Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_6.2311.195ON54354327600.0
Smik_10.811.195ON53354225110.0
Skud_10.631.195ON53354225100.0
YJL153C (INO1)1.195ON53354224780.0
KLLA0D16412g1.195ON52954120440.0
CAGL0I06050g1.195ON53853820180.0
SAKL0F00396g1.195ON52753419820.0
TDEL0C035801.195ON53053419680.0
ZYRO0G18150g1.195ON53053618840.0
KAFR0F018601.195ON54254118720.0
TPHA0A028801.195ON54054418380.0
Kpol_2001.171.195ON47147017960.0
TBLA0C020701.195ON53654817900.0
NCAS0I027501.195ON58353917850.0
KNAG0C025201.195ON59253017770.0
NDAI0B001201.195ON56756017190.0
Smik_4.2013.154ON46476732.6
TBLA0F023507.335ON556114733.0
Smik_15.3828.604ON82983724.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_6.231
         (543 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C ...  1067   0.0  
Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {O...   971   0.0  
Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {O...   971   0.0  
YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON} ...   959   0.0  
KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]...   791   0.0  
CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly...   781   0.0  
SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly s...   768   0.0  
TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.1...   762   0.0  
ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} high...   730   0.0  
KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {O...   725   0.0  
TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {O...   712   0.0  
Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON} (48908....   696   0.0  
TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.1...   694   0.0  
NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.1...   692   0.0  
KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {O...   689   0.0  
NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195 Y...   666   0.0  
Smik_4.201 Chr4 complement(367783..369177) [1395 bp, 464 aa] {ON...    33   2.6  
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    33   3.0  
Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195...    32   4.2  

>Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C
           (REAL)
          Length = 543

 Score = 1067 bits (2760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/543 (95%), Positives = 518/543 (95%)

Query: 1   MTEDNTAPTASVRVASNKCTYTDNELLTKYSYENAVVSKTPDGRYDVTPTVQDYVFKLDL 60
           MTEDNTAPTASVRVASNKCTYTDNELLTKYSYENAVVSKTPDGRYDVTPTVQDYVFKLDL
Sbjct: 1   MTEDNTAPTASVRVASNKCTYTDNELLTKYSYENAVVSKTPDGRYDVTPTVQDYVFKLDL 60

Query: 61  NKPAKXXXXXXXXXXXXXSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGID 120
           NKPAK             STFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGID
Sbjct: 61  NKPAKLGVMLVGLGGNNGSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGID 120

Query: 121 AQGNDVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLK 180
           AQGNDVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLK
Sbjct: 121 AQGNDVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLK 180

Query: 181 PLPSIYYPDFIAANQDQRANNCINLDEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVI 240
           PLPSIYYPDFIAANQDQRANNCINLDEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVI
Sbjct: 181 PLPSIYYPDFIAANQDQRANNCINLDEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVI 240

Query: 241 VLWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNT 300
           VLWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNT 300

Query: 301 FVPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360
           FVPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL
Sbjct: 301 FVPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360

Query: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYS 420
           SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYS
Sbjct: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXX 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQ            
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQENGNGNENENEN 480

Query: 481 DGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEE 540
           DGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEE
Sbjct: 481 DGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEE 540

Query: 541 RLS 543
           RLS
Sbjct: 541 RLS 543

>Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/542 (85%), Positives = 493/542 (90%), Gaps = 10/542 (1%)

Query: 1   MTEDNTAPTASVRVASNKCTYTDNELLTKYSYENAVVSKTPDGRYDVTPTVQDYVFKLDL 60
           MTEDNT P ASV+V ++KCTYT+NELLTKYSYENAVV+KT  G++DVTPTVQDYVFKLDL
Sbjct: 1   MTEDNTTPIASVKVVTDKCTYTENELLTKYSYENAVVTKTAGGQFDVTPTVQDYVFKLDL 60

Query: 61  NKPAKXXXXXXXXXXXXXSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGID 120
           NKP K             ST  A+ILAN+H++EFQTKEGLKKPNYFGSMTQ STLKLGID
Sbjct: 61  NKPKKLGIMLIGLGGNNGSTLVASILANRHDMEFQTKEGLKKPNYFGSMTQCSTLKLGID 120

Query: 121 AQGNDVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLK 180
           A+GNDVYAPFNSLLPM NPNDF+V+GWDIN AN +EAMQR QVLEYDLQQRLK KMS++K
Sbjct: 121 AEGNDVYAPFNSLLPMVNPNDFIVSGWDINKANLYEAMQRGQVLEYDLQQRLKAKMSTVK 180

Query: 181 PLPSIYYPDFIAANQDQRANNCINLDEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVI 240
           PLPSIYYPDFIAANQD+RANNCINLDEKG VTT+GKW+HLQQIR DIQ FKE+NSLDKVI
Sbjct: 181 PLPSIYYPDFIAANQDERANNCINLDEKGKVTTRGKWSHLQQIRRDIQHFKEENSLDKVI 240

Query: 241 VLWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNT 300
           VLWTANTERYVEV+AGVNDTM+NLLQSIKDDHEEIAPST+FAAASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYVEVTAGVNDTMQNLLQSIKDDHEEIAPSTVFAAASILEGVPYINGSPQNT 300

Query: 301 FVPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360
           FVPGLVQLAEHEG FIAGDDFKSGQTK+KSVLAQFLVDAGIKPVSIASYNHLGNNDG+NL
Sbjct: 301 FVPGLVQLAEHEGTFIAGDDFKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL 360

Query: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYS 420
           SAPKQFRSKEISKSSVIDDIIASNDILYNDKLG KVDHCIVIKYMKPVGDSKVAMDEYYS
Sbjct: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXX 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKK  S Q            
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKGSSVQEDHD-------- 472

Query: 481 DGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEE 540
             K+ESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENF+RLLIGLPSLNELRFEE
Sbjct: 473 --KYESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSLNELRFEE 530

Query: 541 RL 542
           RL
Sbjct: 531 RL 532

>Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/542 (85%), Positives = 495/542 (91%), Gaps = 10/542 (1%)

Query: 1   MTEDNTAPTASVRVASNKCTYTDNELLTKYSYENAVVSKTPDGRYDVTPTVQDYVFKLDL 60
           MTEDNT PTASVRVA+ KCTYT++ELLTKYSYENAVVSKTPDGR+DVTPTVQDYVFK+ L
Sbjct: 1   MTEDNTIPTASVRVATEKCTYTEDELLTKYSYENAVVSKTPDGRFDVTPTVQDYVFKVGL 60

Query: 61  NKPAKXXXXXXXXXXXXXSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGID 120
           +KP K             ST  A++LANKH+IEF TKEGLKKPNYFGSMTQSSTLKLG+D
Sbjct: 61  DKPDKLGIMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVD 120

Query: 121 AQGNDVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLK 180
           A GNDVYAPFNSLLPM NPNDFV++GWDIN+AN  EAMQRAQVLEYDLQQRL ++MS++K
Sbjct: 121 AAGNDVYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVK 180

Query: 181 PLPSIYYPDFIAANQDQRANNCINLDEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVI 240
           PLPS+YYPDFIAANQD+RANNCIN+D KG VTT GKWAHLQQIRHDIQ FK++NSLDKVI
Sbjct: 181 PLPSVYYPDFIAANQDERANNCINVDAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVI 240

Query: 241 VLWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNT 300
           VLWTANTERYVE+SAGVNDTMENLLQSIK+DHEEIAPSTIFAAASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300

Query: 301 FVPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360
           FVPGLVQLAEHE  FIAGDD KSGQTK+KSVLAQFLVDAGIKP+SIASYNHLGNNDG+NL
Sbjct: 301 FVPGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNL 360

Query: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYS 420
           SAPKQFRSKEISKSSVIDDIIASNDILYNDKLG KVDHCIVIKYMKPVGDSKVAMDEYYS
Sbjct: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXX 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYK+ + +Q            
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQ----------ED 470

Query: 481 DGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEE 540
           DGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQR+ALENFMRLLIGLPSLNELRFEE
Sbjct: 471 DGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEE 530

Query: 541 RL 542
           RL
Sbjct: 531 RL 532

>YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON}
           INO1Inositol-3-phosphate synthase, involved in synthesis
           of inositol phosphates and inositol-containing
           phospholipids; transcription is coregulated with other
           phospholipid biosynthetic genes by Ino2p and Ino4p,
           which bind the UASINO DNA element
          Length = 533

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/542 (84%), Positives = 490/542 (90%), Gaps = 10/542 (1%)

Query: 1   MTEDNTAPTASVRVASNKCTYTDNELLTKYSYENAVVSKTPDGRYDVTPTVQDYVFKLDL 60
           MTEDN AP  SV+V ++KCTY DNELLTKYSYENAVV+KT  GR+DVTPTVQDYVFKLDL
Sbjct: 1   MTEDNIAPITSVKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQDYVFKLDL 60

Query: 61  NKPAKXXXXXXXXXXXXXSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGID 120
            KP K             ST  A++LANKHN+EFQTKEG+K+PNYFGSMTQ STLKLGID
Sbjct: 61  KKPEKLGIMLIGLGGNNGSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGID 120

Query: 121 AQGNDVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLK 180
           A+GNDVYAPFNSLLPM +PNDFVV+GWDINNA+ +EAMQR+QVLEYDLQQRLK KMS +K
Sbjct: 121 AEGNDVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVK 180

Query: 181 PLPSIYYPDFIAANQDQRANNCINLDEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVI 240
           PLPSIYYPDFIAANQD+RANNCINLDEKG+VTT+GKW HLQ+IR DIQ+FKE+N+LDKVI
Sbjct: 181 PLPSIYYPDFIAANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVI 240

Query: 241 VLWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNT 300
           VLWTANTERYVEVS GVNDTMENLLQSIK+DHEEIAPSTIFAAASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300

Query: 301 FVPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360
           FVPGLVQLAEHEG FIAGDD KSGQTK+KSVLAQFLVDAGIKPVSIASYNHLGNNDG+NL
Sbjct: 301 FVPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL 360

Query: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYS 420
           SAPKQFRSKEISKSSVIDDIIASNDILYNDKLG KVDHCIVIKYMKPVGDSKVAMDEYYS
Sbjct: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXX 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFC+RVSYKK D  +            
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDA--------- 471

Query: 481 DGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEE 540
            GKFE+FYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENF+RLLIGLPS NELRFEE
Sbjct: 472 -GKFENFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEE 530

Query: 541 RL 542
           RL
Sbjct: 531 RL 532

>KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]
           {ON} highly similar to uniprot|P11986 Saccharomyces
           cerevisiae YJL153C INO1 Inositol 1-phosphate synthase
           involved in synthesis of inositol phosphates and
           inositol- containing phospholipids transcription is
           coregulated with other phospholipid biosynthetic genes
           by Ino2p and Ino4p which bind the UASINO DNA element
          Length = 529

 Score =  791 bits (2044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/541 (70%), Positives = 442/541 (81%), Gaps = 18/541 (3%)

Query: 6   TAPTA---SVRVASNKCTYTDNELLTKYSYENAVVSKTPDGRYDVTPTVQDYVFKLDLNK 62
           TAPT    +V+VA++   +++ EL TKY+Y NA+V K+ DG ++V P  QDY FK+DL  
Sbjct: 2   TAPTVFKPTVKVATDVAEFSETELTTKYTYRNAIVEKSADGVFNVEPVTQDYEFKVDLKL 61

Query: 63  PAKXXXXXXXXXXXXXSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGIDAQ 122
           P K             +TF A+ILANKH ++FQTKEGLK+ NY+GS+TQSSTLKLG+DA+
Sbjct: 62  P-KVGVMLVGLGGNNGTTFLASILANKHKVKFQTKEGLKEANYYGSVTQSSTLKLGVDAE 120

Query: 123 GNDVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPL 182
           GNDVYAPFNSL+PM +PNDF V+GWDIN A+   AM RA+VL  DLQ +L+ +MS+ KPL
Sbjct: 121 GNDVYAPFNSLVPMVSPNDFYVSGWDINGADLGTAMARAEVLGVDLQNKLRQEMSAHKPL 180

Query: 183 PSIYYPDFIAANQDQRANNCINLDEK-GHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVIV 241
           PSIYYPDFIAANQD+RA+NC N D K G V+ K KW+H++ IR+DI+ FKE N LDKV+V
Sbjct: 181 PSIYYPDFIAANQDERADNCFNRDGKAGPVSVKDKWSHVEHIRNDIRQFKENNGLDKVLV 240

Query: 242 LWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTF 301
           LWTANTERY ++  GVNDT ENL+ +I+ DH EIAPST+FA ASILE VPYINGSPQNTF
Sbjct: 241 LWTANTERYADIVTGVNDTAENLINAIRSDHAEIAPSTVFAVASILENVPYINGSPQNTF 300

Query: 302 VPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLS 361
           VPG++ LAE EGAFIAGDDFKSGQTKMKSVLAQFLVDAGI+PVSIASYNHLGNNDG+NLS
Sbjct: 301 VPGVIDLAEKEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLS 360

Query: 362 APKQFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYSE 421
           +P+QF+SKEISK+SV+DDII SN ILYNDKLGNK+DHCIVIKYM  VGDSKVAMDEYYSE
Sbjct: 361 SPQQFKSKEISKASVVDDIIESNQILYNDKLGNKIDHCIVIKYMPAVGDSKVAMDEYYSE 420

Query: 422 LMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXXD 481
           LMLGGHNRISIHNVCEDSLLATPLIIDLLVM EFCSR+ YKK +                
Sbjct: 421 LMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCSRIKYKKIND-------------LS 467

Query: 482 GKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEER 541
           G + SFYPVLT LSYWLKAPLTRPGF  +NGLNKQR ALENF+RLLIGLP+L+ELRFEER
Sbjct: 468 GGYHSFYPVLTMLSYWLKAPLTRPGFKAINGLNKQRAALENFLRLLIGLPALDELRFEER 527

Query: 542 L 542
           L
Sbjct: 528 L 528

>CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly
           similar to uniprot|P11986 Saccharomyces cerevisiae
           YJL153c INO1 myo-inositol-1-phosphate synthase
          Length = 538

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/538 (69%), Positives = 441/538 (81%), Gaps = 14/538 (2%)

Query: 11  SVRV--ASNKCTYTDNELLTKYSYENAVVSKTPDG-RYDVTPTVQDYVFKLDLNKPAKXX 67
           S+RV    +K +Y +NELLT Y+Y   VV    D  +++VTP  ++Y FK+DLNKP +  
Sbjct: 8   SIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERLG 67

Query: 68  XXXXXXXXXXXSTFTAAILANKHNIEFQT--KEGLKKPNYFGSMTQSSTLKLGIDAQGND 125
                      ST  AA+LANKHN+ F+T  KEGL +PNY+GS+TQSST+KLG+D++G D
Sbjct: 68  VMLVGLGGNNGSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKD 127

Query: 126 VYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPLPSI 185
           VY PFNSL+PM NPNDFVV+GWDIN A   +AM+RA VLE DL+ +L   M   KPL S+
Sbjct: 128 VYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSV 187

Query: 186 YYPDFIAANQDQRANNCINLD-EKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVIVLWT 244
           YYPDFIAANQD+RA+NC+N+D + G VTT GKW HL  IR+DI++FK++N LDKVI+LWT
Sbjct: 188 YYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWT 247

Query: 245 ANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPG 304
           ANTERYVE+  GVNDTMENLL++IK+DH EIAPSTIFAAASILE  PYINGSPQNTFVPG
Sbjct: 248 ANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPG 307

Query: 305 LVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLSAPK 364
           L++LAE   + IAGDDFKSGQTKMKSVLAQFLVDAGI+PVSIASYNHLGNNDG+NLS+P+
Sbjct: 308 LIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQ 367

Query: 365 QFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYSELML 424
           QFRSKEISK+SV+DDII SN ILYNDKLGNK+DHCIVIKYM  VGDSKVAMDEYYSELML
Sbjct: 368 QFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELML 427

Query: 425 GGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXXDGKF 484
           GGHNRISIHNVCEDSLLATPLIIDL+VMTEFCSRV+Y+  D                G F
Sbjct: 428 GGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAK--------GDF 479

Query: 485 ESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEERL 542
           E+FYPVL+FLSYWLKAPLT+PG+ P+NGLNKQRTALENF+RLLIGLP+++ELRFEERL
Sbjct: 480 ENFYPVLSFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537

>SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 527

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/534 (68%), Positives = 428/534 (80%), Gaps = 13/534 (2%)

Query: 9   TASVRVASNKCTYTDNELLTKYSYENAVVSKTPDGRYDVTPTVQDYVFKLDLNKPAKXXX 68
           T  V+VA+  C Y  ++L+T Y+Y+N +VSK  DG Y   P V++Y FK+DL  P K   
Sbjct: 6   TPKVKVATENCQYRGSDLITNYTYKNTIVSKCSDGSYSAQPVVENYQFKVDLKVP-KLGV 64

Query: 69  XXXXXXXXXXSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGIDAQGNDVYA 128
                     STF A+ILANKH I+F +KEG    NY+GS+TQ+ST+KLGIDA GNDVY 
Sbjct: 65  MLVGLGGNNGSTFIASILANKHKIQFNSKEGTIGANYYGSVTQASTIKLGIDADGNDVYV 124

Query: 129 PFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPLPSIYYP 188
           PFNS+LP  NPNDFVV GWDIN +N +EAM RA+VLEYDLQ++LK +M  + PLPS+YYP
Sbjct: 125 PFNSVLPFVNPNDFVVGGWDINGSNMYEAMVRAKVLEYDLQEKLKAEMEKIHPLPSVYYP 184

Query: 189 DFIAANQDQRANNCINLDEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVIVLWTANTE 248
           D+IAANQD+RANNCIN   KG V+TK KW H+++IR DI+ FKE N LDKVIVLWTANTE
Sbjct: 185 DYIAANQDERANNCIN-RVKGTVSTKNKWDHVEKIRKDIRDFKETNGLDKVIVLWTANTE 243

Query: 249 RYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQL 308
           RY ++  GVND  ENLL++IK DH EI+PS IFA ASILE VPYINGSPQNTFVPG+V+L
Sbjct: 244 RYSDLIDGVNDNAENLLKAIKSDHTEISPSAIFAVASILENVPYINGSPQNTFVPGIVEL 303

Query: 309 AEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLSAPKQFRS 368
           AE   +FI GDDFKSGQTK+KSVLAQFLVDAGI+PVSIASYNHLGNNDG+NLS+PKQF+S
Sbjct: 304 AEKNKSFIGGDDFKSGQTKLKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPKQFKS 363

Query: 369 KEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHN 428
           KEISKSSV+DDIIASN ILYN+KLG K+DHCIVIKYM  V DSKVAMDEYYSELMLGGHN
Sbjct: 364 KEISKSSVVDDIIASNSILYNEKLGKKIDHCIVIKYMPAVADSKVAMDEYYSELMLGGHN 423

Query: 429 RISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXXDGKFESFY 488
           RISIHNVCEDSLLATPLIIDLLVM+EF SRV+YKK +S               G +E  Y
Sbjct: 424 RISIHNVCEDSLLATPLIIDLLVMSEFLSRVTYKKLESDASA-----------GSYEKLY 472

Query: 489 PVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEERL 542
            +L+FLSYWLKAPLTR GF  +NGLNKQR ALENF+RLLIGLP+++ELRFEERL
Sbjct: 473 SILSFLSYWLKAPLTRKGFETINGLNKQRMALENFLRLLIGLPAIDELRFEERL 526

>TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.195
           YJL153C
          Length = 530

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/534 (68%), Positives = 433/534 (81%), Gaps = 16/534 (2%)

Query: 11  SVRVASNKCTYTDNELLTKYSYENAVVSKTP-DGRYDVTPTVQDYVFKLDLNKPAKXXXX 69
           ++ VA++K  Y++ +L T+Y Y N+VV+K+  DG  +V PT QDY F++DL  P K    
Sbjct: 10  TINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDLKIP-KIGVM 68

Query: 70  XXXXXXXXXSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGIDAQGNDVYAP 129
                    +T  A++LAN+  I F TK+G K+ NY+GS+TQSST+KLGID QGNDVY P
Sbjct: 69  LVGLGGNNGTTLVASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDEQGNDVYVP 128

Query: 130 FNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPLPSIYYPD 189
           FNS+LP  +PNDFVV GWDIN AN  +AM R+QVLEYDLQQ+L+ +M+   PLPSIYYPD
Sbjct: 129 FNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPSIYYPD 188

Query: 190 FIAANQDQRANNCINLDEK-GHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVIVLWTANTE 248
           FIAANQD+RA+NCIN D K G+V+TKGKW+H++QIR DI++FK  N LDKVIVLWTANTE
Sbjct: 189 FIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVIVLWTANTE 248

Query: 249 RYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQL 308
           RY +V + VND  +NLL +IK+DHEEIAPSTIFA ASILEGVPYINGSPQNTFVPG++ L
Sbjct: 249 RYADVLSNVNDNADNLLAAIKNDHEEIAPSTIFAVASILEGVPYINGSPQNTFVPGVIDL 308

Query: 309 AEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLSAPKQFRS 368
           AE   A IAGDDFKSGQTK+KSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL++ +QF+S
Sbjct: 309 AEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLTSERQFKS 368

Query: 369 KEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHN 428
           KEISK SV+DD+IASN ILYN+K GNK+DHCIVIKYM  VGDSKVAMDEYYSELMLGGHN
Sbjct: 369 KEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHN 428

Query: 429 RISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXXDGKFESFY 488
           RISIHNVCEDSLLATPLIIDL+VM EFCSRVSYKK  S Q               +ESFY
Sbjct: 429 RISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQ-------------SYESFY 475

Query: 489 PVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEERL 542
            +L+FLSYWLKAPLTR GF  +NGLNKQR  +ENF+RLLIGLP+L+ELRFEE+L
Sbjct: 476 SILSFLSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529

>ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 530

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/536 (66%), Positives = 422/536 (78%), Gaps = 16/536 (2%)

Query: 9   TASVRVASNKCTYTDNELLTKYSYENAVVSK-TPDGRYDVTPTVQDYVFKLDLNKPAKXX 67
           T SV+VA++K  Y++ EL TKY+Y N++V++       DV P  Q+Y FK+DL  P +  
Sbjct: 8   TPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDLKLP-RVG 66

Query: 68  XXXXXXXXXXXSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGIDAQGNDVY 127
                      +TF A+ILAN+  ++F  KEGLK+ NY+GS+TQ STLKLG+   GND Y
Sbjct: 67  VMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRPDGNDFY 126

Query: 128 APFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPLPSIYY 187
            PFNSLLP  +PNDF VTGWDI+  N  +AM+RAQVLEYDLQ++LK +MS  KPLPSIYY
Sbjct: 127 VPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSIYY 186

Query: 188 PDFIAANQDQRANNCINL-DEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVIVLWTAN 246
           PDFIAANQD RA+NCIN  +  G  +TK KW HL++IR DI+ FK++  LDKVIVLWTAN
Sbjct: 187 PDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVIVLWTAN 246

Query: 247 TERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLV 306
           TERY ++  GVNDT +NLL +IK D EEIAPSTIFA ASILEG  YINGSPQNTFVPG++
Sbjct: 247 TERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFVPGVI 306

Query: 307 QLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLSAPKQF 366
           +LAE E +FIAGDDFKSGQTK+KSVLAQFLV+AGIKP SIASYNHLGNNDG+NLS+ +QF
Sbjct: 307 ELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSSERQF 366

Query: 367 RSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGG 426
           +SKEISK SV+DD++ASN +LYNDKLGNK+DHCIVIKYM  VGDSKVAMDEYYSELMLGG
Sbjct: 367 KSKEISKKSVVDDVVASNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGG 426

Query: 427 HNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXXDGKFES 486
           HNRISIHNVCEDSLLATPLIIDLLVM EFC+RVSYK+                   ++  
Sbjct: 427 HNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGST-------------EYGK 473

Query: 487 FYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEERL 542
           FY +L+FLSYWLKAPLTR G+  +NGLNKQR+ LENFMRLLIGLP+ +ELRFEERL
Sbjct: 474 FYNILSFLSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529

>KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {ON}
           Anc_1.195 YJL153C
          Length = 542

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/541 (65%), Positives = 422/541 (78%), Gaps = 19/541 (3%)

Query: 6   TAPTASVRVASNKCTYT--DNELLTKYSYENAVVSK-TPDGRYDVTPTVQDYVFKLDLNK 62
           TAP  SV+     CT +  +NEL+++Y Y+N++V K       ++TP  QDY FK++LN 
Sbjct: 16  TAPRPSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLN- 74

Query: 63  PAKXXXXXXXXXXXXXSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGIDAQ 122
           P K             STF A++LANK+NI F T+EG  +PNY+GSMTQSSTLKLGID++
Sbjct: 75  PNKVGIMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSE 134

Query: 123 GNDVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPL 182
           GNDV+APFNS+LPM NPNDFVV+GWDIN+ N F AMQRA+VLEYDLQ +LK  M S KPL
Sbjct: 135 GNDVFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPL 194

Query: 183 PSIYYPDFIAANQDQRANNCINLDEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVIVL 242
            SIYYPDFIA NQ +RANNCIN ++ G   T+ KW  L +IR DI+ FK  N+L+ +IVL
Sbjct: 195 KSIYYPDFIAMNQFERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVL 254

Query: 243 WTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTFV 302
           WTANTER VE+  GVNDTM+NL+ SIKD+H EI+PS IFA A+I+E VPYINGSPQNTFV
Sbjct: 255 WTANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFV 314

Query: 303 PGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLSA 362
           PGL++LAEH    IAGDDFK+GQTK+KSV+ QFLVDAGIKPVSIASYNHLGNNDG NLS+
Sbjct: 315 PGLIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSS 374

Query: 363 PKQFRSKEISKSSVIDDIIASNDILYNDKLG-NKVDHCIVIKYMKPVGDSKVAMDEYYSE 421
             QFRSKEISKSSVIDD I SN+IL+N K   +K +HCIVIKYMK VGDSKVAMDEYYS+
Sbjct: 375 HAQFRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQ 434

Query: 422 LMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXXD 481
           LMLGGHNRISIHNVCEDSLLA+P+IIDLLVMTEF SR++YKK    Q             
Sbjct: 435 LMLGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQ------------- 481

Query: 482 GKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEER 541
            +F  FYP+L+FLSYWLKAPLTR GF P+N LN+QR ALENF+RLL+GLP  +ELRFEER
Sbjct: 482 -EFHKFYPILSFLSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEER 540

Query: 542 L 542
           L
Sbjct: 541 L 541

>TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {ON}
           Anc_1.195 YJL153C
          Length = 540

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/544 (64%), Positives = 421/544 (77%), Gaps = 27/544 (4%)

Query: 12  VRVASNKCTYTDNELLTKYSYENAVVSKTPDGRYDVTPTVQ-DYVFKLDLNKPAKXXXXX 70
           + V ++KCT   N L +KY+Y + +V+K       +  TV+ DY F +DLN P K     
Sbjct: 10  IIVNNDKCTIEGNTLKSKYTYTSNLVTKNDSTNSYIVDTVKKDYEFNVDLNLP-KLGIML 68

Query: 71  XXXXXXXXSTFTAAILANKHNIEFQTK--EGLKKPNYFGSMTQSSTLKLGIDAQGND-VY 127
                   +T  A++LANK+N+EF +K  +GLKK NY+GS+TQSST+KLGID + ND +Y
Sbjct: 69  VGLGGNNGTTLLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGIDPKTNDEIY 128

Query: 128 APFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPLPSIYY 187
            PF  +LP++NPNDFV+TGWDI++ N FEAMQRA VLE+DLQ +LK +M  +KPL SIYY
Sbjct: 129 VPFTDILPLSNPNDFVITGWDISDLNCFEAMQRACVLEHDLQMQLKDEMEKIKPLKSIYY 188

Query: 188 PDFIAANQDQRANNCINLDEKGHVT---------TKGKWAHLQQIRHDIQSFKEKNSLDK 238
           PDFIA NQ++RAN+C N   +             TK KW+H++QIR DI++FK++N+LDK
Sbjct: 189 PDFIALNQNERANHCFNRKSEAEGNKDPLSLDGLTKNKWSHVEQIRDDIRNFKKENNLDK 248

Query: 239 VIVLWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQ 298
           VIVLWTANTERY  + AGVND  +NLL +IK+DH E++PSTIFA ASILEGVPYINGSPQ
Sbjct: 249 VIVLWTANTERYSTIEAGVNDNADNLLNAIKNDHSEVSPSTIFAVASILEGVPYINGSPQ 308

Query: 299 NTFVPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGF 358
           NTFVPG++ LAE E +FIAGDDFKSGQTKMKSVLAQFLVDAGIKP+SIASYNHLGNNDGF
Sbjct: 309 NTFVPGVIDLAEREHSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNNDGF 368

Query: 359 NLSAPKQFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEY 418
           NLS+P QF+SKEISK  V DD+I SN IL+NDK+G  +DHCIVIKY+  VGDSKVAMDEY
Sbjct: 369 NLSSPMQFKSKEISKRGVCDDMIESNQILFNDKVGKTIDHCIVIKYLNAVGDSKVAMDEY 428

Query: 419 YSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXX 478
           YSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFC+RV+YKK               
Sbjct: 429 YSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVTYKKLGEGAT--------- 479

Query: 479 XXDGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRF 538
                +E FYPVLT LSYWLKAPLTRPGF P+NGL KQR ALENF+RLLIGLP L++LRF
Sbjct: 480 ----DYEQFYPVLTLLSYWLKAPLTRPGFKPINGLMKQRAALENFLRLLIGLPPLDDLRF 535

Query: 539 EERL 542
           EERL
Sbjct: 536 EERL 539

>Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON}
           (48908..50323) [1416 nt, 472 aa]
          Length = 471

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/470 (71%), Positives = 390/470 (82%), Gaps = 16/470 (3%)

Query: 79  STFTAAILANKHNIEFQTK--EGLKKPNYFGSMTQSSTLKLGIDAQGN-DVYAPFNSLLP 135
           +TF A++LANK+N+EF +K  +GLKK NY+GS+TQSST+KLGI+ + N DVY PFN +LP
Sbjct: 11  TTFLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGINPETNEDVYIPFNEILP 70

Query: 136 MANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPLPSIYYPDFIAANQ 195
             NPNDFVV+GWDINN+N  EAMQRA VLEYDLQ +LK  M  + PL SIYYPDFIA NQ
Sbjct: 71  FVNPNDFVVSGWDINNSNCSEAMQRACVLEYDLQSKLKDYMKDVTPLKSIYYPDFIAINQ 130

Query: 196 DQRANNCINL---DEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVIVLWTANTERYVE 252
           ++RANN IN    D      +KGKW+H++ IR+DI++FK +N+LDKVIVLWTANTERY  
Sbjct: 131 NERANNVINRGTNDLSLENLSKGKWSHVEHIRNDIRNFKNENNLDKVIVLWTANTERYSV 190

Query: 253 VSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQLAEHE 312
           +  G+NDT +NL+ SIK+DH E++PSTIFA ASILEGVPYINGSPQNTFVPG+++LAE E
Sbjct: 191 IENGINDTADNLINSIKNDHAEVSPSTIFAVASILEGVPYINGSPQNTFVPGVIELAERE 250

Query: 313 GAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLSAPKQFRSKEIS 372
            +FIAGDDFKSGQTKMKSVLAQFLVDAGIKP+SIASYNHLGNNDG+NLS+P QF+SKEIS
Sbjct: 251 HSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSSPMQFKSKEIS 310

Query: 373 KSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHNRISI 432
           K  V DD+I SN IL+NDK+G  +DHCIVIKYM  VGDSKVAMDEYYSELMLGGHNRISI
Sbjct: 311 KRGVCDDMIESNQILFNDKVGKTIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHNRISI 370

Query: 433 HNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXXDGKFESFYPVLT 492
           HNVCEDSLLATPLIIDLLVMTEFC+RV+YKK D +               +FE FYPVLT
Sbjct: 371 HNVCEDSLLATPLIIDLLVMTEFCTRVTYKKLDGADATKK----------EFEPFYPVLT 420

Query: 493 FLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEERL 542
            LSYWLKAPLTRPGF  +NGL KQR ALENFMRLLIGLP L+ELRFEERL
Sbjct: 421 LLSYWLKAPLTRPGFKAINGLMKQRAALENFMRLLIGLPPLDELRFEERL 470

>TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.195
           YJL153C
          Length = 536

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/548 (62%), Positives = 422/548 (77%), Gaps = 19/548 (3%)

Query: 1   MTEDNTAPTASVRVASNKCTYTDNELLTKYSYENAVV-SKTPDGRYDVTPTVQDYVFKLD 59
           MT     P  +V+V ++KC YT++EL+TKY+Y+N +V S      +DV    +DY FK D
Sbjct: 1   MTAQTFVP--AVKVQTDKCRYTEDELITKYTYKNVLVDSNQAKTSFDVKIQNEDYEFKTD 58

Query: 60  LNKPAKXXXXXXXXXXXXXSTFTAAILANKHNIEFQTK--EGLKKPNYFGSMTQSSTLKL 117
           L  P K             +TF A++LANK  ++F+TK  +GLK  NY+GS+TQ+ST+KL
Sbjct: 59  LKIP-KVGVMLVGMGGNNGTTFVASVLANKKKLKFRTKNFKGLKDANYYGSVTQASTVKL 117

Query: 118 GIDAQG-NDVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKM 176
           G+D++  NDVY PFNSLLPM NPNDFVV+GWDI + N ++AM  +QVLEYDL Q+LK +M
Sbjct: 118 GVDSETLNDVYIPFNSLLPMVNPNDFVVSGWDIQDYNCYDAMVESQVLEYDLIQQLKPEM 177

Query: 177 SSLKPLPSIYYPDFIAANQDQRANNCINLDEKGH--VTTKGKWAHLQQIRHDIQSFKEKN 234
           S +KPL SIYYPDF+A NQ +RANNCIN  +     +  K K + L  IR+DI++FK++N
Sbjct: 178 SQIKPLKSIYYPDFLAMNQIERANNCINRKDNSSEVIDIKNKQSDLDHIRNDIKTFKQEN 237

Query: 235 SLDKVIVLWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYIN 294
            LDKVIVLWTA+TERY ++  GVNDT +NLL SIK  HEEIAPSTIFA ASILEG  YIN
Sbjct: 238 HLDKVIVLWTASTERYADIIEGVNDTADNLLNSIKTSHEEIAPSTIFAVASILEGAIYIN 297

Query: 295 GSPQNTFVPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGN 354
           GSPQNT VPG+V L++ E   IAGDDFK+GQTK+KSVLAQFL+DAGIKP+S+ASYNHLGN
Sbjct: 298 GSPQNTLVPGVVDLSKRENTIIAGDDFKTGQTKLKSVLAQFLIDAGIKPLSVASYNHLGN 357

Query: 355 NDGFNLSAPKQFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVA 414
           NDG+NLSAPKQFRSKEISKSSVIDD+I SN+ILYN K G +VDHCIVIKYM  VGD+KVA
Sbjct: 358 NDGYNLSAPKQFRSKEISKSSVIDDMIESNEILYNAKTGAEVDHCIVIKYMPAVGDNKVA 417

Query: 415 MDEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXX 474
           MDEYYSELMLGGHNRIS+HNVCEDSLLATP++IDL+VM EF SR+SYK+ +S        
Sbjct: 418 MDEYYSELMLGGHNRISVHNVCEDSLLATPIMIDLMVMVEFISRISYKRVNSRD------ 471

Query: 475 XXXXXXDGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLN 534
                 + ++ +F   L+FLSYWLKAP+ + GF P+NGLNKQR ALENF+RLLIGLP  +
Sbjct: 472 ----DEELEYSTFNSTLSFLSYWLKAPMVKKGFQPINGLNKQRLALENFLRLLIGLPPND 527

Query: 535 ELRFEERL 542
           ELRFEERL
Sbjct: 528 ELRFEERL 535

>NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.195
           YJL153C
          Length = 583

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/539 (64%), Positives = 412/539 (76%), Gaps = 23/539 (4%)

Query: 11  SVRVASNKCTYT--DNELLTKYSYENAVV-SKTPDGRYDVTPTVQDYVFKLDLNKPAKXX 67
           +V +A+ KC Y+  DN LLT Y Y+ + V +   DG   V+   QDY FK+DL  P K  
Sbjct: 62  NVVLATGKCQYSAKDNVLLTDYKYKTSTVKNNKADGSIKVSLEEQDYKFKIDLKVP-KVG 120

Query: 68  XXXXXXXXXXXSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGIDAQ-GNDV 126
                      ST  A+ILANKHNI F  K+G  KPNY GSMTQS+T+ LG D + G D 
Sbjct: 121 VMLVGFGGNNGSTLLASILANKHNISFHNKDGEIKPNYLGSMTQSATVHLGRDEETGRDF 180

Query: 127 YAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPLPSIY 186
           + PFN++LPM NPND +VTGWDI+N N  E+MQRAQVL+YDLQ++L   M    P+ SIY
Sbjct: 181 FQPFNAVLPMVNPNDLIVTGWDISNLNLAESMQRAQVLDYDLQRQLTPLMKEYTPMKSIY 240

Query: 187 YPDFIAANQDQRANNCINLDEKG-HVTTKGKWAHLQQIRHDIQSFKEKNSLDKVIVLWTA 245
           YP+FIAANQ  RANNCIN   KG   TTKGKW H+ Q+R DI++FK +N LDKVIVLWTA
Sbjct: 241 YPEFIAANQFDRANNCIN--SKGDEFTTKGKWDHMMQVRSDIKTFKTENQLDKVIVLWTA 298

Query: 246 NTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGL 305
           NTE++ ++  GVNDT ENLLQ+IK+DHEEIAPST+FA ASILEGVPYINGSPQNTFVPGL
Sbjct: 299 NTEKFAQIVPGVNDTHENLLQAIKNDHEEIAPSTLFAVASILEGVPYINGSPQNTFVPGL 358

Query: 306 VQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLSAPKQ 365
           ++LAEHE   IAGDDFK+GQTK+KSVL QFLVDAGI+PVSIASYNHLGNNDG NLS+  Q
Sbjct: 359 IKLAEHENVLIAGDDFKTGQTKLKSVLTQFLVDAGIRPVSIASYNHLGNNDGKNLSSQMQ 418

Query: 366 FRSKEISKSSVIDDIIASNDILY-NDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYSELML 424
           F+SKEISKS VI+DI+ SN I+Y +D    ++DHCIVIKYM  VGDSKVAMDEYY+ELML
Sbjct: 419 FKSKEISKSGVINDILESNSIMYGDDPEKARIDHCIVIKYMPAVGDSKVAMDEYYNELML 478

Query: 425 GGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXXDGKF 484
           GGHNRIS+HNVCEDSLLA P+I+DL++M EFCSRV+YK+A+               +G +
Sbjct: 479 GGHNRISLHNVCEDSLLAAPIILDLVIMCEFCSRVTYKEAND--------------NGDY 524

Query: 485 ESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEERLS 543
           + F+PVLT LSYWLKAPL R  F PVNGL KQR ALENFMRLLIGLP+ +ELRFEERL+
Sbjct: 525 KKFHPVLTLLSYWLKAPLAREDFLPVNGLMKQRAALENFMRLLIGLPANDELRFEERLA 583

>KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {ON}
           Anc_1.195 YJL153C
          Length = 592

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/530 (65%), Positives = 404/530 (76%), Gaps = 16/530 (3%)

Query: 19  CTYT--DNELLTKYSYENAVVSKTPD--GRYDVTPTVQDYVFKLDLNKPAKXXXXXXXXX 74
           CT +   NEL++ + Y+N V+   P       ++P   +Y FK+DL+ P K         
Sbjct: 72  CTLSRETNELVSSFKYQNTVIDTDPSTGAVRGLSPREINYNFKVDLSVPEKVGVLLVGFG 131

Query: 75  XXXXSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGIDAQGNDVYAPFNSLL 134
               ST  A+ILAN+  + F  KEG ++ N+FGSMTQSST+KLG+D +GNDV+ PFNS+L
Sbjct: 132 GNNGSTLLASILANRQKMVFNNKEGPQRANFFGSMTQSSTMKLGVDVKGNDVFVPFNSVL 191

Query: 135 PMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPLPSIYYPDFIAAN 194
           PMA+P +FVV GWDINNAN FEAMQR  VLEYDLQ +LK++M ++ P+ S+YYPDFIA N
Sbjct: 192 PMADPTEFVVDGWDINNANLFEAMQRGHVLEYDLQMKLKSQMENIVPMKSVYYPDFIALN 251

Query: 195 QDQRANNCINLDEKGH-VTTKGKWAHLQQIRHDIQSFKEKNSLDKVIVLWTANTERYVEV 253
           Q  RANNCIN  + G   +T  K   L+QIR DI+ FK  N LDKVIVLWTANTER V++
Sbjct: 252 QFDRANNCINATQGGEGFSTAQKRKDLEQIRKDIRHFKATNKLDKVIVLWTANTERCVDI 311

Query: 254 SAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQLAEHEG 313
              VND+ ++LL++I+D+HEEIAPSTIFAAASILEGVPYINGSPQNTFVPGL+ LAE   
Sbjct: 312 IPSVNDSADSLLKAIEDNHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLIDLAERHD 371

Query: 314 AFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLSAPKQFRSKEISK 373
             IAGDDFKSGQTK+KSVL QFLVDAGIKPVSIASYNHLGNNDG NLS+ +QFRSKEISK
Sbjct: 372 VLIAGDDFKSGQTKLKSVLMQFLVDAGIKPVSIASYNHLGNNDGKNLSSQRQFRSKEISK 431

Query: 374 SSVIDDIIASNDILYND-KLGNKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHNRISI 432
           SSVIDD I SN ILYND K  +KV+HCIVIKY+  VGDSKVAMDEYYSELMLGGHNRISI
Sbjct: 432 SSVIDDCIQSNKILYNDHKDKSKVNHCIVIKYLPAVGDSKVAMDEYYSELMLGGHNRISI 491

Query: 433 HNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQXXXXXXXXXXXXDGKFESFYPVLT 492
           HNVCEDSLLA PLIIDLLVMTEF SR+ Y+K +                 KF  FYP+LT
Sbjct: 492 HNVCEDSLLAAPLIIDLLVMTEFFSRIKYQKIEDG----------APPSDKFSDFYPILT 541

Query: 493 FLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEERL 542
           FLSYWLKAPLTR GF P+N LN+QR ALENF+RLLIGLP  +ELRFEERL
Sbjct: 542 FLSYWLKAPLTRKGFQPINSLNRQRLALENFLRLLIGLPPNDELRFEERL 591

>NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195
           YJL153C
          Length = 567

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/560 (60%), Positives = 412/560 (73%), Gaps = 31/560 (5%)

Query: 2   TEDNTAPTASVRVASNKCTYT--DNELLTKYSYENAVV---SKTPDGRYDVTPTVQDYVF 56
           T  N++   +  + S+KC Y+  +N LLT Y+Y   +V       +   +V+   +DY F
Sbjct: 19  TNTNSSGDFNWSLNSDKCKYSQSENALLTNYTYNKTIVDIQQSHNNNNINVSTLTKDYNF 78

Query: 57  KLDLNKPAKXXXXXXXXXXXXXSTFTAAILANKHNIEFQTKEG----LKKPNYFGSMTQS 112
           K+DL  P K             +TF A++LANK+N+ F  K+G     ++  + GSMTQS
Sbjct: 79  KVDLKIP-KIGVMLVGMGGNNGTTFLASLLANKNNLTFNNKDGPYNIKERGGFLGSMTQS 137

Query: 113 STLKLGIDAQGN-DVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQR 171
           STL LG + Q N DVY PFNS+LPM NPND +++GWDI+  N F+AMQRA+VLEYDLQ++
Sbjct: 138 STLYLGKNQQTNEDVYVPFNSILPMCNPNDLIISGWDISGENMFKAMQRAKVLEYDLQEK 197

Query: 172 LKTKMSSLKPLPSIYYPDFIAANQDQRANNCINLDEKG----HVTTKGKWAHLQQIRHDI 227
           LK  M S  PL SIYYPDFIA NQ  RA+NCIN   KG      + K KW  L  IR +I
Sbjct: 198 LKPLMESYTPLKSIYYPDFIAMNQLDRADNCINYTTKGTNHDAYSIKNKWNDLLTIRQNI 257

Query: 228 QSFKEKNSLDKVIVLWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASIL 287
           + FK  N LDKVI+LWTA TE++ EV  G+NDT ENLL SIK +H+EIAPSTIFA ASIL
Sbjct: 258 KDFKNDNKLDKVIILWTATTEKFAEVIPGINDTFENLLNSIKANHKEIAPSTIFATASIL 317

Query: 288 EGVPYINGSPQNTFVPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIA 347
           E  PYINGSPQNTFVPGL+ LAE E   IAGDDFK+GQTK+KSVLAQFL+DAGIKP+SIA
Sbjct: 318 ENCPYINGSPQNTFVPGLIDLAERENVLIAGDDFKTGQTKLKSVLAQFLIDAGIKPISIA 377

Query: 348 SYNHLGNNDGFNLSAPKQFRSKEISKSSVIDDIIASNDILY--NDKLGNK---VDHCIVI 402
           SYNHLGNNDG NLS+  QF+SKEI+KS+VIDD+I SN ILY  +DK+  K   VDHCIVI
Sbjct: 378 SYNHLGNNDGLNLSSSLQFKSKEITKSNVIDDMIKSNQILYPQSDKMKKKNKDVDHCIVI 437

Query: 403 KYMKPVGDSKVAMDEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYK 462
           KYM+ +GDSKVAMDEYY+ELMLGGHNRISIHNVCEDSLLA+P+I+DL++M EFCSR++Y 
Sbjct: 438 KYMESIGDSKVAMDEYYNELMLGGHNRISIHNVCEDSLLASPIILDLIIMCEFCSRITYI 497

Query: 463 KADSSQXXXXXXXXXXXXDGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALEN 522
           ++ + Q            DG ++ FYPVL+ LSYWLKAPLTRPG+ P+NGLNKQR AL+N
Sbjct: 498 ESGNQQ-----------GDGNYQQFYPVLSLLSYWLKAPLTRPGYEPINGLNKQRMALDN 546

Query: 523 FMRLLIGLPSLNELRFEERL 542
           FMRLLIGLP ++ELRFEERL
Sbjct: 547 FMRLLIGLPPIDELRFEERL 566

>Smik_4.201 Chr4 complement(367783..369177) [1395 bp, 464 aa] {ON}
           YDL036C (REAL)
          Length = 464

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 2/76 (2%)

Query: 376 VIDDIIASNDILYNDKLGN--KVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHNRISIH 433
           + +D I SND ++   LG   +VD   V+  +  +G SK A   +Y     G   R    
Sbjct: 353 IANDPIYSNDEVWGSNLGKNGQVDLATVVTKLDEIGKSKPAKSWFYDSYGYGEVLRQEKC 412

Query: 434 NVCEDSLLATPLIIDL 449
           +VCE  L   P   DL
Sbjct: 413 SVCESDLYTDPGPNDL 428

>TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {ON}
           Anc_7.335 YDL159W
          Length = 556

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 49/114 (42%), Gaps = 7/114 (6%)

Query: 171 RLKTKMSSLKPLPSIYYPDFIAANQDQRANNCINLDEKGHVTTKGKWAHLQQIRHDIQSF 230
           R  T M +LKP P++   +F  A  DQ  NN I +     +        L +I     SF
Sbjct: 274 RELTIMKNLKPHPNLV--EFYGAFYDQSTNNEIII-----LLEYMNCGSLDKILSTYHSF 326

Query: 231 KEKNSLDKVIVLWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAA 284
             +N + + IV+   NT     +SA V   +  L  + K  H +I PS I   +
Sbjct: 327 VNRNLIPQDIVVKWFNTLSISRISASVLTGLSYLYDNYKIIHRDIKPSNILIGS 380

>Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195W
           (REAL)
          Length = 829

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 7/83 (8%)

Query: 302 VPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLS 361
           VP L Q++  EGA       K  +  M S +A  ++D  I P      + +  ND FN++
Sbjct: 176 VPDLKQIS-TEGAA------KDKEEIMSSPMAIDMIDTNISPNKFIMNDGVARNDSFNIN 228

Query: 362 APKQFRSKEISKSSVIDDIIASN 384
             K     EI++    +D I SN
Sbjct: 229 TDKLNLENEINEKQEEEDFIKSN 251

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,436,063
Number of extensions: 2494288
Number of successful extensions: 6989
Number of sequences better than 10.0: 29
Number of HSP's gapped: 7116
Number of HSP's successfully gapped: 29
Length of query: 543
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 428
Effective length of database: 40,294,809
Effective search space: 17246178252
Effective search space used: 17246178252
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)