505
                     ++E L N     G ++    ++   +W FNK  +
Sbjct: 328 DLASKRHECFSMEELENLFNLNGLTKGNAKVDDKKLWFFNKHFL 371

>KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 546

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 99/235 (42%), Gaps = 49/235 (20%)

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLELL 263
           TRF P P+G LHIG  + AL N   A++  G  ++R +DT+ ++     + +I E L   
Sbjct: 47  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLSWC 106

Query: 264 GIKGD-------------RITYSSDYFQEMYDYCVQMIKDGKAY---CDDTPTEKMRE-- 305
           GI  D             R +  ++ +Q+   Y  +++  G AY   C     + +RE  
Sbjct: 107 GIHYDEGPGVNDKKNGPFRQSDRTEIYQQ---YTNKLLDSGHAYRCFCTKERLDGLRESA 163

Query: 306 ERMDGIASARRDRSV----EENLR-------IFTEEMKNGTEV-GLKNCVRAKIDYEAL- 352
           +++    +A  DR      E  +R        FT  +K+       ++ +  K+D +   
Sbjct: 164 QKLQPPTTASYDRHCSHLSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQPQV 223

Query: 353 ---NKTLRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEY 404
              ++   DP++ + +              PTY F   + D L  +TH +R  E+
Sbjct: 224 NPNDRRYDDPILVKSD------------ALPTYHFANVVDDHLMDITHVVRGEEW 266

>SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} similar
           to uniprot|P48525 Saccharomyces cerevisiae YOL033W MSE1
           Mitochondrial glutamyl-tRNA synthetase encoded by a
           nuclear gene
          Length = 554

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 94/237 (39%), Gaps = 49/237 (20%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLE 261
           V TRF P P+G LH+G  + AL N   A++  G+ ++R +DT+  +     + +I + L+
Sbjct: 61  VRTRFAPSPTGLLHMGSLRTALYNYLLARSTGGQFLLRLEDTDQKRLVPGAEQNIYDSLK 120

Query: 262 LLGIKGDR---------ITYSSDYFQEMYD-YCVQMIKDGKAY---CDDTPTEKMRE--E 306
             G++ D            Y      E+Y  Y  Q++  G AY   C     + +R   +
Sbjct: 121 WCGVEYDEGPGVNEDKFGPYRQSDRTEIYQHYIKQLLNSGHAYRCFCSKERLDGLRSSAQ 180

Query: 307 RMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKI--DYEALNKTLR------- 357
           ++    +A  DR   E   +  +E+    + G+   VR K    Y      L        
Sbjct: 181 QLQPPTTASYDRHCTE---LTEDEIAENLKKGVPCTVRLKAPKKYPPFEDLLHGQLDMQI 237

Query: 358 ----------DPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEY 404
                     DP++ + +              PTY F   + D L  +TH +R  E+
Sbjct: 238 QINMNDIRYDDPILMKSD------------GLPTYHFANVVDDHLMRITHVIRGEEW 282

>ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 533

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 97/237 (40%), Gaps = 50/237 (21%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDL- 260
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+ S+  E  +++I + L 
Sbjct: 40  VRTRFAPSPTGLLHMGSLRTALYNYLLAKNTGGQFILRLEDTDQSRLVEGAEENIYDSLR 99

Query: 261 -------ELLGIKGDRITYSSDYFQEMY-DYCVQMIKDGKAY---CDDTPTEKMREE--R 307
                  E   + G    Y      E+Y  Y   +++ G AY   C     E +RE   +
Sbjct: 100 WCKLHYDEGPMVGGPFGPYRQSERTEIYRSYIGTLLESGHAYRCFCPKERLEDLRESARK 159

Query: 308 MDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAK------IDYEALNKTL----- 356
           +    +A  DR       +   E+K   +  +   +R +      I  + L+ TL     
Sbjct: 160 LQPPTTASYDRHCAH---MSPHEIKQNLDNDVAYTIRLRAPEKYPIIQDLLHGTLDIQPQ 216

Query: 357 --------RDPVIYRC-NLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEY 404
                    DP++ +  NL             PTY F   I D L  +TH +R  E+
Sbjct: 217 VNANDVRYDDPILVKSDNL-------------PTYHFANVIDDHLMEITHVIRGEEW 260

>Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {ON}
           YOL033W (MSE1) - Mitochondrial glutamyl-tRNA synthetase
           [contig 47] FULL
          Length = 567

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 91/227 (40%), Gaps = 33/227 (14%)

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEFQDSILEDLELL 263
           TRF P P+G LHIG  + AL N   A++  G+ ++R +DT+  +     ++SI E L+  
Sbjct: 54  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGEFLLRLEDTDQKRLVPGAEESIYESLKWC 113

Query: 264 GI-----------------KGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMRE- 305
           G+                 + DR      Y  ++ D  V      + +C     + +R+ 
Sbjct: 114 GLSFDEGPGVNDAEFGPFRQSDRTKIYQSYINKLLDLGVAY----RCFCPKERLDNLRDS 169

Query: 306 -ERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKI--DYEALNKTLRDPVIY 362
            +++    +   DR    +    TE+++   +  +   VR K    Y      L   +  
Sbjct: 170 AQKLQPPTTVSYDRHCAHH---STEKIQEQLDQKIPFTVRLKSPQKYPPFEDLLHGSIDM 226

Query: 363 RCNLTPHHRTGSTWKI-----YPTYDFCVPIVDALEGVTHALRTIEY 404
           +  + P+        +      PTY F   + D L  +TH +R  E+
Sbjct: 227 QPQVNPNDMRYDDPILMKSDGLPTYHFANVVDDHLMKITHVVRGEEW 273

>Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {ON}
           YLR382C (REAL)
          Length = 895

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 173 VKKNANVGKK--KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQ 230
           VKK   +GKK  ++T +   E D P      ++ +FP  PSG LHIGH +  +++    +
Sbjct: 21  VKKLIAIGKKWKQKTIRGPIEHDTPKKGSKYILCQFP-YPSGALHIGHLRVYVISDSLNR 79

Query: 231 AYKGK 235
            YK +
Sbjct: 80  FYKQR 84

>CAGL0M07183g Chr13 (724616..726373) [1758 bp, 585 aa] {ON} similar
           to uniprot|P38880 Saccharomyces cerevisiae YHR194w
          Length = 585

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 48/105 (45%), Gaps = 9/105 (8%)

Query: 18  ELIAARIVNALAPNS-IAVEFVXXXXXXXXXXXXXTEDVFNKITGKFAAIFDNGKKEEVA 76
           E +A +I N L  N+ ++V F               ++VF     K +  F  G ++E A
Sbjct: 156 EYVAEKIGNYLTRNTALSVVFESAVVPDWSSGKISFKNVFISRRPKTSHSFTKGSQKEAA 215

Query: 77  KWVKLA-QEELVVK-------NFGKLSQSLETLDTQLNLRTFILG 113
           +  KLA  E L+V        N+ +   +L+ LD  LNLR +I G
Sbjct: 216 QRAKLALSESLLVNREDFDHGNYTQFDLTLDQLDISLNLRKWING 260

>TBLA0I02880 Chr9 complement(680214..682892) [2679 bp, 892 aa] {ON}
           Anc_4.236 YLR382C
          Length = 892

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 59/144 (40%), Gaps = 29/144 (20%)

Query: 208 PEPSGYLHIGHAKAALLNQYFAQAYK--GKMIIR---FD-------------DTNPS--- 246
           P PSG LH+GH +  +++   ++ YK  G  +I    +D             D NPS   
Sbjct: 66  PYPSGVLHLGHLRVYVISDSLSRFYKQRGYDVIHPMGWDAFGLPAENAAIDRDCNPSTWT 125

Query: 247 -----KEKEEFQDSILE---DLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDT 298
                K KE+ ++ +     D EL     D   ++   F E+Y + +   K+ +   D  
Sbjct: 126 YDNIAKMKEQMKNMLANFDWDRELTTCSKDYYKFTQMIFLELYKHGLAYHKEAEINWDPV 185

Query: 299 PTEKMREERMDGIASARRDRSVEE 322
               +  E++D    + R  ++ E
Sbjct: 186 DKTVLANEQVDSTGHSWRSGALVE 209

>NDAI0J01730 Chr10 complement(421402..426042) [4641 bp, 1546 aa]
           {ON} Anc_4.136 YLR320W
          Length = 1546

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 9/88 (10%)

Query: 378 IYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFARI--NFVR 435
           ++ +Y   V IV  L+   H    +E +  ++Q   ++  L   +  IW   RI  +F+ 
Sbjct: 786 LFESYHILVTIVQLLDRKQHLWEALEKQSYSSQIALIILNLFPTRKTIWSLLRIEPSFIS 845

Query: 436 TLL-------SKRKLQWMVDKELVGNWD 456
            +        S  +  W+VDK+L+ N D
Sbjct: 846 LVYTFKFIGYSTSQCNWIVDKDLIINLD 873

>Suva_13.198 Chr13 (321195..322343) [1149 bp, 382 aa] {ON}  YMR030W
           (REAL)
          Length = 382

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 3/69 (4%)

Query: 272 YSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMREERMDGIASARRDRSVEENLRIFTEEM 331
           ++S  FQ  Y+Y   ++ D  A  +  P EK R++  D   S R D  + +NL    E+ 
Sbjct: 233 HNSPLFQRYYNYQSMLMNDLLAEPETKPKEKKRKQAED---STRNDSDIGQNLNYCQEQQ 289

Query: 332 KNGTEVGLK 340
            N  E+  K
Sbjct: 290 HNILELQSK 298

>Skud_4.690 Chr4 (1220089..1222656) [2568 bp, 855 aa] {ON} YDR416W
           (REAL)
          Length = 855

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 24/31 (77%)

Query: 624 VDFDHLLTKDKLEEDESFEDFLTPETEFHTD 654
           ++F++L+T +KL EDE +E+F++  +E + D
Sbjct: 266 LNFNYLITLEKLGEDEQYEEFMSQMSEIYPD 296

>Skud_5.238 Chr5 (383121..383657) [537 bp, 178 aa] {ON} YER134C
           (REAL)
          Length = 178

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 216 IGHAKAALLNQYFAQAYKGKMIIRFDDTNPSKEKEEF 252
           IGH K  L N Y     K K I  FDD N ++E E++
Sbjct: 115 IGHLKDGLKNLYNISDLKSKRICLFDDENRNREVEKY 151

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,065,073
Number of extensions: 3143131
Number of successful extensions: 9404
Number of sequences better than 10.0: 72
Number of HSP's gapped: 9562
Number of HSP's successfully gapped: 72
Length of query: 708
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 591
Effective length of database: 40,065,477
Effective search space: 23678696907
Effective search space used: 23678696907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)