Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_6.1381.317ON83083042420.0
Skud_10.1591.317ON83183336850.0
YJL062W (LAS21)1.317ON83083236140.0
Smik_10.1781.317ON83183336050.0
NCAS0A092201.317ON83181918220.0
Kpol_1035.261.317ON83585318180.0
KAFR0A017301.317ON82180818080.0
SAKL0D06974g1.317ON81381318030.0
TDEL0D018601.317ON80983717950.0
NDAI0G057401.317ON85784417790.0
KNAG0C058301.317ON83081617730.0
ZYRO0G20724g1.317ON81283217500.0
Kwal_14.25871.317ON80883617190.0
TBLA0F013301.317ON82784617140.0
AEL166C1.317ON80682717100.0
CAGL0J05236g1.317ON84284916920.0
Ecym_62881.317ON80680716840.0
KLTH0H10736g1.317ON81081916750.0
KLLA0F01705g1.317ON78781716030.0
TPHA0O014801.317ON82482516050.0
KLTH0E06094g4.28ON10163774565e-46
CAGL0G04015g4.28ON10193634556e-46
Ecym_55594.28ON10143014405e-44
KLLA0C17534g4.28ON10053124352e-43
YLL031C (GPI13)4.28ON10173254333e-43
NDAI0H003204.28ON10343134325e-43
Kpol_478.14.28ON10093184253e-42
SAKL0H25542g4.28ON10133064254e-42
TPHA0F003104.28ON10263404245e-42
Kwal_55.20667singletonOFF6023104147e-42
Kwal_YGOB_55.206644.28ON9563094201e-41
KNAG0J028204.28ON10173254165e-41
KAFR0I014104.28ON10163284149e-41
ZYRO0B01034g4.28ON10093284139e-41
Smik_12.254.28ON10173244122e-40
TDEL0F016904.28ON10053224093e-40
AGR126C4.28ON10133244051e-39
NCAS0C058004.28ON10113174041e-39
Skud_12.364.28ON10163054032e-39
Suva_10.414.28ON10173094004e-39
TPHA0K021804.28ON10283213942e-38
TBLA0A085004.28ON10654243942e-38
KLLA0B07249g1.184ON9193451871e-13
NDAI0A009801.184ON9253301844e-13
AEL113C1.184ON9253321835e-13
Ecym_80941.184ON9263311825e-13
Kwal_33.138561.184ON9221931754e-12
Kpol_2001.281.184ON9193271754e-12
NCAS0B082601.184ON9243311745e-12
KLTH0F04884g1.184ON9223271702e-11
SAKL0C05434g1.184ON10353371683e-11
KNAG0C010801.184ON9313251674e-11
TBLA0C058401.184ON9473411656e-11
TDEL0C036901.184ON9203291647e-11
ZYRO0G18458g1.184ON9212031631e-10
YKL165C (MCD4)1.184ON9193301603e-10
KAFR0G005001.184ON9222011575e-10
Smik_11.641.184ON9453301567e-10
CAGL0M08448g1.184ON9213151541e-09
Skud_11.601.184ON9193281532e-09
Suva_11.581.184ON9193241522e-09
TPHA0A028001.184ON9203261479e-09
TBLA0E014804.28ON10402741272e-06
Kpol_1044.184.28ON1022249781.1
KAFR0G037603.505ON43793708.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_6.138
         (830 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON...  1638   0.0  
Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {...  1424   0.0  
YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}  LAS21Inte...  1396   0.0  
Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062...  1393   0.0  
NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa] ...   706   0.0  
Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {O...   704   0.0  
KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {O...   701   0.0  
SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {...   699   0.0  
TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.3...   696   0.0  
NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON} Anc_1...   689   0.0  
KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON} Anc_1...   687   0.0  
ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]...   678   0.0  
Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {O...   666   0.0  
TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {O...   664   0.0  
AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON} S...   663   0.0  
CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa] ...   656   0.0  
Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar t...   653   0.0  
KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {...   649   0.0  
KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {...   622   0.0  
TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {...   622   0.0  
KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa] ...   180   5e-46
CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highl...   179   6e-46
Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} simila...   174   5e-44
KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON} sim...   172   2e-43
YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}  ...   171   3e-43
NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON...   171   5e-43
Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON} co...   168   3e-42
SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON} sim...   168   4e-42
TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON...   167   5e-42
Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa] {...   164   7e-42
Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)...   166   1e-41
KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4...   164   5e-41
KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4....   164   9e-41
ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar...   163   9e-41
Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON...   163   2e-40
TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4....   162   3e-40
AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON} ...   160   1e-39
NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON} Anc_...   160   1e-39
Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON...   159   2e-39
Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON...   158   4e-39
TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4...   156   2e-38
TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]...   156   2e-38
KLLA0B07249g Chr2 complement(630336..633095) [2760 bp, 919 aa] {...    77   1e-13
NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {O...    75   4e-13
AEL113C Chr5 complement(409096..411873) [2778 bp, 925 aa] {ON} S...    75   5e-13
Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar t...    75   5e-13
Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {...    72   4e-12
Kpol_2001.28 s2001 (81621..83408,83411..84382) [2760 bp, 919 aa]...    72   4e-12
NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON} Anc_1...    72   5e-12
KLTH0F04884g Chr6 complement(431251..434019) [2769 bp, 922 aa] {...    70   2e-11
SAKL0C05434g Chr3 complement(516536..519643) [3108 bp, 1035 aa] ...    69   3e-11
KNAG0C01080 Chr3 complement(209716..212511) [2796 bp, 931 aa] {O...    69   4e-11
TBLA0C05840 Chr3 complement(1411740..1414583) [2844 bp, 947 aa] ...    68   6e-11
TDEL0C03690 Chr3 (648638..651400) [2763 bp, 920 aa] {ON} Anc_1.1...    68   7e-11
ZYRO0G18458g Chr7 (1522413..1525178) [2766 bp, 921 aa] {ON} high...    67   1e-10
YKL165C Chr11 complement(137932..140691) [2760 bp, 919 aa] {ON} ...    66   3e-10
KAFR0G00500 Chr7 complement(134741..137509) [2769 bp, 922 aa] {O...    65   5e-10
Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {O...    65   7e-10
CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa] ...    64   1e-09
Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {O...    64   2e-09
Suva_11.58 Chr11 complement(123117..125876) [2760 bp, 919 aa] {O...    63   2e-09
TPHA0A02800 Chr1 complement(603610..606372) [2763 bp, 920 aa] {O...    61   9e-09
TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {...    54   2e-06
Kpol_1044.18 s1044 complement(37667..40735) [3069 bp, 1022 aa] {...    35   1.1  
KAFR0G03760 Chr7 (770672..771985) [1314 bp, 437 aa] {ON} Anc_3.5...    32   8.1  

>Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON}
           YJL062W (REAL)
          Length = 830

 Score = 1638 bits (4242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 803/830 (96%), Positives = 803/830 (96%)

Query: 1   MNLKQLMCLSCAQXXXXXXXXXXXXPRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVV 60
           MNLKQLMCLSCAQ            PRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVV
Sbjct: 1   MNLKQLMCLSCAQLFAILLFIFAFFPRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVV 60

Query: 61  IDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL 120
           IDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL
Sbjct: 61  IDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL 120

Query: 121 LLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSD 180
           LLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSD
Sbjct: 121 LLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSD 180

Query: 181 FTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKT 240
           FTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKT
Sbjct: 181 FTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKT 240

Query: 241 IYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAE 300
           IYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAE
Sbjct: 241 IYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAE 300

Query: 301 NALPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK 360
           NALPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK
Sbjct: 301 NALPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK 360

Query: 361 ENFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIIT 420
           ENFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIIT
Sbjct: 361 ENFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIIT 420

Query: 421 IIATYQLQRHSGPTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVP 480
           IIATYQLQRHSGPTFCKLRT               TFASSFIEEEHQLWWWIVTAFAAVP
Sbjct: 421 IIATYQLQRHSGPTFCKLRTSSLSVLLVSVILGVSTFASSFIEEEHQLWWWIVTAFAAVP 480

Query: 481 LFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFL 540
           LFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFL
Sbjct: 481 LFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFL 540

Query: 541 ILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTKIDFIPNESN 600
           ILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTKIDFIPNESN
Sbjct: 541 ILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTKIDFIPNESN 600

Query: 601 LITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVF 660
           LITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVF
Sbjct: 601 LITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVF 660

Query: 661 QILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHGIS 720
           QILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHGIS
Sbjct: 661 QILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHGIS 720

Query: 721 SDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPAFTYHCIFGT 780
           SDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPAFTYHCIFGT
Sbjct: 721 SDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPAFTYHCIFGT 780

Query: 781 CLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVILALD 830
           CLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVILALD
Sbjct: 781 CLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVILALD 830

>Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {ON}
           YJL062W (REAL)
          Length = 831

 Score = 1424 bits (3685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/833 (82%), Positives = 742/833 (89%), Gaps = 5/833 (0%)

Query: 1   MNLKQLMCLSCAQXXXXXXXXXXXXPRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVV 60
           MNLKQ  CLSCAQ            PRKIVL GISQQ PD+D  RDLQH RPFQKLVFV+
Sbjct: 1   MNLKQFTCLSCAQLFAILLFIFAFFPRKIVLTGISQQDPDED--RDLQHNRPFQKLVFVI 58

Query: 61  IDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL 120
           IDALRSDFLFD++ISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL
Sbjct: 59  IDALRSDFLFDAQISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL 118

Query: 121 LLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSD 180
           LLNVAQD+DSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDF DPTHSFFVSD
Sbjct: 119 LLNVAQDIDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFADPTHSFFVSD 178

Query: 181 FTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKT 240
           FTQVDNNVTRNLQ KLFQEWAQWDVAILHYLGLDHIGH+DGPHSKFM TKHQEMDSILK+
Sbjct: 179 FTQVDNNVTRNLQKKLFQEWAQWDVAILHYLGLDHIGHRDGPHSKFMGTKHQEMDSILKS 238

Query: 241 IYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAE 300
           IYDQVLEHE+DDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLS+F KP  Q  
Sbjct: 239 IYDQVLEHENDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSRFAKPEPQET 298

Query: 301 NALPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK 360
           + LPINGT D DFQYL+SVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNK+ASMK
Sbjct: 299 HILPINGTPDHDFQYLESVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASMK 358

Query: 361 ENFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIIT 420
           ENFMHLWRLSDH ++V LDD  I DIY+KMHDIQETLT+SATNYNYPLL++AF SFL  T
Sbjct: 359 ENFMHLWRLSDHHDDVALDDFTINDIYTKMHDIQETLTRSATNYNYPLLAVAFVSFLFTT 418

Query: 421 IIATYQLQRHSGPTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVP 480
           I+A YQLQR+SGP+FC L                 TFASSFIEEEHQLWWWIVTA + VP
Sbjct: 419 IVAVYQLQRYSGPSFCHLHISSLSVILVSVILGVSTFASSFIEEEHQLWWWIVTASSVVP 478

Query: 481 LFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFL 540
           LF Y  NA V ARWFIM+ACVRLIKFWNNSGQKFIY+NVMS++LN+NPFWKW LNS TFL
Sbjct: 479 LFLYPSNAFVFARWFIMIACVRLIKFWNNSGQKFIYSNVMSNLLNQNPFWKWYLNSSTFL 538

Query: 541 ILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTKIDFIPNESN 600
            L++ S RSQLLH I++TILVGLCFTYKISWEIVNG+QAEIP F+Q LLTK+DF+P E+N
Sbjct: 539 ALIIPSARSQLLHFIVTTILVGLCFTYKISWEIVNGNQAEIPPFMQGLLTKMDFLPTENN 598

Query: 601 LITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVF 660
           L+ LARVFFQAW+IVVISRL LTKLKVLD++YLI DMKLYIT+LLI QTSSQNIG FI+F
Sbjct: 599 LLLLARVFFQAWSIVVISRLALTKLKVLDKRYLIEDMKLYITVLLIFQTSSQNIGQFIIF 658

Query: 661 QILQSQICYFFQNFPSS---SSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYH 717
           QILQSQI YFFQ+ P+S   +S ++VYLS+LVSL+LQNF+FFQFGGTNSISTIDLGNAYH
Sbjct: 659 QILQSQIYYFFQHLPTSLSLTSPSEVYLSSLVSLILQNFTFFQFGGTNSISTIDLGNAYH 718

Query: 718 GISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPAFTYHCI 777
           G+SSDYNI VVG+LMS+ANFAPAIYWSMLPWSINY  ASSQNKLQTF+ SK+PAFTYHCI
Sbjct: 719 GVSSDYNIYVVGILMSVANFAPAIYWSMLPWSINYGSASSQNKLQTFIMSKMPAFTYHCI 778

Query: 778 FGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVILALD 830
           FG CLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMG LNGWLPELA++ ALD
Sbjct: 779 FGACLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGLLNGWLPELAILFALD 831

>YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}
           LAS21Integral plasma membrane protein involved in the
           synthesis of the glycosylphosphatidylinositol (GPI) core
           structure; mutations affect cell wall integrity
          Length = 830

 Score = 1396 bits (3614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/832 (81%), Positives = 733/832 (88%), Gaps = 4/832 (0%)

Query: 1   MNLKQLMCLSCAQXXXXXXXXXXXXPRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVV 60
           MNLKQ  CLSCAQ            PRKIVL GIS+Q PDQD  RDLQ +RPFQKLVFV+
Sbjct: 1   MNLKQFTCLSCAQLLAILLFIFAFFPRKIVLTGISKQDPDQD--RDLQRDRPFQKLVFVI 58

Query: 61  IDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL 120
           IDALRSDFLFDS+ISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL
Sbjct: 59  IDALRSDFLFDSQISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL 118

Query: 121 LLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSD 180
           LLNVAQD+DSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFP +WFDF DPTHSFFVSD
Sbjct: 119 LLNVAQDIDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPQQWFDFADPTHSFFVSD 178

Query: 181 FTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKT 240
           FTQVDNNVTRNL GKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFM+ KHQEMDSILK+
Sbjct: 179 FTQVDNNVTRNLPGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMAAKHQEMDSILKS 238

Query: 241 IYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAE 300
           IYD+VLEHE DDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKL+QF +P SQ  
Sbjct: 239 IYDEVLEHEDDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLAQFARPESQVN 298

Query: 301 NALPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK 360
             LPIN + D +FQYL++VQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNK+ASMK
Sbjct: 299 YTLPINASPDWNFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASMK 358

Query: 361 ENFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIIT 420
           ENFMHLW+LSDH  EV LDD    DIY+KM+ IQETLTKSATNYNYPLL+LAF  FLIIT
Sbjct: 359 ENFMHLWKLSDHHGEVALDDFTAEDIYTKMYTIQETLTKSATNYNYPLLTLAFVGFLIIT 418

Query: 421 IIATYQLQRHSGPTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVP 480
           IIA Y L R+SGP F +LR                TFASSFIEEEHQLWWWIVTAF+AVP
Sbjct: 419 IIAIYVLLRYSGPDFWQLRVSSLSVLLVSIILGVSTFASSFIEEEHQLWWWIVTAFSAVP 478

Query: 481 LFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFL 540
           LF Y+LN  +I RWFIM+ACVR IKFWNNSGQKFIY+NVMS++LN+NP WKW LN LTFL
Sbjct: 479 LFVYRLNVLIIVRWFIMMACVRSIKFWNNSGQKFIYSNVMSNLLNQNPSWKWCLNMLTFL 538

Query: 541 ILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTKIDFIPNESN 600
           +L+MAS   Q+LH I++TILVGLCFTYKISWEIVNG+QAEIPLF+ DLL KIDF P ESN
Sbjct: 539 VLIMASAGFQVLHFIVTTILVGLCFTYKISWEIVNGNQAEIPLFMHDLLAKIDFAPTESN 598

Query: 601 LITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVF 660
           LI LARVFFQAWAIVVISRLVLTKLKVL++ YLI+DMK+YITILL+ QTSSQNIG F+VF
Sbjct: 599 LIVLARVFFQAWAIVVISRLVLTKLKVLNKNYLIKDMKVYITILLMFQTSSQNIGQFLVF 658

Query: 661 QILQSQICYFFQNFPSSS--STTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHG 718
           QIL+SQI YFFQN P++S  ST+K+Y SNLVSL+LQNF+FFQFGGTNSISTIDLGNAYHG
Sbjct: 659 QILESQIFYFFQNIPTASLTSTSKIYFSNLVSLILQNFTFFQFGGTNSISTIDLGNAYHG 718

Query: 719 ISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPAFTYHCIF 778
           +SSDYNI VVG+LMS+ANFAPAIYWSMLPWSINY    +Q KLQTF++SKLPAFTYHCIF
Sbjct: 719 VSSDYNIYVVGILMSVANFAPAIYWSMLPWSINYASIPAQVKLQTFIRSKLPAFTYHCIF 778

Query: 779 GTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVILALD 830
           GTCLMTAC+ LRFHLFIWSVFSPKLCYFLGWN VMG LNGWLPELA++ ALD
Sbjct: 779 GTCLMTACVVLRFHLFIWSVFSPKLCYFLGWNFVMGLLNGWLPELALLCALD 830

>Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062W
           (REAL)
          Length = 831

 Score = 1393 bits (3605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/833 (80%), Positives = 734/833 (88%), Gaps = 5/833 (0%)

Query: 1   MNLKQLMCLSCAQXXXXXXXXXXXXPRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVV 60
           MNLKQL C++CAQ            PRKIVL GISQQ  D DQDRDLQH RPFQKLVFV+
Sbjct: 1   MNLKQLTCITCAQLLAIVLFIFAFFPRKIVLTGISQQ--DADQDRDLQHNRPFQKLVFVI 58

Query: 61  IDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL 120
           IDALRSDFLFDS ISHFNNVH+WLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL
Sbjct: 59  IDALRSDFLFDSHISHFNNVHEWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL 118

Query: 121 LLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSD 180
           LLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFP EWFDFTDPTHSFFVSD
Sbjct: 119 LLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPQEWFDFTDPTHSFFVSD 178

Query: 181 FTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKT 240
           FTQVDNNVTRNL GK+FQEWAQWDVAILHYLGLDHIGHKDGPHSKFM TKHQEMDSILK+
Sbjct: 179 FTQVDNNVTRNLPGKIFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMGTKHQEMDSILKS 238

Query: 241 IYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAE 300
           IYDQVL HE ++DTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLS+FVKP SQ  
Sbjct: 239 IYDQVLVHEHEEDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSKFVKPESQIN 298

Query: 301 NALPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK 360
             LPIN   DRDFQYL++VQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNK+AS+K
Sbjct: 299 RTLPINAAPDRDFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASIK 358

Query: 361 ENFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIIT 420
           ENFMHLW+LSDH  +  LDDL I  IY+KM+ IQETLTKSATNYNYPLL+LAF SFLIIT
Sbjct: 359 ENFMHLWKLSDHNGDFTLDDLTIDGIYTKMYSIQETLTKSATNYNYPLLALAFISFLIIT 418

Query: 421 IIATYQLQRHSGPTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVP 480
           IIA YQLQR+SG +  + RT               TFASSFIEEEHQLWWWIVTAF+ VP
Sbjct: 419 IIAIYQLQRNSGSSLWQPRTSPLSVLLISVILGISTFASSFIEEEHQLWWWIVTAFSVVP 478

Query: 481 LFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFL 540
           LF Y LN  V+ARWFIM+ CVRLIKFWNNSGQKFIY+NVMS++LN+NP WKW LN  T L
Sbjct: 479 LFVYNLNVFVVARWFIMMVCVRLIKFWNNSGQKFIYSNVMSNLLNQNPIWKWWLNLFTLL 538

Query: 541 ILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTKIDFIPNESN 600
            L++AS R Q+LH I++TILVGLCFTYKISWEIVNG+QAEIP+F+ DLL KIDF+P ESN
Sbjct: 539 ALIIASSRFQVLHFIVTTILVGLCFTYKISWEIVNGNQAEIPIFMHDLLAKIDFVPTESN 598

Query: 601 LITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVF 660
           LI LARVFFQAWAIVV+SRLVLTKLKVL++ YLI D+K+YITILLILQTSSQNIG FI+F
Sbjct: 599 LILLARVFFQAWAIVVVSRLVLTKLKVLNKNYLIEDIKVYITILLILQTSSQNIGQFIIF 658

Query: 661 QILQSQICYFFQNFPSS---SSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYH 717
           QILQSQI YFF++ P+    + ++KVYLSNLVSL+LQNF+FFQFGGTNSISTIDLGNAYH
Sbjct: 659 QILQSQIYYFFKSLPAPFLLTPSSKVYLSNLVSLILQNFTFFQFGGTNSISTIDLGNAYH 718

Query: 718 GISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPAFTYHCI 777
           G+SSDYN+  VG+LMSIANFAP+IYWSMLPWS+NY+  SSQ K+QTF++SKLPAFTYHCI
Sbjct: 719 GVSSDYNMCTVGMLMSIANFAPSIYWSMLPWSMNYDSTSSQVKIQTFIRSKLPAFTYHCI 778

Query: 778 FGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVILALD 830
           FGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWN VMGFLNGW+ EL V+ ALD
Sbjct: 779 FGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNFVMGFLNGWITELTVLFALD 831

>NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa]
           {ON} Anc_1.317 YJL062W
          Length = 831

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/819 (46%), Positives = 520/819 (63%), Gaps = 34/819 (4%)

Query: 26  PRKIVLPGISQQAPDQDQDRDLQHERP-FQKLVFVVIDALRSDFLFDSRISHFNNVHQWL 84
           P+K VL G++    + +Q R+    +P FQKLV VVIDALRSDFLFD   SHF+ +H  L
Sbjct: 26  PQKNVLKGLADFHYNSEQQRE---TKPVFQKLVLVVIDALRSDFLFDETNSHFHFIHSQL 82

Query: 85  NTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFI 144
           N G AWG+T+++NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S  L++ DS L QF 
Sbjct: 83  NEGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSTTLADQDSLLAQFH 142

Query: 145 QHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQWD 204
             N  I F GDDTWLKLFP +WF+  + T+SFFVSDF  VD NV+R+L  +L +    WD
Sbjct: 143 LQNKKINFFGDDTWLKLFPRDWFNEVEGTNSFFVSDFEVVDTNVSRHLTKQL-KHNHDWD 201

Query: 205 VAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGM 264
           V I+HYLGLDHIGHKDG  SKFM  KH EMD+I++ +Y+ +     DDDTL+ V+GDHGM
Sbjct: 202 VLIMHYLGLDHIGHKDGASSKFMPEKHIEMDNIVRQVYENI-----DDDTLLVVMGDHGM 256

Query: 265 NELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQIDI 324
           NE+GNHGGSSAGETSAGL+FLS KL +   P  Q    LPI    D +FQ+L SVQQID+
Sbjct: 257 NEVGNHGGSSAGETSAGLVFLSNKLKKGELPLKQRHLNLPIKRQTDENFQFLTSVQQIDL 316

Query: 325 VPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK--ENFMHLWRLSDHQE--EVVLDD 380
           VPT+A LF +PIP N+VGI+IP+FLQ L   + ++K  EN+  L +LS  Q+   +  D 
Sbjct: 317 VPTLATLFNIPIPKNNVGIVIPEFLQFLRKDMINIKLMENYHQLLQLSKGQDLPNIPFDH 376

Query: 381 LDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIITIIATYQLQRHSGPTFCKLRT 440
           +D  +I +KM +IQ+ LTK+ATNYNY  L   +   +  T+        +    +C    
Sbjct: 377 MDSKNIMNKMKEIQDELTKNATNYNYSYLGRGYLLLIFTTVTVFIVFILNQKSLYC---A 433

Query: 441 XXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTA---FAAVPLFAYQLNASVIARWFIM 497
                          +F SSF+EEEHQ+WWWI+T    F+ +       + S +   F++
Sbjct: 434 TTIITIVISLLVGLSSFGSSFVEEEHQIWWWIITGSIMFSCIETLISNPSKSTVFNHFLI 493

Query: 498 LACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLT-FLILLMASVRSQLLHCIM 556
             C R+I+ WNNSGQK +Y  ++++IL  +    W L   T + I L  ++R+  L  + 
Sbjct: 494 AVCARIIRGWNNSGQKHVYEFILTNILKNHYNTLWYLICTTIYYIGLKNTIRTDFLSFLG 553

Query: 557 STILVGLCFTYKISWEIVNGDQAEIPLFL-----QDLLTKIDFIPNES---NLITLARVF 608
              +  LCF YK+ W IVN +      ++      D+L K+   P ++    L+ LA +F
Sbjct: 554 PFFMTTLCFVYKLDWAIVNNESVPEWFYVITKEASDILLKVGHSPKDAFKEALLPLATLF 613

Query: 609 FQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVFQILQSQIC 668
           +Q +  +V  R++        +K    D+  YI++LLI Q+++ NI  F+VF+ L+  I 
Sbjct: 614 YQTFVALVSIRIIFLVF-FSRRKTFFDDISNYISLLLIFQSTATNIPQFLVFEFLKKSIT 672

Query: 669 YFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHGISSDYNISVV 728
              QN+   +     YL  L+SL+LQ+F+FFQFGGTNSI+TID+ NAYHGIS +YNI +V
Sbjct: 673 KVLQNYHQENKNN--YLP-LISLILQSFTFFQFGGTNSIATIDISNAYHGISENYNIYLV 729

Query: 729 GLLMSIANFAPAIYWSMLPWSINY-EPASSQNKLQTFVKSKLPAFTYHCIFGTCLMTACI 787
           G+ M+I+NFAP+IYW +  W I Y E   S +K   + K+KLP   ++CI G CL+ AC 
Sbjct: 730 GIFMTISNFAPSIYWIISMWPILYAEIPESSSKWNIYFKNKLPLLVFNCIVGCCLLAACY 789

Query: 788 FLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVI 826
            LR+HLFIWSVFSPKLCYFLGWN+ M F+ GWL E  ++
Sbjct: 790 ILRYHLFIWSVFSPKLCYFLGWNVFMNFVVGWLVEGTLV 828

>Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {ON}
           complement(61260..63767) [2508 nt, 836 aa]
          Length = 835

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/853 (46%), Positives = 523/853 (61%), Gaps = 42/853 (4%)

Query: 1   MNLKQLMCLSCAQXXXXXXXXXXXXPRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVV 60
           M + QL  +   Q            P K VL G      +   D  L  +  F KLV VV
Sbjct: 1   MKVLQLTAILIIQLISVLIFCIGFFPSKNVLEG--DAVFEISSDAQLNAKPAFNKLVLVV 58

Query: 61  IDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL 120
           IDALRSDFLFD  IS FN +H+  N G AWG+T+F+NPPTVTLPRLK ITTGSTP+F+D 
Sbjct: 59  IDALRSDFLFDQDISQFNYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDA 118

Query: 121 LLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSD 180
           +LNVA+D  S++L   DSW  QF +H   IRF GDDTWLKLFPHE F   + T+SFFVSD
Sbjct: 119 ILNVAEDDSSSNLKNQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSD 178

Query: 181 FTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKT 240
           F QVD+NVTR+L+ K  +E   WD  ILHYLGLDHIGHK GP SKFM  KH+EMDSI+K 
Sbjct: 179 FEQVDHNVTRHLE-KQIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKN 237

Query: 241 IYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAE 300
           +++ V +   D++TLICV+GDHGMNE+GNHGGSS GETSAGL+ +S KL  F  P+ Q  
Sbjct: 238 LFETVGQ---DENTLICVMGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKG 294

Query: 301 NALPINGT-----LDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNK 355
             LPI         D+ +++L  +QQ+DIVPT++ALF +P P N+VG+++P  L+LL  K
Sbjct: 295 VKLPIKSVNVAPEEDKQYKFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPK 354

Query: 356 VASMK--ENFMHLWRLSDHQ------EEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYP 407
           +  +K  ENF  L  +S+++      E    ++ +I DI S+M DIQ  LT SATNYN P
Sbjct: 355 LFRIKLQENFRQLMIVSNNKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVP 414

Query: 408 LLSLAFASFLIITIIATYQLQRHSGPTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQ 467
           LL L      I+T+  ++        +  ++                 +FASSF+EEEHQ
Sbjct: 415 LLYLGLGLIFILTLTISFWFYF----SVLEVDFKNVLIVIISLLIGLSSFASSFVEEEHQ 470

Query: 468 LWWWIVTAFAAVPLFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRN 527
           +WWWI+T    V   A  L    IA   +M  CVR+I+ WNNSGQK+ Y   +S +LN  
Sbjct: 471 IWWWIITGLITVS--AINLPDQKIAH-LVMFVCVRIIRGWNNSGQKYSYDRTISILLNTE 527

Query: 528 -PFWKWSLNSLTFLILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLF-- 584
              ++W LN  T L +++      L+  + S  L  +C  YK+ W I+N D    P++  
Sbjct: 528 YEDFQWYLNIATILYIMLKDSTDNLISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKA 587

Query: 585 -------LQDLLTKIDFIPNESNLITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDM 637
                  L    +  D    E NLI +AR FF +   +VI+     KLK++  K  I+D+
Sbjct: 588 AIYICRRLSRDYSLQDISVVEENLIPIARFFFYSVLAIVIAIYGSAKLKLI--KNPIKDI 645

Query: 638 KLYITILLILQTSSQNIGLFIVFQILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFS 697
           +  +T LLI Q+ S  IGLF+V+ ILQS +     N  SS+    V +++ +SLVLQ F+
Sbjct: 646 QKTLTFLLIFQSPSSYIGLFMVYDILQSSLSSLLVNQYSSN----VMITSTISLVLQYFT 701

Query: 698 FFQFGGTNSISTIDLGNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASS 757
           FFQFGGTNSI+T DL NAY+G+S DYNI  VG LM ++NFAPAIYW+M PW + Y     
Sbjct: 702 FFQFGGTNSIATADLTNAYNGVSEDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKP 761

Query: 758 QNKLQTFVKSKLPAFTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLN 817
            NK   F ++KLP   ++CI G  L+ +C  LR+HLFIWSVFSPKLCY+  WN+ M  + 
Sbjct: 762 NNKWNVFAENKLPIVYFNCIAGCFLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIV 821

Query: 818 GWLPELAVILALD 830
           GW+ E+AV+  +D
Sbjct: 822 GWVLEIAVLSMVD 834

>KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {ON}
           Anc_1.317 YJL062W
          Length = 821

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/808 (46%), Positives = 523/808 (64%), Gaps = 54/808 (6%)

Query: 44  DRDLQHE--RPFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTV 101
           ++ LQ E  +PF+KLV +VIDALRSDFLFD   S+F+ VH  LN+GEAWGYT+++NPPTV
Sbjct: 39  NKKLQEETKQPFKKLVLIVIDALRSDFLFDESSSNFHFVHSKLNSGEAWGYTAYSNPPTV 98

Query: 102 TLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKL 161
           TLPRLK ITTGSTP+F+D LLNVA+D  S+++ + DSWL+QF      +RF GDDTWLKL
Sbjct: 99  TLPRLKGITTGSTPNFLDALLNVAEDDSSSNVKDQDSWLKQFHSKGYRMRFFGDDTWLKL 158

Query: 162 FPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDG 221
           FP E+F+  + T+SFFVSDF QVD NVTR++  +L ++   WDV ILHYLGLDHIGHK G
Sbjct: 159 FPLEFFNDYEGTNSFFVSDFEQVDLNVTRHIPRQL-EKTEDWDVLILHYLGLDHIGHKGG 217

Query: 222 PHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAG 281
            +SKFM  KH+EMD I+  +YD +     D+DTL+ V+GDHGMN+ GNHGGSSAGETSAG
Sbjct: 218 ANSKFMPAKHREMDQIVGKLYDNL-----DEDTLLIVMGDHGMNDAGNHGGSSAGETSAG 272

Query: 282 LLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSV 341
           L+F S KLS+F  P  Q    LPI      D+QYL  VQQ+D+VPT+AAL+ +PIP NSV
Sbjct: 273 LVFFSKKLSKFKIPIRQLNARLPITSN-SSDYQYLTQVQQMDLVPTLAALYNVPIPKNSV 331

Query: 342 GIIIPDFLQLL-PNKV-ASMKENFMHLWRLSDHQEEVVLDDLDIGDIYSK------MHDI 393
           G+IIPDFLQLL PN +   + EN+  L  LS  + +  L +L++ D+  +      M  +
Sbjct: 332 GVIIPDFLQLLDPNIIDTKLLENYKQLLELSKVEYDDELFNLNVFDLEKRSECQRIMKTL 391

Query: 394 QETLTKSATNYNYPLLSLA-FASFLIITIIATYQL-QRHSGPTFCKLRTXXXXXXXXXXX 451
           QE L  + T Y+Y +L++  F S ++  ++A +   Q  S   F                
Sbjct: 392 QEKLIAATTEYDYTMLAIGCFMSLVLTLVMAIFSFFQMASNKYF-------FASVLLASI 444

Query: 452 XXXXTFASSFIEEEHQLWWWIVTA--FAAVPLFAYQLNASVIARWFIMLACVRLIKFWNN 509
                F SSF+EEEHQ+WWW++T   F +     +    SVI      L C+RLI+ WNN
Sbjct: 445 LGFSCFGSSFVEEEHQIWWWVITGCLFISAAKTMHYFEHSVI------LLCLRLIRGWNN 498

Query: 510 SGQKFIYTNVMSSILNRNPFWKWSLNSLTFLILLMASVRSQLLHCIMSTILVGLCFTYKI 569
           +GQK +Y  V+S IL  N   +W+LN+LTF ++ +   ++ +   I S+ L  LC  YK 
Sbjct: 499 TGQKTVYPYVISKILEENSTLQWNLNALTFFVISLNGNQNSMWGFISSSTLGILCLAYKA 558

Query: 570 SWEIVNGDQAEIPLFLQDLL----------TKIDFIPNESNLITLARVFFQAWAIVVISR 619
           +W +VN +   +P ++Q+++           K D+    S LI +A  F  + A ++   
Sbjct: 559 TWAVVNKEI--VPWYIQNIMDNCASFFQDGNKKDY---SSTLIPMASFFLHSVAAIIFFT 613

Query: 620 LVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVFQILQSQICYFFQNFPSSSS 679
           L+  K       + ++ +  Y+TIL++  +SS NI  F++F+I++S    F         
Sbjct: 614 LLWGKFNKHHPSFSLKCISKYVTILMMFLSSSVNIPQFLIFEIMRS----FISKILKKHY 669

Query: 680 TTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHGISSDYNISVVGLLMSIANFAP 739
            + +YL++L+SL LQNF+FFQFGGTNSI+TID+ NAYHGIS +YNI V+G+LM ++NFAP
Sbjct: 670 NSNIYLTSLISLCLQNFAFFQFGGTNSIATIDISNAYHGISENYNIYVIGVLMVLSNFAP 729

Query: 740 AIYWSMLPWSINYEPASSQ-NKLQTFVKSKLPAFTYHCIFGTCLMTACIFLRFHLFIWSV 798
           +IYW+M  W I Y+   +  NK  +F KSK+P   ++CI G CLM AC+  R+HLF+WSV
Sbjct: 730 SIYWAMFSWDIIYDIKETNFNKWASFTKSKIPTSLFNCIVGLCLMLACVMFRYHLFVWSV 789

Query: 799 FSPKLCYFLGWNLVMGFLNGWLPELAVI 826
           FSPKLCYF+GWNL M  + GW+ E+ ++
Sbjct: 790 FSPKLCYFVGWNLFMNAIFGWVLEVLLL 817

>SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 813

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/813 (47%), Positives = 511/813 (62%), Gaps = 47/813 (5%)

Query: 26  PRKIVLPGISQ--QAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQW 83
           P+K VL G +     P Q    D      F+KLV VVIDALRSDFLF    S FN VHQ 
Sbjct: 25  PQKSVLQGDASFLYLPQQQSRSD----PVFRKLVLVVIDALRSDFLFQESNSKFNFVHQL 80

Query: 84  LNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQF 143
           LN G AWGYT+++NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S+ L++ DSWL+QF
Sbjct: 81  LNDGAAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDLSSSLNDQDSWLRQF 140

Query: 144 IQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQW 203
             +N  I+F GDDTWLKLFP E+F   + T+SFFVSDF QVD NVTR+L  + F    +W
Sbjct: 141 HNNNKRIKFFGDDTWLKLFPLEFFQEYEGTNSFFVSDFEQVDLNVTRHLPHQ-FSHKDEW 199

Query: 204 DVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHG 263
           DV ILHYLGLDHIGHK G  S+FM  K +EMD+++K IY+ +     D DTL+CV+GDHG
Sbjct: 200 DVLILHYLGLDHIGHKGGSSSRFMPGKQEEMDNVIKQIYESM-----DRDTLLCVMGDHG 254

Query: 264 MNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQID 323
           MN+LGNHGGSS GETSA L F+SPKL QF  P +Q    LP+      +++YLD VQQID
Sbjct: 255 MNDLGNHGGSSNGETSAALTFISPKLKQFQPPVTQRNAHLPLKEH-SENYKYLDEVQQID 313

Query: 324 IVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK--ENFMHLWRLSDHQEEVVLDDL 381
           +VPT+A+LF +PIP NS+GIII DFLQL P ++A +K  +NF  L  +     E   D  
Sbjct: 314 LVPTLASLFNLPIPKNSLGIIITDFLQLFPGELAEIKITDNFHQLMNIIG---ETPSDTK 370

Query: 382 DIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIITIIAT-YQLQRHSGPTFCKLRT 440
           DI +   KM  IQ TL K+ TNYNY L+S+ +   L++T+  T + L      +  KL  
Sbjct: 371 DIQNSVEKMKRIQSTLAKATTNYNYQLISIGYIILLLVTVATTGFTL------SLVKLNY 424

Query: 441 XXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVPLFAYQLNASVIARWFIMLAC 500
                          TF SSF+EEE QLWWWI T    + L +  L    I    ++  C
Sbjct: 425 DSALLLGVSFTLGISTFGSSFVEEEQQLWWWIST---GILLLSAILVPQEIINHLLVFTC 481

Query: 501 VRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFLILLMASVRSQL--LHCIMST 558
           +RLI+ WNNSGQKFIY   +  +L  +  W W+LN+LT  +        +   L  + S 
Sbjct: 482 LRLIRGWNNSGQKFIYDCTLYELLKVHTSWNWALNALTIFVTSFTCTLGERGPLSFVSSF 541

Query: 559 ILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTK-----IDFIPNE----SNLITLARVFF 609
           +L  LC  YK +W +VNG+Q  I  +L+ ++ K     +D   N      +L+ +AR+FF
Sbjct: 542 LLATLCLVYKGTWSVVNGEQ--ISQWLKAVIRKSCILLLDDTDNRDMYTDSLVPMARLFF 599

Query: 610 QAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVFQILQSQICY 669
           Q    +++ R+ L KL     KY  +D+   ++++LILQTSS NI  F+VF ILQ ++ Y
Sbjct: 600 QITLTLILFRIALNKLMDRKTKYF-KDIHSIVSMILILQTSSANIPQFLVFWILQDRLKY 658

Query: 670 FFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHGISSDYNISVVG 729
               +  S     V     +SL+LQN +FFQFGGTNSI+T++L NAY+GIS DYNI VVG
Sbjct: 659 LLTAYTPSDCLVMV-----ISLILQNLTFFQFGGTNSIATVNLTNAYNGISGDYNIHVVG 713

Query: 730 LLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPAFTYHCIFGTCLMTACIFL 789
           LLM I NFAP+IYWSM      +E   + +K + F  ++LPA  ++ I G  +M +C+ L
Sbjct: 714 LLMCIGNFAPSIYWSMATLPTLFENKKNTDKWEIFFATRLPALMFYSIIGCFIMGSCVIL 773

Query: 790 RFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPE 822
           R+HLFIWSVFSPKLCY++ WN+ M F+  W  E
Sbjct: 774 RYHLFIWSVFSPKLCYYVTWNVFMNFMVSWCAE 806

>TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.317
           YJL062W
          Length = 809

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/837 (46%), Positives = 522/837 (62%), Gaps = 43/837 (5%)

Query: 4   KQLMCLSCAQXXXXXXXXXXXXPRKIVLPGISQQAPDQDQDRDLQHE-RP-FQKLVFVVI 61
           K+L+ L  +Q            P+K VL   +Q      ++  LQ+E +P F KLV VVI
Sbjct: 3   KRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFI----EEPALQNEAKPVFNKLVLVVI 58

Query: 62  DALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLL 121
           DALRSDFLF+   S F+ +H  LN G AWG+T+++NPPTVTLPRLK ITTGSTP+F+D +
Sbjct: 59  DALRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAI 118

Query: 122 LNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDF 181
           LNVA+D  S++L++ DSW++QF  H   +RF GDDTWLKLFP E+FD  D T+SFFVSDF
Sbjct: 119 LNVAEDDSSSNLNDQDSWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDF 178

Query: 182 TQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTI 241
            QVD+NVTR+L  +L  +  +WD  ILHYLGLDHIGHK GP+S+FM  K +EMD ILK I
Sbjct: 179 EQVDHNVTRHLPKQLNNQ-QEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQI 237

Query: 242 YDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAEN 301
           Y+ V     DD+TLICV+GDHGMN++GNHGGSSAGETSA L  +S KL ++  PA Q   
Sbjct: 238 YENV-----DDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGV 292

Query: 302 ALPI-NGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK 360
            LP+ N   + D+QYL  +QQ+DIVPT+AALF  PIP NSVGI+I + LQLL  K+A +K
Sbjct: 293 QLPVQNADGEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIK 352

Query: 361 --ENFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLI 418
             EN   L  +S+   EV+ D+ +I  +Y  M DIQ  LT+SATNYNY L+ +  A  +I
Sbjct: 353 LLENLKQLDSISNGH-EVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLALLVI 411

Query: 419 ITIIATYQLQRHSGPTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAA 478
            TII         G    +                  +F SSF+EEEHQ+WWWI T  A 
Sbjct: 412 TTIITVL-----VGSNRMEFGHPFFFTMIVSLLIGLSSFGSSFVEEEHQIWWWISTG-AT 465

Query: 479 VPLFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLT 538
           +    Y ++       F++L C+R+I+ WNNSGQK    N +  IL RNP  +W LN   
Sbjct: 466 LASSVYLVDEKYTH--FVILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFA 523

Query: 539 FLILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTKIDFIPN- 597
            +I  +      ++  + S +L  LC  YK++W +VN  +  +P +L ++  K   I   
Sbjct: 524 IVICGLKGSSGDIVTFMCSFVLTALCLVYKVTWALVN--RETVPHWLYEVAYKSCSIMMG 581

Query: 598 ------ESNLITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSS 651
                 + +LI LA++FF+ +A  V   +V  K+      + I     +IT+LLI Q+ S
Sbjct: 582 DTTDVFDKSLIPLAQLFFRCFAGCVAVAVVACKMGGNKNSHAIST---FITLLLIFQSQS 638

Query: 652 QNIGLFIVFQILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTID 711
            NI LF VF +L+S +        S    +  Y+ + VSL+LQ F+FF FGGTNSI+T+D
Sbjct: 639 PNIPLFFVFDVLKSSL----NKIVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVD 694

Query: 712 LGNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPA 771
           L NAY+G+S +YNI  VG +M ++NFAP+IYWS   W++ Y+   +  K   F +SKL  
Sbjct: 695 LSNAYNGVSENYNIYAVGFMMCVSNFAPSIYWSTFTWNLLYK---TNKKWHNFFQSKLTF 751

Query: 772 FTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVILA 828
             ++CI G CLM AC+ LRFHLFIWSVFSPKLCY+  WN+ M  + GW+ E+ + L 
Sbjct: 752 LMFNCISGCCLMFACVALRFHLFIWSVFSPKLCYYATWNIFMNLVIGWILEIPLALT 808

>NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON}
           Anc_1.317 YJL062W
          Length = 857

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/844 (46%), Positives = 532/844 (63%), Gaps = 52/844 (6%)

Query: 26  PRKIVLPGISQ---QAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQ 82
           P+K V+ G SQ    A  Q Q R       F KLV +VIDALRSDFLFDS+ SHF+ VH 
Sbjct: 25  PQKTVIKGDSQFQINATLQSQTRP-----TFNKLVLIVIDALRSDFLFDSQKSHFHFVHS 79

Query: 83  WLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQ 142
            LN G AWG+T+++NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S+ L + DS ++Q
Sbjct: 80  QLNKGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDISSTLEDQDSLIKQ 139

Query: 143 FIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQ 202
           F      ++F GDDTWLKLFPH WF   + T+SFFVSDF  VD NVTR+L  +L    A 
Sbjct: 140 FYMQGKNLKFFGDDTWLKLFPHHWFSEFEGTNSFFVSDFEIVDKNVTRHLPEQLAANDA- 198

Query: 203 WDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQV-LEHESDDDTLICVLGD 261
            DV ILHYLGLDHIGHKDG  SKFM  KH EMD I+K IY+     +E DD+TL+ V+GD
Sbjct: 199 -DVLILHYLGLDHIGHKDGASSKFMKHKHLEMDEIIKMIYESTQYSNEYDDNTLMVVMGD 257

Query: 262 HGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRD----FQYLD 317
           HGMNE+GNHGGSSAGETSAG++FLS KL+++  P  Q    +P+   L+ +    FQYL+
Sbjct: 258 HGMNEVGNHGGSSAGETSAGMVFLSEKLAKYSTPQEQMNFEVPLLPNLNEEGQNNFQYLN 317

Query: 318 SVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVAS--MKENFMHLWRLSD---H 372
           S+QQ+D+VPT+A LFG+PIP NSVG+IIP+FLQ+L  ++ S  +KEN+  L +LS    +
Sbjct: 318 SIQQVDLVPTLATLFGLPIPKNSVGVIIPEFLQMLDPQIISTKIKENYNQLLQLSKKSAN 377

Query: 373 QEEVVLD-DLDIGD--IYSKMHDIQETLTKSATNYNYPLLSLAFASFLIITIIATYQL-Q 428
           + E   D DLD+    + ++M +IQ  LTK+ATNYNY LL + ++  +I T+  +  + +
Sbjct: 378 EYEYNFDSDLDVNQEILQNEMKNIQNELTKTATNYNYNLLIIGYSILVISTLFTSLLIWK 437

Query: 429 RHSGPTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVPLFA---YQ 485
            +S     +L                 TF+SSF+EEEHQ+WWWI T F  V L +    Q
Sbjct: 438 DYSKKNIFQL----IPITVISIMLGVSTFSSSFVEEEHQIWWWITTGFITVSLVSTLTLQ 493

Query: 486 LNAS---VIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFLIL 542
              S    I    I+  C R+++ W+NSGQK+IY +V+S++L  +   +W LN LT LI+
Sbjct: 494 NGFSPLKTILYHLIIFGCARILRGWSNSGQKYIYDHVLSNVLKSHTNIQWYLNLLTILII 553

Query: 543 -LMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQ-----DLLTKIDFIP 596
                  S      ++  L  LCF YK++W IVN +      +        +L       
Sbjct: 554 GFQKDSTSNFFKFTITFFLSVLCFIYKVNWAIVNNENVPDWFYASTYEACSILIGPTATT 613

Query: 597 NESNLITLARVFFQAWAIVVISRLVLTKL---KVLDQKYLIRDMKLYITILLILQTSSQN 653
            + +LI +A +F +A    +I R++ +K+   K      LI D+  YI +LLI +TSS  
Sbjct: 614 FQDSLIPMANLFLKAIVTTIIGRIIYSKIFIGKNNKDSLLIPDIVKYIKLLLIFETSSTK 673

Query: 654 IGLFIVFQILQ---SQICYFFQNFPSSSSTTKVYLS--NLVSLVLQNFSFFQFGGTNSIS 708
           I  F++F+I+     ++    ++   +     + LS   L+SL+LQNF+FFQFGGTNSI+
Sbjct: 674 ISQFLIFEIINHIWPKLLNLVKDTSDNDIANSIELSLIPLISLILQNFTFFQFGGTNSIA 733

Query: 709 TIDLGNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQT---FV 765
           TID+ NAYHGIS +YNI  VGL M+I+NFAP+IYW+++ W   Y   S  NK      F 
Sbjct: 734 TIDISNAYHGISENYNIYQVGLFMTISNFAPSIYWTIITWPTLYNSTSITNKNSKWIIFA 793

Query: 766 KSKLPAFTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAV 825
            +KLP   ++CI G CL+ +C  LR+HLFIWSVFSPKLCYFLGWNL M  + G++ E  +
Sbjct: 794 SNKLPILFFNCIVGCCLLASCYILRYHLFIWSVFSPKLCYFLGWNLFMNSIVGYIVE-GL 852

Query: 826 ILAL 829
           I+AL
Sbjct: 853 IVAL 856

>KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON}
           Anc_1.317 YJL062W
          Length = 830

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/816 (46%), Positives = 519/816 (63%), Gaps = 42/816 (5%)

Query: 26  PRKIVLPGISQQAPDQDQDRDLQHERP-FQKLVFVVIDALRSDFLFDSRISHFNNVHQWL 84
           P+K VL G ++  P+         E P F K + VV+DALRSDF+FDS  SHF+ VH  L
Sbjct: 25  PQKKVLKGQAEFNPENLDRLGSNREEPVFNKFILVVVDALRSDFIFDSHNSHFDFVHSKL 84

Query: 85  NTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFI 144
           N+GEAWG+T+F++PPTVTLPRLK ITTGSTP+F+D LLNVA+D  ++ + E DSW+ QF+
Sbjct: 85  NSGEAWGFTAFSSPPTVTLPRLKGITTGSTPNFLDALLNVAEDDQTSTIKEQDSWINQFL 144

Query: 145 QHNN-TIRFMGDDTWLKLF--PHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWA 201
            + N +IRF GDDTWLKLF   +E F   + T+SFFVSDFTQVD NVTR++  +L QE  
Sbjct: 145 TNGNQSIRFFGDDTWLKLFAPANETFQEWEGTNSFFVSDFTQVDLNVTRHIPTQL-QEKD 203

Query: 202 QWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGD 261
           QWD  ILHYLGLDHIGHK G +S FM  KH+EMD++LK +Y+ V     D DTLI V+GD
Sbjct: 204 QWDTLILHYLGLDHIGHKGGAYSHFMPEKHKEMDNVLKDLYENV-----DPDTLIVVMGD 258

Query: 262 HGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENA---LPINGTLDRDFQYLDS 318
           HGMN++GNHGGSS GET AGL+FLS KLS+F KP SQ E      P+    D+ F+YL  
Sbjct: 259 HGMNDVGNHGGSSPGETHAGLVFLSEKLSRFPKPHSQYETIPLNTPVTADGDKTFEYLTQ 318

Query: 319 VQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPN--KVASMKENFMHLWRLSDHQEEV 376
           VQQ+DIVPT+A LF +PIP NSVGI+I DF+ LL    + A + EN+  L+ LS+  E V
Sbjct: 319 VQQVDIVPTLATLFNVPIPKNSVGILIKDFIPLLDKHLREAKVGENYQQLFTLSNSMETV 378

Query: 377 VLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIIT---IIATYQLQRHSGP 433
            +  L + ++Y KM  +QE LT++AT+YNY  L   +   + +T   +I   Q  R SG 
Sbjct: 379 NV-GLTVDEMYEKMRAVQENLTRNATDYNYRALVPGYVILVCVTAYCLILAVQRMRLSGA 437

Query: 434 TFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVPLFAYQLNASVIAR 493
               L                  F SSF+EEEHQLWWW++T      L   Q +    + 
Sbjct: 438 FVALLGISFLTGISM--------FGSSFVEEEHQLWWWVITGSILFTLAFRQSSWHTTSS 489

Query: 494 WFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFLILLMASVRSQLLH 553
              +   VRLI+ WNN+GQK  YT V+ +IL  +P  KW+LN L FL +  ++  S +  
Sbjct: 490 CITLSLAVRLIRGWNNTGQKTTYTYVIGNILAAHPTIKWNLNVLAFLAVCQSNTESLMSF 549

Query: 554 CIMSTILVGLCFTYKISWEIVNGDQAEIPL--FLQDL--LTKIDF---IPN-ESNLITLA 605
           C    +L+ +   YKI+W +VN +   +    FLQ +  L K++    I N E  LI LA
Sbjct: 550 C-GHIVLIVVALAYKINWALVNKENVPVYAFQFLQIIGRLIKVNVGEDIENLEEALIPLA 608

Query: 606 RVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVFQILQS 665
           RVF++      + ++VL K+++     LI+D+     +LL+  +S+ NI  F++F+I++ 
Sbjct: 609 RVFYRLVLSFTVVKIVLAKIRLQPPHSLIKDISKNFVVLLMFLSSTSNIPQFLIFEIMKV 668

Query: 666 QICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHGISSDYNI 725
            I    ++       + + ++ +VSL+LQNF+FFQFG TNSI+TIDL NAYHGIS +YNI
Sbjct: 669 CITQIIKD----EYGSDISITAIVSLILQNFTFFQFGRTNSIATIDLSNAYHGISENYNI 724

Query: 726 SVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQ--TFVKSKLPAFTYHCIFGTCLM 783
             VG LM I+NFAPA+YW++ PW+I Y   +   K +   F K KLP   ++ + G CL+
Sbjct: 725 YAVGWLMVISNFAPALYWAIYPWNITYVTPTGICKARWLRFAKGKLPITLFNGLVGCCLL 784

Query: 784 TACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGW 819
            AC+ LR+HLFIWSVFSPKLCY++ WNL M  + GW
Sbjct: 785 AACVALRYHLFIWSVFSPKLCYYVFWNLFMASIIGW 820

>ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 812

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/832 (44%), Positives = 519/832 (62%), Gaps = 53/832 (6%)

Query: 3   LKQLMCLSCAQXXXXXXXXXXXXPRKIVLPGISQ---QAPDQDQDRDLQHERPFQKLVFV 59
           L+Q++ L  AQ            P+K VL G +    ++  Q Q + +     F K V +
Sbjct: 2   LRQIITLLLAQFVAIFIFCCGFFPQKNVLKGNADFIIESSIQTQSKPV-----FDKFVLI 56

Query: 60  VIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFID 119
           V+DALRSDF+F+  IS+F  VH  +N GEAWG+T+++NPPTVTLPRLK ITTGSTP+F+D
Sbjct: 57  VVDALRSDFVFEESISNFKFVHSLINDGEAWGFTAYSNPPTVTLPRLKGITTGSTPNFLD 116

Query: 120 LLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVS 179
            +LNVA+D  S++L E DSWL+QF++    +RF GDDTWLKLFP ++F   + T+SFFVS
Sbjct: 117 AILNVAEDDSSSNLKEQDSWLKQFVRQGKKMRFFGDDTWLKLFPLDFFQEYEGTNSFFVS 176

Query: 180 DFTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILK 239
           DF QVD NVTR+L  +L +    WDV ILHYLGLDHIGHK G  S FM  KH EMDSI+K
Sbjct: 177 DFEQVDLNVTRHLPHQL-ETQKDWDVLILHYLGLDHIGHKGGARSVFMPGKHAEMDSIVK 235

Query: 240 TIYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQA 299
            IY+ V     D++TL+CV+GDHGMNE+GNHGGSS GETS+ L+ +S KL QF  P  Q 
Sbjct: 236 NIYENV-----DENTLVCVMGDHGMNEVGNHGGSSPGETSSALVMISKKLKQFQPPLHQR 290

Query: 300 ENALPINGTL---DRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKV 356
           +  LPI       + ++ YL  VQQ+D VPT+AALF +PIP N+VGIIIPDFLQLL +K+
Sbjct: 291 DVHLPITTQFQDGEVNYDYLTKVQQVDFVPTLAALFNIPIPKNNVGIIIPDFLQLLDSKM 350

Query: 357 ASM--KENFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFA 414
           A++  K+NF  L  L     EV   +  I + + +M D+QE LTKSATNY YP+L+  F 
Sbjct: 351 AAIKVKDNFNQLASLLGRTLEV--KNESINEEFEQMKDLQEVLTKSATNYKYPILAAGFG 408

Query: 415 SFLIITIIATYQLQRHSGPTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVT 474
              ++T +A +      G +  +L                 TF+SSF+EEEHQ+WWW++T
Sbjct: 409 LLTVLTAVALWY-----GISIMQLSKSSLLTIVLSLLLGIATFSSSFVEEEHQIWWWVIT 463

Query: 475 AFAAVPLFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSL 534
              A+ L    L  + +   F+   CVRLI+ WNNSGQK+ Y N +  +L  NP  +W L
Sbjct: 464 --GALLLSQLYLRKA-LGLHFVCFVCVRLIRGWNNSGQKYTYDNTIFELLKANPGVQWYL 520

Query: 535 NSLTFLILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDL------ 588
           N LT   + +       L  I+S  L  LC +YKISW IVN  + ++P ++Q+L      
Sbjct: 521 NILTIFTVGLGGSLGDRLSFILSFSLCALCGSYKISWAIVN--REDVPFWMQELAFKSCL 578

Query: 589 -LTKIDFIPNE---SNLITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITIL 644
             TK    P E     L+ +A+ FF+ +   ++ ++  +K+ V        ++   ++IL
Sbjct: 579 FFTKEHTNPEEVFGKALVPMAQFFFKYFIACLVVKISASKIGVCKA-----NLFSMLSIL 633

Query: 645 LILQTSSQNIGLFIVFQILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGT 704
           L+ Q+ + NI LF +F++L++ +   F ++  S++    Y  +L SL+LQ F+F+QFGGT
Sbjct: 634 LMFQSPTANIPLFFIFEVLRAALSRLFTDYYGSNT----YFVSLSSLLLQYFTFYQFGGT 689

Query: 705 NSISTIDLGNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTF 764
           NSI++IDL NAY+G+  +YNI +VG +M ++NFAP IYWS+   +I   P     K   +
Sbjct: 690 NSIASIDLSNAYNGVPENYNIYLVGFMMFVSNFAPTIYWSLYKSTI---PRPESRKWILY 746

Query: 765 VKSKLPAFTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFL 816
            + K+P   ++C+ G  L+ AC   RFHLFIWSVFSPKLCYF+ WN+ M  +
Sbjct: 747 AEQKIPFLIFNCVVGVFLLIACYVFRFHLFIWSVFSPKLCYFVSWNIFMNII 798

>Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {ON}
           YJL062W (LAS21) - putative membrane protein, a member of
           the major facilitator super family [contig 224] FULL
          Length = 808

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/836 (45%), Positives = 524/836 (62%), Gaps = 43/836 (5%)

Query: 4   KQLMCLSCAQXXXXXXXXXXXXPRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVVIDA 63
           K+L+ L  AQ            P+K VL G ++     D+ R +  +  F KLV +VIDA
Sbjct: 3   KKLLILVVAQLVAILTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPK--FNKLVLIVIDA 60

Query: 64  LRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLN 123
           LRSDF+F   +S+F  VH  LN G+AWGYT+++NPPTVTLPRLK ITTGSTP+F+D +LN
Sbjct: 61  LRSDFVFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 124 VAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQ 183
           VA+D  S++L E DSWL+QF  +N  I+F GDDTWLKLFP E+FD TD T+SFFVSDF +
Sbjct: 121 VAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEE 180

Query: 184 VDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYD 243
           VD NVTR+L  +L  +   WDV ILH+LGLDHIGHK G  S FM+ K +EMD +++ +Y+
Sbjct: 181 VDFNVTRHLPKQLATQ-DSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYN 239

Query: 244 QVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENAL 303
            V E     DTLICV+GDHGMN+LGNHGGSSAGETSAGL+F+S  L  + KP +Q     
Sbjct: 240 SVGE-----DTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETF 294

Query: 304 PINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK--E 361
           PI  T + D+ Y+  V QID+VP+I++LF  PIP NS+G+++PD L+LL  K A +K  +
Sbjct: 295 PIK-TKNDDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMD 353

Query: 362 NFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIITI 421
           N++ L  +S    +++ +  D   IY  M DIQ  L K+AT YNY +L   F S L IT 
Sbjct: 354 NYLQLTTISG---DLMANSSDQDVIYQHMRDIQGDLAKNATKYNYFMLGFGF-SLLFITA 409

Query: 422 IATYQLQRHSGPTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVPL 481
           IAT+ L +   PT  K                  TF SSF+EEEHQLWWW+  A      
Sbjct: 410 IATFLLLK---PTISK--PALVLLIGVSLLLSLSTFGSSFVEEEHQLWWWLAIALTGA-- 462

Query: 482 FAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFLI 541
            +Y    S I    I+L C+RLI+ WNNSGQK+ Y + +  IL +    +W L +LT  +
Sbjct: 463 -SYTQAPSEIKEHLIILLCLRLIRGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFV 521

Query: 542 LLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTKIDFIPNESN- 600
               +    L+    S ++  LC  YK +W IVNG++  +P +LQ ++ K   I N  N 
Sbjct: 522 TQFRAKNKGLVSFQCSFLVSTLCLIYKATWSIVNGEK--VPSWLQRVVMKSFSIMNGENN 579

Query: 601 --------LITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQ 652
                   L+ +AR+FF+    V +  +VL K    D+K  + +++ Y T  LILQTS  
Sbjct: 580 SQADLKESLVPMARLFFKTILAVTLLEIVLHKWNP-DRKRFLHNIQAYCTAFLILQTSPA 638

Query: 653 NIGLFIVFQILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDL 712
           NI  F+V+ IL  ++   ++    S S        L  +VLQN +FFQFG TNSI+T++L
Sbjct: 639 NIPQFLVYLILSEKLESVWRRREWSPSILM-----LAGIVLQNLAFFQFGNTNSIATVNL 693

Query: 713 GNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYE-PASSQNKLQTFVKSKLPA 771
            NAY+GIS +YNI VVG LM ++NFAP+IYWS+    I Y  P   ++K + F+ S++P+
Sbjct: 694 TNAYNGISENYNIYVVGFLMCVSNFAPSIYWSLNCLKILYSFPV--KDKWKIFLASRMPS 751

Query: 772 FTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVIL 827
           F ++CIFG  L+ +C+ LR+HLFIWSVFSPKLCY++ WN+ M  + GWL E  +++
Sbjct: 752 FLFYCIFGCFLLGSCVILRYHLFIWSVFSPKLCYYVSWNIFMNAVIGWLVEATLLV 807

>TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {ON}
           Anc_1.317 YJL062W
          Length = 827

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/846 (45%), Positives = 533/846 (63%), Gaps = 50/846 (5%)

Query: 6   LMCLSCAQXXXXXXXXXXXXPRKIVLPGISQQAPDQDQDRDLQHERP--FQKLVFVVIDA 63
           L+CLS  Q            P+K VL G S        ++ LQ E P  F KL+ VVIDA
Sbjct: 7   LICLSL-QLAAVFIFCIGFFPQKSVLNGSSTF----QIEKSLQQEAPPVFSKLILVVIDA 61

Query: 64  LRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLN 123
           LRSDF+FDS IS+F   H  LN G AWG+T+++NPPTVTLPRLK +TTGSTP+F+D +LN
Sbjct: 62  LRSDFIFDSNISNFPFTHSLLNNGNAWGFTAYSNPPTVTLPRLKGLTTGSTPNFLDAILN 121

Query: 124 VAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQ 183
           VA+D +S++L + DS L QF  +N  IRF GDDTWLKLFP ++F+  + T+SFFVSDFTQ
Sbjct: 122 VAEDDNSSNLKDQDSLLNQFYLNNKKIRFFGDDTWLKLFPLDYFEEHEGTNSFFVSDFTQ 181

Query: 184 VDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYD 243
           VDNNVTR++  +L QE   WDV ILHYLGLDHIGHK GP SKFM TKH+EMD I++ +Y+
Sbjct: 182 VDNNVTRHIPKQL-QEKNDWDVLILHYLGLDHIGHKGGPRSKFMPTKHEEMDGIIRQLYE 240

Query: 244 QVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENAL 303
            +     D+D L+C+LGDHGMNELGNHGGSS GETSA ++F SPKLS F  P+ Q E  L
Sbjct: 241 NL-----DNDGLLCILGDHGMNELGNHGGSSNGETSAAMVFASPKLSNFELPSKQKEIKL 295

Query: 304 PINGTLDRD--FQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPN-KVAS-- 358
           PI    + +  F+YL  +QQ+D VPTIA LF +PIP NSVGIII   L+LL N K+ S  
Sbjct: 296 PITKPSEDENSFKYLTEIQQVDFVPTIATLFNLPIPRNSVGIIIEPLLKLLRNSKLESIK 355

Query: 359 MKENFMHLWRLSD-HQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFL 417
           +KEN+  L  L+  H     +  L+  ++++KM  IQE LT+SATNY Y  L+    S +
Sbjct: 356 LKENYKQLLDLAHIHSTMDDISSLEDFELFTKMVSIQEDLTRSATNYFYEFLAAGIISSI 415

Query: 418 IITIIATYQLQRHSGPTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFA 477
           I TI+    + +       K                   F SSF+EEEHQ+WWWIVT   
Sbjct: 416 IGTILYAVLITKD-----LKFNGIEIISIIISLLIGLSMFGSSFVEEEHQIWWWIVTGLI 470

Query: 478 AVPLFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPF--WKWSLN 535
            + L+   L  +       +  CVRLI+ WNNSGQK++Y + +S+IL+R  +   +W L 
Sbjct: 471 TLSLY---LKPNTKLLHLTLFICVRLIRGWNNSGQKYVYESTISNILSRIEYKDMQWYLI 527

Query: 536 SLTFLILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDL---LTKI 592
             T   +        L    MS  L  L F++K+SW I NG++  +P  ++D+   + K+
Sbjct: 528 LATITFVSFNDSMKNLPTFAMSLSLGVLVFSFKVSWSITNGEK--VPFVIKDMARTVVKL 585

Query: 593 DFIPNESNLIT-------LARVFFQAWAIVVISRLVLTKLKVLDQKY--LIRDMKLYITI 643
            F P+ES  I        LA++FF      ++ +L++ KLK+ D+    +  ++   + +
Sbjct: 586 LF-PDESKDIIFSLALNPLAQLFFHCTLGFLVIKLLIQKLKI-DKTVDNIFDELTKVMNL 643

Query: 644 LLILQTSSQNIGLFIVFQILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGG 703
           + I+QT   NI +F VF+I++  +    ++  +S+     Y++++ SLVLQ+F+FFQFGG
Sbjct: 644 VAIMQTRPSNIPMFCVFEIMKMILVKIIKHDYNSNP----YVTSIASLVLQHFTFFQFGG 699

Query: 704 TNSISTIDLGNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYE-PASSQNKLQ 762
           TNSI+T+DL NAY+G+S +YNI  VGLLM+IANFAP+IYW++  W I Y    +S  + Q
Sbjct: 700 TNSIATVDLSNAYNGVSENYNIYYVGLLMTIANFAPSIYWAVFSWDILYSYDTNSILRRQ 759

Query: 763 TFVKSKLPAFTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPE 822
            F+KSK+    ++ I G  L  +C  LR+HLFIWSVFSPKLCY++ W++ M  + GW+ E
Sbjct: 760 NFMKSKVLPLLFYFIIGCFLFLSCFILRYHLFIWSVFSPKLCYYVAWSIFMNCIVGWVFE 819

Query: 823 LAVILA 828
             ++LA
Sbjct: 820 GILVLA 825

>AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL062W
           (LAS21)
          Length = 806

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/827 (43%), Positives = 509/827 (61%), Gaps = 44/827 (5%)

Query: 1   MNLKQLMCLSCAQXXXXXXXXXXXXPRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVV 60
           M  K++  L C Q            P+K VL G +Q     +  R L  E  F KLV VV
Sbjct: 1   MRFKEVGLLFC-QLLAVLIFAAGFFPQKKVLKGDAQFQYMAETQRAL--EPAFDKLVLVV 57

Query: 61  IDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDL 120
           IDALR+DFLF   +SHF+ VH+ LN GEAWG+T+++NPPTVTLPRLK ITTGS P+F+D 
Sbjct: 58  IDALRADFLFQQNVSHFDFVHELLNRGEAWGFTAYSNPPTVTLPRLKGITTGSAPNFLDA 117

Query: 121 LLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSD 180
           +LNVA+D  S++L + DSW+ QF +H   I F GDDTWLKLFP E+F   D T+SFFVSD
Sbjct: 118 ILNVAEDDSSSNLKDQDSWISQFAKHGKKIHFFGDDTWLKLFPEEFFQKHDGTNSFFVSD 177

Query: 181 FTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKT 240
           F +VD NVTR+L  +L  +   WDV ILHYLGLDHIGHK G  S+FM  KH+EMD++++ 
Sbjct: 178 FEEVDTNVTRHLPHEL--QHKDWDVLILHYLGLDHIGHKGGAASQFMPPKHREMDAVIRQ 235

Query: 241 IYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAE 300
           IYDQV     D+ TL+CV+GDHGMN+LGNHGGSSAGETSAG++F+S  LS + +PA+Q  
Sbjct: 236 IYDQV-----DNRTLLCVMGDHGMNDLGNHGGSSAGETSAGMVFISKMLSSYPRPAAQDG 290

Query: 301 NALPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVAS-M 359
            + P+  T   D+Q+   +QQ+D VPTIA+LF +PIP NS+G+ + +F  LL     + +
Sbjct: 291 VSSPV--TAAEDYQFFTRIQQVDFVPTIASLFNIPIPKNSLGVFVREFSSLLGQHATTKI 348

Query: 360 KENFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLII 419
            EN+  L +L+  +     +D DI  + ++M D+Q TL ++ATNYNY +L L      I+
Sbjct: 349 IENYHQLMQLAAKKTAARGND-DIDSMLAEMKDVQATLARTATNYNYAMLFLGVGMLSIV 407

Query: 420 TIIATYQLQRHSGPTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAV 479
           T    Y     +     +L                  F SSF+EEEHQ+WWWI+ A    
Sbjct: 408 TAATAYCYISSA-----RLNEASVLMIAVTALLGSSVFGSSFVEEEHQIWWWIIIAVVG- 461

Query: 480 PLFAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTF 539
             +++    S      + L C RL++ WNNSGQKF+Y   ++ +L  +P  KW L   T 
Sbjct: 462 --YSWATRPSCTPSHLVFLVCARLLRGWNNSGQKFMYDFTVAELLKSHPSIKWLLVCATL 519

Query: 540 LILLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTKIDFI---- 595
            ++ +     + L  I + +   L F YK  W  VNG+ +  P + Q L+TK   +    
Sbjct: 520 AVVALDGFTERPLLSIFNLLAGLLWFVYKTCWANVNGEVS--PTYAQTLVTKACSLLFAG 577

Query: 596 ----PNESNLITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSS 651
                ++  L+ LAR+FF+  A +V  R+      V  ++  + ++    TI+LI+QT+S
Sbjct: 578 GTPWDDKQLLVPLARLFFKVTAAIVCMRIAYN--VVFAKRKFLSELFPLFTIVLIMQTAS 635

Query: 652 QNIGLFIVFQILQSQICYFFQ-NFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTI 710
           QNI LF+VF I++S +    +  +P      +  +  ++SL+LQN SFFQFGGTNSI+TI
Sbjct: 636 QNIPLFLVFTIMRSSLRNILRVGYPQQ----RCEMFFVLSLILQNLSFFQFGGTNSIATI 691

Query: 711 DLGNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLP 770
           DL N+Y+GIS +YNI VVGLLM I N APAIYWS L   ++++  S     +++ + KL 
Sbjct: 692 DLTNSYNGISENYNIYVVGLLMCIGNMAPAIYWS-LAAVVDHQLYSK----KSYAQQKLS 746

Query: 771 AFTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLN 817
           +  ++ +    L+ ACI +R+HLFIWSVFSPKLCY LGWN+++ FL 
Sbjct: 747 SMFFYSVNSLLLLVACICMRYHLFIWSVFSPKLCYLLGWNILIHFLT 793

>CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062w LAS21
          Length = 842

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/849 (45%), Positives = 528/849 (62%), Gaps = 74/849 (8%)

Query: 26  PRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLN 85
           P+K VL G    A D    RD      F KLV VV+DA+RSDFLFD+ IS F+ +H+ L 
Sbjct: 22  PQKKVLDG--HAALDGTHARD----PVFDKLVVVVVDAMRSDFLFDASISKFHFIHEKLA 75

Query: 86  TGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQ 145
            G AWG+T+ +NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S+ L   DSWL QF  
Sbjct: 76  DGSAWGFTAHSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDTSSSLLAQDSWLWQFRN 135

Query: 146 H-NNTIRFMGDDTWLKLFP--------HEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKL 196
           +    IRF GDDTWLKLFP           FD  + T+SFFVSDFTQVD NVTR++  +L
Sbjct: 136 NAGKRIRFFGDDTWLKLFPPVEANEDSQTMFDEYEGTNSFFVSDFTQVDLNVTRHIDRQL 195

Query: 197 FQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLI 256
            +E ++WDV ILHYLGLDHIGHKDGP+S+FM  KH+EMDSI++ +YD+ L+ +S   TL+
Sbjct: 196 -RETSEWDVLILHYLGLDHIGHKDGPYSRFMGPKHEEMDSIIRKLYDE-LDMQS---TLL 250

Query: 257 CVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENA------LP-INGTL 309
            ++GDHGMN+LGNHGGSSAGETSAG++FLS KL+ + KP+ +  +A      +P +N   
Sbjct: 251 VLMGDHGMNDLGNHGGSSAGETSAGMVFLSDKLAAY-KPSKEQSSAKEFPMKIPSLNAGE 309

Query: 310 DRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPN---KVASMKENFMHL 366
           ++ F YL  +QQID+VPTI++LF + IP N+VG+IIP+FLQL  +   + A +KEN+  L
Sbjct: 310 EKTFHYLKKIQQIDVVPTISSLFNVAIPKNNVGVIIPEFLQLFKDVSLQKAIVKENWNQL 369

Query: 367 WRLSDHQEEVVLD--DLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIITIIAT 424
             L+  + +++ +  +  I D+   M D+QE L K+AT+YNYPLL +     ++IT    
Sbjct: 370 SGLTKGKTQIMEETKNFVIEDVIKNMKDVQENLAKTATDYNYPLLFIGCFLSIVITGTIY 429

Query: 425 YQLQRHSGPTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVPLFAY 484
           Y+  RH       +                  F SSFIEEEHQ WWWI+T    V L   
Sbjct: 430 YRYARH-----VAININTSILIAIAALMGISVFGSSFIEEEHQFWWWIITGL--VLLSMV 482

Query: 485 QLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRN--PFWKWSLNSLTFLIL 542
            LN S      I+L C+RLI+ WNNSGQK+ Y NV++++L  N    W  +L ++T + L
Sbjct: 483 NLNFSSWKSHIIVLFCLRLIRGWNNSGQKYTYDNVIANLLKGNIDALWWLNLITVTVVGL 542

Query: 543 LMASVR-----------SQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTK 591
            + S+R           S LL      +L  + F YK++W IVNG++    LF + +L  
Sbjct: 543 NLKSLRFGNHTVSLLGFSDLLSM---GLLSMITFLYKVNWSIVNGERVP-DLFYKWVLET 598

Query: 592 IDFIPNESN-----------LITLARVFFQAWAIVVISRLVLTK-LKVLDQKYLIRDMKL 639
              I  ++            LI LAR+FF+ +  V++SRL++ K  +V D    +  +  
Sbjct: 599 ASLIVEDATLYREEDLIHTALIPLARIFFKLFFAVLVSRLMIQKFFQVSDISKSLAVVSR 658

Query: 640 YITILLILQTSSQNIGLFIVFQILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFF 699
           Y+TI L+ QT S NIGLF+ F+I+     +  +    S       L+ +  ++LQ F+FF
Sbjct: 659 YVTIFLVFQTPSHNIGLFLFFEIINEITVHIIRERYQSD----YLLAVIFGIILQFFTFF 714

Query: 700 QFGGTNSISTIDLGNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQN 759
           Q GGTNSI+T+DL NAY+G+S +YNI VVGL+M I+NFAP IYWS   W I Y  A+S +
Sbjct: 715 QSGGTNSIATVDLSNAYNGVSENYNIYVVGLMMCISNFAPTIYWSFYNWRITYANANS-S 773

Query: 760 KLQTFVKSKLPAFTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGW 819
           + QT V +K P        G CL+ ACI LR+HLFIWSVFSPKLCY++ W + +G +  W
Sbjct: 774 RWQTLVAAKYPFIIIQSTIGCCLLLACIILRYHLFIWSVFSPKLCYYMVWTIFVGIIVHW 833

Query: 820 LPELAVILA 828
           +PE+ ++L 
Sbjct: 834 IPEILLLLT 842

>Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar to
           Ashbya gossypii AEL166C
          Length = 806

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/807 (44%), Positives = 506/807 (62%), Gaps = 45/807 (5%)

Query: 26  PRKIVLPGISQ--QAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQW 83
           P+K VL G S+    P++ +  + Q    F+K+V +VIDALRSDFLF + +S F+ VH  
Sbjct: 25  PQKSVLTGDSEFLYMPEEHKPMEPQ----FEKMVVMVIDALRSDFLFQANVSGFHFVHDL 80

Query: 84  LNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQF 143
           +N GEAWGYT+++NPPTVTLPRLK ITTGS P+F+D +LNVA+D  S++L + DSWL Q 
Sbjct: 81  INKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAEDDTSSNLKDQDSWLSQL 140

Query: 144 IQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQW 203
            +H   I F GDDTWLKLFP  +F  +D T+SFFVSDF +VD NVTR+L   L   + +W
Sbjct: 141 HKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDRNVTRHLPYDL--SYQEW 198

Query: 204 DVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHG 263
           D+ ILHYLGLDHIGHK G  S+FM  KH EMD+++K IYD V     D+ TL+CVLGDHG
Sbjct: 199 DILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAV-----DERTLVCVLGDHG 253

Query: 264 MNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQID 323
           MN++GNHGGSSAGETSA ++F+S KL+ +  P +Q    +P+  + D D+QYL  +QQ+D
Sbjct: 254 MNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINS-DGDYQYLTRIQQVD 312

Query: 324 IVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVA-SMKENFMHLWRLSDHQEEVVLDDLD 382
           IVPT+ +LF  PIP NSVGIII DFL LL       +K+NF  L +L+++  E     +D
Sbjct: 313 IVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTFAEIKVKDNFRQLMKLANNTPEFAGASID 372

Query: 383 IGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIITIIATYQLQRHSGPTFCKLRTXX 442
           +  +  +M   Q+ L  +ATNYNY  L +  +    ITII + +  R    TF K     
Sbjct: 373 M--LLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYR----TF-KQTKIL 425

Query: 443 XXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVPLFAYQLNASVIARWFIMLACVR 502
                         F+SSF+EEEHQ+WWWI+TA   +   ++ +N S+    F++  C R
Sbjct: 426 SLTVAISLSLGLSMFSSSFVEEEHQIWWWILTAAVGI---SWVMNPSLTWDHFLVSVCAR 482

Query: 503 LIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFLILLMASVRSQLLHCIMSTILVG 562
           LI+ WNNSGQK+IY N +  IL R P  KW +N+ T  ++   +V   L+  + S + V 
Sbjct: 483 LIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETVEFNLMTFVSSFVTVT 542

Query: 563 LCFTYKISWEIVNGDQAEIPLFLQDLLT-KIDFIPNESN-----LITLARVFFQAWAIVV 616
           LC  YK  W +VN  +  +P +LQ  +     F+    N     L+ LAR+ FQ+    +
Sbjct: 543 LCLAYKGCWTLVN--EGLVPNWLQAFVNMTCSFLIGPDNMLKEALVPLARLCFQSILASI 600

Query: 617 ISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVFQILQSQICYFFQNFPS 676
           + R+   + K       ++ +   I  +L+LQTS  NI LF++F +++  I     N  S
Sbjct: 601 VFRVCYNRFK--SSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILTNLSS 658

Query: 677 SSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHGISSDYNISVVGLLMSIAN 736
           +  +    +S ++SL++QNF+FFQFGGTNSI+TI+L N+Y+G+S  YNI VVG L  I+N
Sbjct: 659 NDLSQ---ISCILSLIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFISN 715

Query: 737 FAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPAFTYHCIFGTCLMTACIFLRFHLFIW 796
           FAP IYWS+    +  EP    NK  T++  +LP   ++ + G  L+ +C+ LR+HLFIW
Sbjct: 716 FAPVIYWSLNLIEVYQEP----NKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLFIW 771

Query: 797 SVFSPKLCYFLGWNLVMGFLNGWLPEL 823
           SVFSPKLCY++ W+++   +NG L  L
Sbjct: 772 SVFSPKLCYYIAWSIL---INGLLEHL 795

>KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 810

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/819 (45%), Positives = 510/819 (62%), Gaps = 48/819 (5%)

Query: 26  PRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLN 85
           P+K VL G +Q     +  R +  +  F+K+V V++DALRSDF+F   +S F  +H+ LN
Sbjct: 25  PQKSVLQGDAQFNYKPEAHRRMAPK--FEKMVLVIVDALRSDFVFQKDMSEFGFLHKLLN 82

Query: 86  TGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQ 145
            G AWGYT+++NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S++L E DSWL+QF  
Sbjct: 83  KGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLKEQDSWLRQFRM 142

Query: 146 HNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQWDV 205
           H   I+F GDDTWLKLFP E+FD TD T+SFFVSDF +VD NVTR+L  +L Q    WDV
Sbjct: 143 HQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRHLPQQL-QSQDSWDV 201

Query: 206 AILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMN 265
            ILHYLGLDHIGHK G  S FM  KH+EMD++++ IY+ V E     DTLICV+GDHGMN
Sbjct: 202 LILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGE-----DTLICVMGDHGMN 256

Query: 266 ELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQIDIV 325
           +LGNHGGSSAGETSA L+F+S  L ++ KP +Q    +P+  +   ++ YL  V QID V
Sbjct: 257 DLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASS-SPEYNYLTKVNQIDFV 315

Query: 326 PTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK--ENFMHLWRLSDHQEEVVLDDLDI 383
           PTIA LF +P+P NS+G++IPDFL+LL    A  K  +N+  L  +S    +  L D D 
Sbjct: 316 PTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSISGGSTK-KLGDPDA 374

Query: 384 GDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIITIIATYQLQRHSGPTFCKLRTXXX 443
             I  +M ++Q  L K+ATNYNY LL + F + L+++ +A +        TF        
Sbjct: 375 --IIEEMREVQSDLAKTATNYNYLLLGIGFLTLLVVSSVALFFSWTSFPSTFGLFLL--- 429

Query: 444 XXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVPLFAYQLNASVIARWFIMLACVRL 503
                       TF SSFIEEEHQ+WWW  T+ A V L +Y      +     +LA +RL
Sbjct: 430 --LGTSLLLSLSTFGSSFIEEEHQIWWW--TSIALVGL-SYISAPRELGDHLTVLAVLRL 484

Query: 504 IKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFLILLMASVRSQLLHCIMSTILVGL 563
           I+ WNNSGQKF+Y   +  +L ++   +W L + T  ++              S ++  L
Sbjct: 485 IRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAFQYSFLMSVL 544

Query: 564 CFTYKISWEIVNGDQAEIPLFLQDLLTK---------IDFIPNESNLITLARVFFQAWAI 614
           C  YK +W IVN +Q  +P +LQ +  +          D I     L+ +AR+FFQ  A 
Sbjct: 545 CLVYKATWSIVNNEQ--VPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVTAA 602

Query: 615 VVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVFQILQSQICYFFQ-- 672
           V+   ++  + K  +   L+ ++  +I+ LLILQTSS NI  F+ F IL  ++   +   
Sbjct: 603 VIAVEVIRHQFKP-NGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLWSRR 661

Query: 673 --NFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHGISSDYNISVVGL 730
             +FP       V ++  V+LVLQ+ SFFQFG TNSI+T+ L NAY+G+S +YNI VVG 
Sbjct: 662 QWSFP-------VLMT--VNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGA 712

Query: 731 LMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPAFTYHCIFGTCLMTACIFLR 790
           LM ++NFAP+IYWS+    I Y   S+Q+K +TF  S+LP+F Y+C+FG  L+ +C+ LR
Sbjct: 713 LMCVSNFAPSIYWSLSCLKILYS-KSTQSKWETFFTSRLPSFLYYCLFGCFLLGSCVILR 771

Query: 791 FHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVILAL 829
           +HLFIWSVFSPKLCY++ WNL M  +  W  E  ++  L
Sbjct: 772 YHLFIWSVFSPKLCYYVSWNLFMNAIIAWFFEGTLVALL 810

>KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 787

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/817 (44%), Positives = 504/817 (61%), Gaps = 90/817 (11%)

Query: 26  PRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLN 85
           P+K+VL   S+   + +    L  +  F+KLV VVIDALRSDFLF    S F  +H  LN
Sbjct: 26  PQKVVLKNDSKFIVNPE--VQLASKPVFKKLVLVVIDALRSDFLFQKDSSDFEFLHGLLN 83

Query: 86  TGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQ 145
           +GEAWGYT+++NPPTVTLPRLK ITTGS P+F+D +LNVA+D  S++L E DS L+QF  
Sbjct: 84  SGEAWGYTAYSNPPTVTLPRLKGITTGSAPNFLDAILNVAEDDTSSNLKEQDSLLKQFHT 143

Query: 146 HNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQWDV 205
           H+  + F GDDTWLKLFP E+F   D T+SFFVSDF +VD NVTR++  ++ +    WDV
Sbjct: 144 HHYKMNFFGDDTWLKLFPLEFFSEYDGTNSFFVSDFEEVDFNVTRHVPYQM-EHQKNWDV 202

Query: 206 AILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMN 265
            ILHYLGLDHIGHK G  S FM +KH+EMDS++K IY+++     D DTL+ VLGDHGMN
Sbjct: 203 LILHYLGLDHIGHKGGSKSHFMPSKHREMDSVIKQIYEKI-----DGDTLMVVLGDHGMN 257

Query: 266 ELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQIDIV 325
           +LGNHGGSS+GETSA L FLS +L ++     Q  + +P+      D++YL  V+QIDIV
Sbjct: 258 DLGNHGGSSSGETSAALAFLSKRLKKYQSSDIQQSSNVPVEDA-HPDYKYLKEVEQIDIV 316

Query: 326 PTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK--ENFMHLWRLSDHQEEVVLDDLDI 383
           PT++ LF +PIP NS+G+II + LQLLP+K+A++K  +N++ L +L     E  L+    
Sbjct: 317 PTLSMLFNLPIPKNSMGVIIDELLQLLPSKLAAIKVQDNYLQLTKLKPGY-EAQLEKKSA 375

Query: 384 GDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIITIIAT---YQLQR----HSGPTFC 436
           G +  +M +IQ +L  +ATNYNY  L+      +I T+I T   +QL +    H G +  
Sbjct: 376 GTLLEEMREIQSSLAMAATNYNYTFLTYGTTLMIIGTLIVTVWNFQLSQEYIEHVGTS-- 433

Query: 437 KLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVPLFAYQLNASVIARWFI 496
                               FASSFIEEEHQ+WWWI  +     L   Q++     +  +
Sbjct: 434 -------------VLLGISMFASSFIEEEHQIWWWITISV----LLLMQISN---GKKLV 473

Query: 497 MLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFLILLMASVR----SQLL 552
           +L+ +RLI+ WNNSGQK+IY NV+ ++L  +    W LN +TFL +    +R    S+ +
Sbjct: 474 VLSGLRLIRGWNNSGQKYIYDNVLHTLLKSHTSVLWWLNVVTFLSVGFPFLRNKDESEKM 533

Query: 553 HCIMSTILVGL-CFTYKISWEIVNGDQAEIPLFLQDLLTKIDFIPNESN--------LIT 603
             ++S   + L   TYKI + IVNGD+    L+   L +   ++ NE+         L+ 
Sbjct: 534 VSLLSVSFLALSSITYKICFAIVNGDKVPSGLYTFALRSCAMYLANENATESDISQCLVP 593

Query: 604 LARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVFQIL 663
           +AR+FFQ   + +I  L+  K  +     ++  +   I  +L+LQTSS NI LF++F+IL
Sbjct: 594 IARIFFQICGVSII-ILLFMKYALNKSTNMLNKLLSVIKFVLLLQTSSANIPLFLIFEIL 652

Query: 664 QSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHGISSDY 723
            S           +   T ++     SL LQN +FFQFGGTNSI+T++L NAY+G+SS+Y
Sbjct: 653 TS----------VTPDITPIF-----SLCLQNLTFFQFGGTNSIATVNLTNAYNGVSSNY 697

Query: 724 NISVVGLLMSIANFAPAIYW--SMLPWSINYEPASSQNKLQTFVKSKLPAFTYHCIFGTC 781
           NI VVG+LM ++N+AP+IYW  S++P S                K K     ++ I GTC
Sbjct: 698 NIYVVGVLMFLSNYAPSIYWALSLIPQS---------------YKQKTLRLQHYYITGTC 742

Query: 782 LMTACIFLRFHLFIWSVFSPKLCYFLGW---NLVMGF 815
           LM ACI LR+HLFIWSVFSPKLCY+  W   N+VM F
Sbjct: 743 LMIACIALRYHLFIWSVFSPKLCYYAAWSLYNVVMDF 779

>TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {ON}
           Anc_1.317 YJL062W
          Length = 824

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/825 (46%), Positives = 517/825 (62%), Gaps = 52/825 (6%)

Query: 26  PRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLN 85
           P K VL G  +   + +++  L  +  F KLVFVVIDALRSDFL++ + SHF+ VH+ LN
Sbjct: 23  PSKNVLQGSGEF--NFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQNSHFHFVHRVLN 80

Query: 86  TGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQ 145
           +GEAWG+T+F+NPPTVTLPRLK ITTGSTP+F+D +LNVA+D  S+ L + DSWL QF +
Sbjct: 81  SGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQDSWLMQFYK 140

Query: 146 HNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQWDV 205
           HN  IRF GDDTWLKLFP   F   + T+SFFVSDF QVD NVTR+L+ K F+E  QWDV
Sbjct: 141 HNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLE-KQFKEKEQWDV 199

Query: 206 AILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMN 265
            ILHYLGLDHIGHK G  SKFM  KH+EMDSIL+ IY+ + + E   DTL+CV+GDHGMN
Sbjct: 200 LILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTE---DTLLCVMGDHGMN 256

Query: 266 ELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPI--NGTL---DRDFQYLDSVQ 320
             GNHGGSS+GETSAGL  +S K  +  KP  Q    LPI  N  L   ++D+++L  VQ
Sbjct: 257 NGGNHGGSSSGETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKFLSFVQ 316

Query: 321 QIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKV--ASMKENFMHLWRLSDH-QEEVV 377
           Q+D VPT++ALF +P+P+NSVG++IP+ L+LL  K+    +KENF  L  LS       +
Sbjct: 317 QVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSLTTRNI 376

Query: 378 LDDLD-----IGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIITIIATYQLQRHSG 432
            + +D     I DI S+M  +Q  L KSATNYN   + +A     I+T+I  +  +  S 
Sbjct: 377 YNAIDFQNDTIEDIISQMQSVQSELMKSATNYNMNAIYIAIILLSIVTLIIIH--KAFSN 434

Query: 433 PTFCKLRTXXXXXXXXXXXXXXXTFASSFIEEEHQLWWWIVTAFAAVPLFAYQLNASVIA 492
             F  L                 +FASSFIEEEHQ+WWW++T   A   F+   N+    
Sbjct: 435 YKFNILPV------AVSLIIGLSSFASSFIEEEHQIWWWLITGMCA---FSLVYNSDSKF 485

Query: 493 RWFIMLACVRLIKFWNNSGQKFIYTNVMSSILN-RNPFWKWSLNSLTFLILLMASVRSQL 551
             FI+  C+RLI+ WNNSGQK+ Y   +SS+L  +   ++W LN+ T L  +     +  
Sbjct: 486 SNFIVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKGSMNNF 545

Query: 552 LHCIMSTILVGLCFTYKISWEIVNGDQAEIP--------LFLQDLLTKIDFIP---NESN 600
              + S +L  LC  YK+SW IVN  Q  +P        +    L++  +  P    ES 
Sbjct: 546 PSFMSSFLLANLCLMYKVSWAIVN--QEHVPDTIKHYVLVLCTHLMSARNVAPLQLFEST 603

Query: 601 LITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQNIGLFIVF 660
           LI LAR+FF    I++   LV+ KL        + ++K  I  LLI QTS +NIGL+++F
Sbjct: 604 LIPLARLFFCCVVILLSLTLVIGKLSPTRLGNPVSNIKKIIIFLLIFQTSPENIGLYLLF 663

Query: 661 QILQSQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYHGIS 720
            IL++ +        S ++     L   +SLV+Q F+F+QFG TNSI+TIDL NAY+G+S
Sbjct: 664 GILETNLTDIIDKHYSGNTQ----LITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVS 719

Query: 721 SDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSKLPAFTYHCIFGT 780
            DYNI  VG +MSI+N+APAIYWSM PW I+     ++ K + F++ K     ++CI G 
Sbjct: 720 EDYNIYFVGWMMSISNYAPAIYWSMFPWIID----DNKQKWKKFIERKNIILLFNCISGL 775

Query: 781 CLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAV 825
            L+  C  LR+HLFIWSVFSPKLCY++ WN+ M  + GW+ E  V
Sbjct: 776 FLLITCTILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILETLV 820

>KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa]
           {ON} similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1016

 Score =  180 bits (456), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 127/377 (33%), Positives = 184/377 (48%), Gaps = 57/377 (15%)

Query: 49  HERPFQKLVFVVIDALRSDFLF------DSRISHFNN----VHQWLNTGEAWGYTSF--- 95
           HE  F K V +VIDALR DF        ++  S+F+N    +H   N   +  ++S    
Sbjct: 79  HEARFSKCVILVIDALRFDFSIPVDPADNAFNSYFHNNLDVLHTSFNNATSETHSSLLLK 138

Query: 96  --ANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFM 153
             A+PPT TL RLK +TTGS P+FID     A    +  + E D+ ++Q   +N ++ F 
Sbjct: 139 FIADPPTTTLQRLKGLTTGSLPTFID-----AGSNFNGAVIEEDNLIKQMFLNNQSVLFA 193

Query: 154 GDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLF---QEWAQWDVAILHY 210
           GDDTW  LF       + P  S  V D   VDN V R  +  LF   ++  +WDV I H 
Sbjct: 194 GDDTWDNLFNPFLSPASQPFESLNVWDLDTVDNGVIRFFEDNLFAKSEKSEEWDVLIGHM 253

Query: 211 LGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGNH 270
           LG+DH+GHK GP+   M  K  + +  +K I + +     DDDTL+ V+GDHGM+  GNH
Sbjct: 254 LGIDHVGHKYGPNHFTMKEKQLQANEFIKRICESI-----DDDTLLVVMGDHGMDHTGNH 308

Query: 271 GGSSAGETSAGLLFLSPKLS-------QFVKPASQAENALPINGTLDRDFQYLDSVQQID 323
           GG S  E  A L   S + +       QF   ++  EN   +N              QID
Sbjct: 309 GGDSKSELEAALWLHSKRPNMWSHLPEQFYDISALGENYRQVN--------------QID 354

Query: 324 IVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMKENFMHLWRLSDHQEEVVLDDLDI 383
           +VPT++ L G+PIP N++G  I         +VA+ +E      +++  Q +   D   +
Sbjct: 355 LVPTLSLLLGLPIPFNNLGWPI--------QEVAATQEQLRSYSKIALDQIKAYKDISRV 406

Query: 384 GDIYSKMHDIQETLTKS 400
                K   + E L +S
Sbjct: 407 ITAAEKNERLNELLNES 423

>CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highly
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031c GPI13
          Length = 1019

 Score =  179 bits (455), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 119/363 (32%), Positives = 186/363 (51%), Gaps = 42/363 (11%)

Query: 44  DRDLQHERPFQKLVFVVIDALRSDFLFDSRISHFN---NVHQ--------WLNT--GEAW 90
           D  L  ++ F K+V +V+DALR DF+     SH N   N H         WL+T  G   
Sbjct: 72  DNPLAVDKKFDKMVLLVVDALRFDFVVPVSTSHPNYNENFHNNLDVLYNTWLSTRHGGRG 131

Query: 91  GYTS---------FANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQ 141
           GY++          A+PPT TL RLK +TTGS P+FID       + D + + E D+ ++
Sbjct: 132 GYSNSGSSILLKFIADPPTTTLQRLKGLTTGSLPTFID----AGSNFDGSVI-EEDNLIK 186

Query: 142 QFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWA 201
           Q    N ++ F+GDDTW  LF     + ++P  S  V D   VDN V    +  L  + A
Sbjct: 187 QLFLANKSVSFVGDDTWDALFHPFLANNSEPYPSLNVWDLDTVDNGVISYFKSHLLDKSA 246

Query: 202 --QWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVL 259
              WD+ + H LG+DH+GHK GP+   M  K  +++  ++ I + +     D+DTL+ V+
Sbjct: 247 DRNWDILVGHMLGVDHVGHKYGPNHFTMREKQNQVNRFIQEIIESI-----DNDTLLVVM 301

Query: 260 GDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSV 319
           GDHGM+  GNHGG S  E  + L F + + + +     + +N    N  ++   Q   SV
Sbjct: 302 GDHGMDHTGNHGGDSQDELESTLFFYTKRQNTW-----KNQNG---NYDIENLAQNYHSV 353

Query: 320 QQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMKENFMHLWRLSDHQEEVVLD 379
            QID+VPT++ L  +P+P N++G  I +  +    ++A        L R +D  +    +
Sbjct: 354 NQIDLVPTLSLLLDIPVPFNNLGWPISEAFENEKEELACDNVVLQQLKRYADVMQLTYTE 413

Query: 380 DLD 382
           +L+
Sbjct: 414 ELE 416

>Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} similar
           to Ashbya gossypii AGR126C
          Length = 1014

 Score =  174 bits (440), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 111/301 (36%), Positives = 159/301 (52%), Gaps = 28/301 (9%)

Query: 53  FQKLVFVVIDALRSDFLF--DSRISHFN-NVHQWLNT-GEAWGYTSF----ANPPTVTLP 104
           F K V +++DALR DF+   D+    +N N H  L    E W  +      A+PPT TL 
Sbjct: 88  FDKAVILIVDALRFDFVIPVDTAAEGYNDNYHNNLKVLYEYWDNSVLLKFIADPPTTTLQ 147

Query: 105 RLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPH 164
           RLK +TTGS P+FID   N      + D+   D+ ++Q   HN +I F+GDDTW  LF  
Sbjct: 148 RLKGLTTGSLPTFIDAGSNF-----NGDVIVEDNLIKQLYLHNKSIYFVGDDTWDALFHP 202

Query: 165 EWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWA---QWDVAILHYLGLDHIGHKDG 221
              + + P  S  V D   VDN V    +  L  +     +WDV I H LG+DH+GHK G
Sbjct: 203 YLSNMSVPYESLNVWDLDTVDNGVISYFEEHLLDKDPLDREWDVLIGHMLGIDHVGHKYG 262

Query: 222 PHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAG 281
           P+   MS K Q++D  ++ +   +     D+DTL+ V+GDHGM+  GNHGG S  E  + 
Sbjct: 263 PNHFTMSEKQQQVDKFIRKVIASI-----DEDTLLVVMGDHGMDHTGNHGGDSNDELEST 317

Query: 282 LLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSV 341
           L   S + + +   +    N       L  +++    V QID+VPT++ L G PIP N++
Sbjct: 318 LWLHSKRKNAWKLKSPDQYNT----SRLGENYR---QVNQIDLVPTLSLLLGTPIPFNNL 370

Query: 342 G 342
           G
Sbjct: 371 G 371

>KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C,
          Length = 1005

 Score =  172 bits (435), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 116/312 (37%), Positives = 161/312 (51%), Gaps = 32/312 (10%)

Query: 44  DRDLQHERPFQKLVFVVIDALRSDFLF--DSRISHFN-NVHQWLNTGEAWGYTS------ 94
           D  L  E  + K+V +++DALR DF+   D   + +N N H  L       + S      
Sbjct: 79  DPQLPFEAKYDKMVLLIVDALRFDFVIPVDENHAKYNPNYHNNLKVLYETAHNSTDSVLL 138

Query: 95  --FANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRF 152
              A+PPT TL RLK +TTGS P+FID   N   DV      + D+ ++Q   HN  I F
Sbjct: 139 KFLADPPTTTLQRLKGLTTGSLPTFIDAGSNFNGDV-----IDEDNLIKQLYLHNKKIFF 193

Query: 153 MGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQE--WAQWDVAILHY 210
            GDDTW  LF       + P  S  V D   VDN V   L+   F E   +++D+ I H 
Sbjct: 194 AGDDTWDALFNPYLAPESVPYESLNVWDLDTVDNGVISYLEEYYFNEEKRSEYDILIGHM 253

Query: 211 LGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGNH 270
           LG+DH+GHK GP+   M  K  ++D +L+ I        +DD+TL  V+GDHGM+  GNH
Sbjct: 254 LGVDHVGHKYGPNHFTMKEKQLQVDELLRKIIST-----ADDNTLYVVMGDHGMDHTGNH 308

Query: 271 GGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQIDIVPTIAA 330
           GG S  E       L   L  + K A+ +++    N T D    Y   + QID+VPT++ 
Sbjct: 309 GGDSQDE-------LESVLWLYAKNANWSKDYDSYNTT-DLGTSY-KQMNQIDLVPTLSL 359

Query: 331 LFGMPIPMNSVG 342
           L G+PIP N++G
Sbjct: 360 LLGIPIPFNNLG 371

>YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}
           GPI13ER membrane localized phosphoryltransferase that
           adds phosphoethanolamine onto the third mannose residue
           of the glycosylphosphatidylinositol (GPI) anchor
           precursor; similar to human PIG-O protein
          Length = 1017

 Score =  171 bits (433), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 119/325 (36%), Positives = 162/325 (49%), Gaps = 35/325 (10%)

Query: 34  ISQQAPDQDQDRDLQHERP--FQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWG 91
           +S+   D    ++   + P  F K V +VIDALR DF      SH N    + N   +  
Sbjct: 59  LSRHVLDNISSQNETSKLPPRFNKAVILVIDALRFDFAIPVNESHSNYNLNYHNNILSL- 117

Query: 92  YTSFA--------------NPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHD 137
           Y SFA              +PPT TL RLK +TTGS P+FID       + D   + E D
Sbjct: 118 YDSFASDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFID----AGSNFDGTVI-EED 172

Query: 138 SWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLF 197
           ++L+Q    N T++F GDDTW+ LF     + + P  S  V D   VDN V       L 
Sbjct: 173 NFLKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLESLNVWDLDTVDNGVMDYFHDHLQ 232

Query: 198 QEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLIC 257
           Q+  +WDV I H LG+DH+GHK GP    M  K  ++D  +  I   +     DDDTL+ 
Sbjct: 233 QD-KEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDQFIDWILKSI-----DDDTLLV 286

Query: 258 VLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLD 317
           +LGDHGM+  GNHGG S  E  + L   S K   +    +   N       L  D++   
Sbjct: 287 ILGDHGMDHTGNHGGDSIDELESTLFLYSKKPDMWRLKETSNYNI----DNLGHDYR--- 339

Query: 318 SVQQIDIVPTIAALFGMPIPMNSVG 342
           SV+QID+V ++A L G PIP N++G
Sbjct: 340 SVRQIDLVSSLALLMGQPIPFNNLG 364

>NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON}
           Anc_4.28
          Length = 1034

 Score =  171 bits (432), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 111/313 (35%), Positives = 155/313 (49%), Gaps = 40/313 (12%)

Query: 53  FQKLVFVVIDALRSDFL-----------------FDSRISHFNNVHQWLNTGEAWGYTSF 95
           F K V VVIDALR DF+                 F     HFN      +   +      
Sbjct: 92  FDKTVIVVIDALRFDFVIPVDESNPNYNPNYHNNFKVMYDHFNETS---SADSSLLLKFI 148

Query: 96  ANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGD 155
           A+PPT TL RLK +TTGS P+FID       + D + + E D+ ++Q   +N T+ F+GD
Sbjct: 149 ADPPTTTLQRLKGLTTGSLPTFID----AGSNFDGSVI-EEDNLIKQMYLNNKTVYFVGD 203

Query: 156 DTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLF------QEWAQWDVAILH 209
           DTW  LF       + P  S  V D   VDN V    + +L       +E  +WDV I H
Sbjct: 204 DTWDSLFHPFLSSKSQPFESLNVWDLDTVDNGVISYFEKELISKKNNQKEEKEWDVLIGH 263

Query: 210 YLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGN 269
            LG+DH+GHK GP    M  K  +++  +  + D +     D+DTL+ V+GDHGM+  GN
Sbjct: 264 MLGMDHVGHKYGPSHFSMKDKQLQLNEFVTKVIDSL-----DEDTLLVVMGDHGMDHTGN 318

Query: 270 HGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQIDIVPTIA 329
           HGG S  E  + L   S K   +       E    +N  L + ++    V QID+VPT++
Sbjct: 319 HGGDSQDELESTLFLFSKKQQMWNLDPDNQETLYNVN-KLGKHYR---QVNQIDLVPTLS 374

Query: 330 ALFGMPIPMNSVG 342
            L G+PIP N++G
Sbjct: 375 LLTGLPIPFNNLG 387

>Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON}
           complement(442..3471) [3030 nt, 1010 aa]
          Length = 1009

 Score =  168 bits (425), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 110/318 (34%), Positives = 158/318 (49%), Gaps = 36/318 (11%)

Query: 44  DRDLQHERPFQKLVFVVIDALRSDFLFDSRIS---HFNNVH--------QWLNTGEAWGY 92
           D +  + + F K V ++IDALR DF+     +   H  N H        Q+++      +
Sbjct: 64  DLNQDYTKKFDKAVILIIDALRFDFVIPVNSTDPLHNQNYHNNIITLYDQFISQNNNKDH 123

Query: 93  TSF-----ANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHN 147
           +S      A+PPT TL RLK +TTGS P+FID   N    V      E D+ ++Q    N
Sbjct: 124 SSILLKFIADPPTTTLQRLKGLTTGSLPTFIDAGTNFDGSV-----IEEDNLIKQLYLKN 178

Query: 148 NTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWA---QWD 204
             I F+GDDTW  LF     + + P  S  V D   VDN V       L  +     +WD
Sbjct: 179 EEIYFVGDDTWDSLFNPFLSNHSKPFESLNVWDLDTVDNGVISYFNDHLINQKTNDKKWD 238

Query: 205 VAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGM 264
           + I H LG+DH+GHK GP+   M  K  ++++ +  I + +     DDDTL+ ++GDHGM
Sbjct: 239 ILIGHMLGVDHVGHKYGPNHFTMREKQLQVNNFINDIIESI-----DDDTLLVIMGDHGM 293

Query: 265 NELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQIDI 324
           +  GNHGG S  E  + L   S K   +       E   P N  ++       SV QID+
Sbjct: 294 DHTGNHGGDSKDELESTLFMYSKKTDVW-------ELGDPNNYNIENSGDNYRSVNQIDL 346

Query: 325 VPTIAALFGMPIPMNSVG 342
           VPT++ L  +PIP N++G
Sbjct: 347 VPTLSLLLDVPIPFNNLG 364

>SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1013

 Score =  168 bits (425), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 163/306 (53%), Gaps = 33/306 (10%)

Query: 53  FQKLVFVVIDALRSDFLF---DSRISHFNNVHQWLNT-GEAWGYTS---------FANPP 99
           F K V +V+DALR DF+    +++  +  N H  L    E +   S          A+PP
Sbjct: 82  FDKAVVLVVDALRFDFVIPVSETQDYYNENYHNNLEVLYEKFKDVSESSSLLLKFIADPP 141

Query: 100 TVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWL 159
           T TL RLK +TTGS P+FID   N      + ++ E D+ ++Q   ++ T+ F GDDTW 
Sbjct: 142 TTTLQRLKGLTTGSLPTFIDAGSNF-----NGEVIEEDNLIKQMFLNDKTVFFAGDDTWN 196

Query: 160 KLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQE---WAQWDVAILHYLGLDHI 216
            LF     + + P  S  V D   VDN V    +  LF++     +WDV I H LG+DH+
Sbjct: 197 ALFSPFLAEQSRPYESLNVWDLDTVDNGVISFFKEHLFEKTPAQREWDVLIGHMLGIDHV 256

Query: 217 GHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAG 276
           GHK GP+   M  K  ++D+ ++ I + +     D+DTL+ +LGDHGM+  GNHGG S  
Sbjct: 257 GHKYGPNHFTMREKQLQVDNFIRQIMESI-----DEDTLLVILGDHGMDHTGNHGGDSRD 311

Query: 277 ETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPI 336
           E  + L   S K   +   + +  +       L ++++    V QID+VPT++ L G+PI
Sbjct: 312 ELESTLWLHSKKHGMWDHYSDETYDT----SELGKNYR---QVNQIDLVPTLSLLLGLPI 364

Query: 337 PMNSVG 342
           P N++G
Sbjct: 365 PFNNLG 370

>TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1026

 Score =  167 bits (424), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 116/340 (34%), Positives = 172/340 (50%), Gaps = 43/340 (12%)

Query: 30  VLPGISQQAPD----QDQDRDLQHERPFQKLVFVVIDALRSDFLF--DSRISHFN-NVHQ 82
           VL  I++  P        +    H++ F+K V +VIDALR DF+   ++  S +N N H 
Sbjct: 54  VLDDINELKPSMYAANSSNNGFVHQQKFEKTVILVIDALRFDFVIPVNTNNSAYNSNHHN 113

Query: 83  WLNT------GEAWGYTS--------FANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDV 128
            + T       E+ G            A+PPT TL RLK +TTGS P+FID       + 
Sbjct: 114 KITTLYDQFCKESVGKKQNNSLLLKFLADPPTTTLQRLKGLTTGSLPTFID----AGSNF 169

Query: 129 DSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNV 188
           D   + E D+ ++Q   +N  + F+GDDTW  LF     + + P  S  V D   VDN V
Sbjct: 170 DGTVI-EEDNLIKQMYLNNKEVFFVGDDTWDALFSPFLSNHSIPYESLNVWDLDTVDNGV 228

Query: 189 TRNLQGKLF--QEW----AQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIY 242
                  L   +E+    +QW+V I H LG+DH+GHK GP+   M  K  ++++ +  I 
Sbjct: 229 ISYFNDNLIRSEEYKKKNSQWNVLIGHMLGVDHVGHKYGPNHFTMKEKQLQVNNFINDII 288

Query: 243 DQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENA 302
           + +     DDDTL+ ++GDHGM+  GNHGG S  E  + L   S +     +   + E+ 
Sbjct: 289 NVI-----DDDTLLVIMGDHGMDHTGNHGGDSIDELESTLFLYSKR-----QNVWKLEDD 338

Query: 303 LPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVG 342
             +    D    Y  S+ QID+VPT+A L  +PIP N++G
Sbjct: 339 HSVYNIDDLGSNY-KSINQIDLVPTLALLLDIPIPFNNLG 377

>Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa]
           {OFF} YLL031C (GPI13) - phosphoryltransferase that adds
           phosphoethanolamine to the third mannose residue of the
           GPI anchor precursor [contig 141] PARTIAL
          Length = 602

 Score =  164 bits (414), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 114/310 (36%), Positives = 159/310 (51%), Gaps = 32/310 (10%)

Query: 48  QHERPFQKLVFVVIDALRSDFLF--DSRISHFN-----NVHQWLNTGEAWGYTSF----- 95
            +E  F K V +VIDALR DF    D + + +N     N+  + +      ++S      
Sbjct: 82  DYEPKFDKCVILVIDALRFDFSIPIDPQENGYNPYYHNNLDVFHSGFRDQNHSSLLLKFI 141

Query: 96  ANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGD 155
           ++PPT TL RLK +TTGS P+FID   N      +  + E D+ ++Q   +N TI F GD
Sbjct: 142 SDPPTTTLQRLKGLTTGSLPTFIDAGSNF-----NGAIIEEDNLIKQMYLNNKTILFAGD 196

Query: 156 DTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLF---QEWAQWDVAILHYLG 212
           DTW  LF       + P  S  V D   VDN V    +  L    ++ A WDV I H LG
Sbjct: 197 DTWDNLFGTFLSPSSKPYESLNVWDLDTVDNGVIDYFEEHLLSPAKDEAHWDVLIGHMLG 256

Query: 213 LDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGNHGG 272
           +DH+GHK GP+   M  K  + +  +K I +++     DDDTL+ V+GDHGM+  GNHGG
Sbjct: 257 IDHVGHKYGPNHFTMKEKQLQANEFIKRICEKL-----DDDTLLVVMGDHGMDHTGNHGG 311

Query: 273 SSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQIDIVPTIAALF 332
            S  E  A L   S K   +      A N   + G   R+      V QID+V T++ L 
Sbjct: 312 DSRSELEATLWMYSTKPDMWNHLPQDAYNT-SVLGENHRE------VNQIDLVSTLSLLL 364

Query: 333 GMPIPMNSVG 342
           G+PIP N++G
Sbjct: 365 GLPIPFNNLG 374

>Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)
           [2871 bp, 956 aa] {ON} ANNOTATED BY YGOB -
          Length = 956

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 114/309 (36%), Positives = 159/309 (51%), Gaps = 32/309 (10%)

Query: 49  HERPFQKLVFVVIDALRSDFLF--DSRISHFN-----NVHQWLNTGEAWGYTSF-----A 96
           +E  F K V +VIDALR DF    D + + +N     N+  + +      ++S      +
Sbjct: 83  YEPKFDKCVILVIDALRFDFSIPIDPQENGYNPYYHNNLDVFHSGFRDQNHSSLLLKFIS 142

Query: 97  NPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDD 156
           +PPT TL RLK +TTGS P+FID   N      +  + E D+ ++Q   +N TI F GDD
Sbjct: 143 DPPTTTLQRLKGLTTGSLPTFIDAGSNF-----NGAIIEEDNLIKQMYLNNKTILFAGDD 197

Query: 157 TWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLF---QEWAQWDVAILHYLGL 213
           TW  LF       + P  S  V D   VDN V    +  L    ++ A WDV I H LG+
Sbjct: 198 TWDNLFGTFLSPSSKPYESLNVWDLDTVDNGVIDYFEEHLLSPAKDEAHWDVLIGHMLGI 257

Query: 214 DHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGNHGGS 273
           DH+GHK GP+   M  K  + +  +K I +++     DDDTL+ V+GDHGM+  GNHGG 
Sbjct: 258 DHVGHKYGPNHFTMKEKQLQANEFIKRICEKL-----DDDTLLVVMGDHGMDHTGNHGGD 312

Query: 274 SAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQIDIVPTIAALFG 333
           S  E  A L   S K   +      A N   + G   R+      V QID+V T++ L G
Sbjct: 313 SRSELEATLWMYSTKPDMWNHLPQDAYNT-SVLGENHRE------VNQIDLVSTLSLLLG 365

Query: 334 MPIPMNSVG 342
           +PIP N++G
Sbjct: 366 LPIPFNNLG 374

>KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4.28
           YLL031C
          Length = 1017

 Score =  164 bits (416), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 109/325 (33%), Positives = 162/325 (49%), Gaps = 32/325 (9%)

Query: 30  VLPGISQQAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLF-----DSRISHFNNVH--- 81
           VL  IS+     D    LQ    F + V +++DALR DF+       +  ++ NN++   
Sbjct: 63  VLDNISKA----DSQLTLQSSPKFDRAVVLIVDALRFDFVIPIEKEKANSNYHNNINIMY 118

Query: 82  -QWLNTGEAWG---YTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHD 137
            ++++  E+         A+PPT TL RLK +TTGS P+FID   N      + D  E D
Sbjct: 119 DKFMDNSESCSSLLLKFMADPPTTTLQRLKGLTTGSLPTFIDAGSNF-----NGDTIEED 173

Query: 138 SWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLF 197
           + ++Q   H+  + F+GDDTW  LF     + + P  S  V D   VDN V       + 
Sbjct: 174 NLIKQLYLHDKNVLFVGDDTWDALFNPFLSNNSAPFESLNVWDLDTVDNGVISFFNDHIH 233

Query: 198 QEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLIC 257
            +  +WDV + H LG+DH+GHK GP    M  K  +++  +  +   +     DDDTL+ 
Sbjct: 234 SK--EWDVLVGHMLGVDHVGHKYGPDHFTMKEKQTQVNEFIHYVMQSL-----DDDTLLV 286

Query: 258 VLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLD 317
           V+GDHGM+  GNHGG S  E  + L   S    +F    +  +    I    D    Y  
Sbjct: 287 VMGDHGMDRTGNHGGDSIDELESTLFLYSKTPGKF---GAMTDGNQSIYNISDYGSSY-R 342

Query: 318 SVQQIDIVPTIAALFGMPIPMNSVG 342
           SV QID+V T++ + G PIP N++G
Sbjct: 343 SVNQIDLVSTLSLMLGTPIPFNNLG 367

>KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4.28
           YLL031C
          Length = 1016

 Score =  164 bits (414), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 173/328 (52%), Gaps = 35/328 (10%)

Query: 50  ERPFQKLVFVVIDALRSDFLF--DSRISHFNN--------VHQWLNTGEAWGYTSF---- 95
           +  F K V +++DALR DF+   DS   H NN        ++     G + G +      
Sbjct: 76  DAKFDKAVILIVDALRFDFVIPVDST-EHLNNNYHNNIDILYDTFKNGNSHGSSILLKFL 134

Query: 96  ANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQH-NNTIRFMG 154
           A+PPT TL RLK +TTGS P+FID       + + N + E D+ ++Q  ++ N  I F+G
Sbjct: 135 ADPPTTTLQRLKGLTTGSLPTFID----AGSNFNGNVIFE-DNLIRQLSENLNREILFVG 189

Query: 155 DDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLD 214
           DDTW  LF     + + P  S  V D   VDN V       L ++   WDV I H LG+D
Sbjct: 190 DDTWDALFHPFLSNNSLPYESLNVWDLDTVDNGVIDFFDENL-KKNDDWDVLIGHMLGVD 248

Query: 215 HIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGNHGGSS 274
           H+GHK GP+   M  K  ++++ +K I D +     D++TL+ V+GDHGM+  GNHGG S
Sbjct: 249 HVGHKYGPNHFTMREKQLQVNTFIKKIIDSI-----DNNTLLVVMGDHGMDHTGNHGGDS 303

Query: 275 AGETSAGLLFLSPKLSQFVKPASQAENALPINGT-LDRDFQYLDSVQQIDIVPTIAALFG 333
             E  + L   + K + F K     ++  P N T L ++++   +V QID+V T++ L G
Sbjct: 304 IDELESTLFLYTKKKNIFRK----HDDFTPYNITDLGKNYR---AVNQIDLVSTLSYLLG 356

Query: 334 MPIPMNSVGIIIPDFLQLLPNKVASMKE 361
           +PIP N++G  I +      +K+   K 
Sbjct: 357 IPIPFNNLGWPIEEIFHSKNDKIKMTKR 384

>ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar to
           uniprot|Q07830 Saccharomyces cerevisiae YLL031C
          Length = 1009

 Score =  163 bits (413), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 163/328 (49%), Gaps = 39/328 (11%)

Query: 30  VLPGISQQAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLFDSRISH-------FNNVHQ 82
           VL  +S   P+Q           F K V +VIDALR DF+     SH        NN+  
Sbjct: 63  VLDNVSSPFPNQ--------YGKFDKAVVLVIDALRFDFVIPVDESHPQHNPNYHNNIKA 114

Query: 83  WLN----TGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDS 138
             N     G +  +   A+PPT TL RLK +TTGS P+FID       + D + + E D+
Sbjct: 115 LWNDESLKGSSLLFKFIADPPTTTLQRLKGLTTGSLPTFID----AGSNFDGSVI-EEDN 169

Query: 139 WLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQ 198
            ++Q       + F GDDTW  LF       ++P  S  V D   VDN V    +  L +
Sbjct: 170 LIKQLYLAQKNVYFAGDDTWSALFHPFLSAQSEPYPSLNVWDLDTVDNGVMSYFERHLLE 229

Query: 199 ----EWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDT 254
                   WDV + H LG+DH+GHK GP+   M  K  ++D  ++ I   +     D DT
Sbjct: 230 GGQTRHRDWDVLVGHMLGVDHVGHKYGPNHFTMREKQLQVDEFIRKIIAAI-----DKDT 284

Query: 255 LICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQ 314
           L+ V+GDHGM+  GNHGG S  E  +  LFL  K     +P ++  N   ++  L ++++
Sbjct: 285 LLIVMGDHGMDHTGNHGGDSIDELEST-LFLYSKRPDMWQP-NEDPNVYDVSD-LGKNYK 341

Query: 315 YLDSVQQIDIVPTIAALFGMPIPMNSVG 342
               V QID+VPT++ L  +PIP NS+G
Sbjct: 342 ---QVNQIDLVPTLSLLLNLPIPFNSLG 366

>Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  163 bits (412), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 118/324 (36%), Positives = 165/324 (50%), Gaps = 33/324 (10%)

Query: 34  ISQQAPDQDQDRDLQHERP--FQKLVFVVIDALRSDFLF-------DSRISHFNNVHQWL 84
           +S+   D    R+   + P  F K V +VIDALR DF         D   ++ NN+    
Sbjct: 59  LSRHVLDNISSRNETSDLPPRFNKAVVLVIDALRFDFAIPVNESDPDHNPNYHNNILSLY 118

Query: 85  NTGEAWGYTS------FANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDS 138
           ++      +S       A+PPT TL RLK +TTGS P+FID       + D   + E D+
Sbjct: 119 DSFTNDKNSSSLLLKFIADPPTTTLQRLKGLTTGSLPTFID----AGSNFDGT-IIEEDN 173

Query: 139 WLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQ 198
            L+QF   N T++F GDDTW  LF     + + P  S  V D   VDN V       L Q
Sbjct: 174 LLKQFFLANKTVKFAGDDTWTALFYPFLSNDSFPLESLNVWDLDTVDNGVMDYFHDHLQQ 233

Query: 199 EWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICV 258
           +  +WDV I H LG+DH+GHK GP    M  K  ++D  +  I + +     DDDTL+ +
Sbjct: 234 D-KEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDRFIDWILNSI-----DDDTLLVI 287

Query: 259 LGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDS 318
           LGDHGM+  GNHGG S  E  + L   S K   +     + ++A   N T D  + Y  S
Sbjct: 288 LGDHGMDHTGNHGGDSIDELESTLFLYSKKPEMW-----RLKDAFNYN-TSDSGYNY-RS 340

Query: 319 VQQIDIVPTIAALFGMPIPMNSVG 342
           V+QID+V +++ L   PIP N++G
Sbjct: 341 VRQIDLVSSLSLLLDQPIPFNNLG 364

>TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4.28
           YLL031C
          Length = 1005

 Score =  162 bits (409), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 110/322 (34%), Positives = 158/322 (49%), Gaps = 31/322 (9%)

Query: 34  ISQQAPDQDQDRDLQHERPFQKLVFVVIDALRSDFLFDSRISH-------FNNV-----H 81
           +++Q  D    +  ++ + F K V +++DALR DF+      H        NN+      
Sbjct: 59  LTRQVLDDVAIKTAEYGK-FDKAVVLIVDALRFDFVIPVDQDHQGYSGNFHNNIDVLYES 117

Query: 82  QWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQ 141
            + + G +      A+ PTVTL RLK +TTGS P+FID       + D + + E D+ ++
Sbjct: 118 MFADQGSSLLLKFIADAPTVTLQRLKGLTTGSLPTFID----AGSNFDGSVI-EEDNLIK 172

Query: 142 QFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWA 201
           Q  +    I F GDDTW  LF       +    SF V D   VDN V       L +   
Sbjct: 173 QMYEQGKQIYFAGDDTWESLFSPFLSPRSKYYESFNVWDLDTVDNGVISYFNEHLLETAN 232

Query: 202 Q-WDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLG 260
           + WDV I H LG+DH+GHK GP+   M  K  +++  L  I + +     DDDTL+ ++G
Sbjct: 233 RDWDVLIGHMLGVDHVGHKYGPNHFTMREKQLQVNDFLIKIKETI-----DDDTLLVIMG 287

Query: 261 DHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQ 320
           DHGM+  GNHGG S  E  + L   S       +P     N      T D    Y   V 
Sbjct: 288 DHGMDHTGNHGGDSKDELESTLFLYSK------RPNMWGLNDPSQYNTTDLG-AYYREVN 340

Query: 321 QIDIVPTIAALFGMPIPMNSVG 342
           QID+VPT++ L G+PIP N++G
Sbjct: 341 QIDLVPTLSILMGLPIPFNNLG 362

>AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL031C
           (GPI13)
          Length = 1013

 Score =  160 bits (405), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 115/324 (35%), Positives = 168/324 (51%), Gaps = 35/324 (10%)

Query: 34  ISQQAPDQDQDRDLQHERP--FQKLVFVVIDALRSDFLFDSRI------SHFNNVHQWLN 85
           +S++  D   +RD +   P  F +LV +V+DALR DF+    +      SH++N  + L 
Sbjct: 67  LSRKVLDDVANRD-ESTAPAKFDRLVLLVVDALRFDFVIPVDVAAEGYNSHYHNHLRALY 125

Query: 86  TGEAWGYTSF----ANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQ 141
             E W  +      A+PPT TL RLK +TTGS P+FID   N      +  + +    ++
Sbjct: 126 --ERWDESILLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSNF-----NGIVIDEGYIIK 178

Query: 142 QFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQ--- 198
           Q    N TI F GDDTW  LF     + + P  S  V D   VDN V    +  L     
Sbjct: 179 QMCLINKTIYFAGDDTWDALFHPYLSNVSMPYESLNVWDLDTVDNGVISFFEDHLLNNPT 238

Query: 199 EWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICV 258
           E  +WDV + H LG+DH+GHK GP    M+ K  ++D  ++ I D V     D+DTL+ V
Sbjct: 239 EKKEWDVLVGHMLGIDHVGHKYGPSHFSMAEKQSQVDGFIRQIIDAV-----DEDTLLVV 293

Query: 259 LGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDS 318
           +GDHGM+  GNHGG S  E  + L   + +   + + A  A N   +        +Y  +
Sbjct: 294 MGDHGMDHTGNHGGDSPAELESTLWLYTKRPGTWRRQAPAAYNTTELG-------RYYRA 346

Query: 319 VQQIDIVPTIAALFGMPIPMNSVG 342
           V QID+VP+++ L G+PIP N++G
Sbjct: 347 VNQIDLVPSLSLLLGLPIPFNNLG 370

>NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON}
           Anc_4.28
          Length = 1011

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 108/317 (34%), Positives = 157/317 (49%), Gaps = 40/317 (12%)

Query: 45  RDLQHERPFQKLVFVVIDALRSDFLF-------DSRISHFNNVHQWLNTGEAWGYTS--- 94
           + +++   F K V +V+DALR DF+        D    + NN+       E    +S   
Sbjct: 74  QSIENYGKFNKSVILVVDALRFDFVIPVNQSNPDYNDYYHNNLKVLYEKFEDQSSSSSLL 133

Query: 95  ---FANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIR 151
               A+PPT TL RLK +TTGS P+FID       + D + + E D+ ++Q   ++  + 
Sbjct: 134 LKFMADPPTTTLQRLKGLTTGSLPTFID----AGSNFDGSVI-EEDNIIKQMFLNDKQVL 188

Query: 152 FMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEW--AQWDVAILH 209
           F+GDDTW  LF       + P  S  V D   VDN V       L +      W+V I H
Sbjct: 189 FVGDDTWDALFNPFLSPMSQPFESLNVWDLDTVDNGVISFFNDHLLENTNDQSWNVLIGH 248

Query: 210 YLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGN 269
            LG+DH+GHK GP+   M  K  ++D  ++ I D +     DDDTL+ ++GDHGM+  GN
Sbjct: 249 MLGMDHVGHKFGPNHFTMKQKQLQIDKFIREIMDSI-----DDDTLLVIMGDHGMDHTGN 303

Query: 270 HGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQ----YLDSVQQIDIV 325
           HGG S  E  + L   S +            NA  +  T + D +       SV QID+V
Sbjct: 304 HGGDSKDELESTLFLYSKR-----------NNAWNLQDTSNYDTRNQGDRYRSVNQIDLV 352

Query: 326 PTIAALFGMPIPMNSVG 342
            T++ L G+PIP N++G
Sbjct: 353 STLSFLLGLPIPFNNLG 369

>Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON}
           YLL031C (REAL)
          Length = 1016

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 116/305 (38%), Positives = 157/305 (51%), Gaps = 35/305 (11%)

Query: 53  FQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFAN--------------P 98
           F K V +V+DALR DF+     S  N+   + N   +  Y SFAN              P
Sbjct: 79  FNKAVVLVVDALRFDFVIPVNESSSNHNLNYHNNILSL-YDSFANDEDASSLLLKFIADP 137

Query: 99  PTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTW 158
           PT TL RLK +TTGS P+FID       + D   + E D+ L+Q    N T++F GDDTW
Sbjct: 138 PTTTLQRLKGLTTGSLPTFID----AGSNFDGTVI-EEDNLLKQLHLVNKTVKFAGDDTW 192

Query: 159 LKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGH 218
           + LF     + + P  S  V D   VDN V       L Q+  +WDV I H LG+DH+GH
Sbjct: 193 MALFHPFLSNDSFPLESLNVWDLDTVDNGVMDYFHDHLQQD-KEWDVMIGHMLGIDHVGH 251

Query: 219 KDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGNHGGSSAGET 278
           K GP+   M  K  ++D  +  I   +     DDDTL+ +LGDHGM+  GNHGG S  E 
Sbjct: 252 KYGPNHFTMKEKQFQVDQFIAWILKSI-----DDDTLLVILGDHGMDHTGNHGGDSIDEL 306

Query: 279 SAGLLFLSPKLSQF-VKPASQAENALPINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIP 337
            + L   S K + +  K AS           L  D++   SV+QID+V +++ L G PIP
Sbjct: 307 ESTLFLYSKKPNMWNFKDASNYNIT-----NLGCDYR---SVRQIDLVSSLSLLLGQPIP 358

Query: 338 MNSVG 342
            N++G
Sbjct: 359 FNNLG 363

>Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  158 bits (400), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 116/309 (37%), Positives = 161/309 (52%), Gaps = 36/309 (11%)

Query: 49  HERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFAN----------- 97
           H R F K V +VIDALR DF+     S  N+   + N   +  Y SFAN           
Sbjct: 77  HPR-FNKTVVLVIDALRFDFVIPVDESGSNHNLNYHNNILSL-YDSFANDKDASSLLLKF 134

Query: 98  ---PPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMG 154
              PPT TL RLK +TTGS P+FID       + D   + E D+ L+Q    N T++F G
Sbjct: 135 IADPPTTTLQRLKGLTTGSLPTFID----AGSNFDGTVIEE-DNLLKQLHLANKTVKFAG 189

Query: 155 DDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQWDVAILHYLGLD 214
           DDTW+ LF     + + P  S  V D   VD  V       L Q+  +WDV I H LG+D
Sbjct: 190 DDTWMALFHPFLSNDSFPLESLNVWDLDSVDKGVMDYFHDHLQQD-QEWDVMIGHMLGID 248

Query: 215 HIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGNHGGSS 274
           H+GHK GP    M  K  ++D  +  I   +     D++TL+ +LGDHGM+  GNHGG S
Sbjct: 249 HVGHKYGPDHFTMREKQVQVDEFINWILKSI-----DENTLLVILGDHGMDHTGNHGGDS 303

Query: 275 AGETSAGLLFLSPKLSQF-VKPASQAENALPINGTLDRDFQYLDSVQQIDIVPTIAALFG 333
             E  + L   S K + + +K +S  + +      L RD++   SV+QID+V +++ L G
Sbjct: 304 IDELESTLFLYSKKPNLWKLKDSSNYDIS-----ALGRDYR---SVRQIDLVSSLSLLLG 355

Query: 334 MPIPMNSVG 342
            PIP N++G
Sbjct: 356 QPIPFNNLG 364

>TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4.28
           YLL031C
          Length = 1028

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 157/321 (48%), Gaps = 49/321 (15%)

Query: 51  RPFQKLVFVVIDALRSDFLF----------DSRISHFNNVHQWLNTGE------------ 88
           + F K V +++DALR DF+           ++  ++ + + + LN  +            
Sbjct: 85  KKFDKAVVLLVDALRFDFVVPINELDPIYNENYHNNIDIISELLNQNDNSTKNESKKDRV 144

Query: 89  ----AWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFI 144
               +  +   A PPT T  RLK ITTG  PSF+D ++ +   V      E DS ++Q  
Sbjct: 145 QKSSSLLFKFLAEPPTTTFHRLKGITTGLLPSFLDGIMKLNDRV-----VEDDSIIKQLF 199

Query: 145 QHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWA--- 201
             N TI F GDDTW ++F       + P  S+ + D   VD+ V +     L  +     
Sbjct: 200 LRNKTIYFSGDDTWSRMFEPYLSPKSVPLESYNIWDLNTVDDGVFKFFNEHLTSKNTSNR 259

Query: 202 QWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGD 261
           +WD+ I H +G+DH   K GP+   +  K  +++  +K I   +     DD TL+ V+GD
Sbjct: 260 EWDILIGHIVGIDHAATKYGPNHITVKQKQIQINEFIKQIVKSL-----DDQTLLIVMGD 314

Query: 262 HGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQ 321
           HGM+  GNHGG S+GE  + L   S K S + +  S  EN        + DF     + Q
Sbjct: 315 HGMDITGNHGGKSSGELESSLFLYSKKSSVWKQEHSLHEN--------NNDFY--KKINQ 364

Query: 322 IDIVPTIAALFGMPIPMNSVG 342
           IDIVPT + LFG+PIP N++G
Sbjct: 365 IDIVPTFSLLFGIPIPYNNLG 385

>TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]
           {ON} Anc_4.28 YLL031C
          Length = 1065

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 129/424 (30%), Positives = 199/424 (46%), Gaps = 65/424 (15%)

Query: 38  APDQDQDRDLQHERPFQKLVFVVIDALRSDFL-------FDSRISHFNNVHQWLNTGEAW 90
           + D + +  L  +  F K V +++DALR +F+        D   ++ NN+    +T +  
Sbjct: 87  STDNNPNSILNDKPQFDKTVILIVDALRFNFVIPVDVDSMDYNPNYHNNIDVLYDTFKNS 146

Query: 91  GYTS------FANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFI 144
             +S       A+PPT T+ RLK +TTG+ P+FID   N    V   D      +L +F 
Sbjct: 147 QDSSSVLLKFIADPPTTTMQRLKGLTTGTLPTFIDAGSNFDGSVILEDNLIKQLYLNKFW 206

Query: 145 QHNNTIRFMGDDTWLKLF-PHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQ- 202
              N I F+GDDTW  LF P+    F+ P  S  V D   VDN V       L  + ++ 
Sbjct: 207 ---NDIYFVGDDTWDALFKPYLNQQFSRPFDSLNVWDLDTVDNGVISYFHEYLIDQSSKD 263

Query: 203 ---WDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVL 259
              +   I H LG+DH+GHK GP+   M  K  +++  LK I + +     DD+TL+ V+
Sbjct: 264 QMTYKTLIGHMLGVDHVGHKYGPNHFTMKEKQLQINQFLKEIINSI-----DDNTLLVVM 318

Query: 260 GDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQY---- 315
           GDHGM+  GNHGG S  E  + L   + K + F               TLD+D++     
Sbjct: 319 GDHGMDHTGNHGGDSVDELESTLFMYAKKKNSF---------------TLDKDYETSYNI 363

Query: 316 ------LDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDF------LQLLPNKVASMKENF 363
                    V QID+VPT++ L  + IP NS+G  I +       L++  N        F
Sbjct: 364 SNFGESYKQVNQIDLVPTLSLLLDLQIPFNSLGWPIDEIAQNSQQLEMFQNITVQQLHTF 423

Query: 364 MHLWRL--SDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNY--NYPLLSLAFA-SFLI 418
                L  SD +  ++LD+L   ++Y   HD Q  L +   +    +  +S+A   +FL 
Sbjct: 424 KETSNLLTSDDERNLLLDELFEKNLY---HDYQIQLLEVCKDLWARFDYISIAIGITFLF 480

Query: 419 ITII 422
           I+++
Sbjct: 481 ISLV 484

>KLLA0B07249g Chr2 complement(630336..633095) [2760 bp, 919 aa] {ON}
           highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 919

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 86/345 (24%), Positives = 140/345 (40%), Gaps = 51/345 (14%)

Query: 41  QDQDRDLQHERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPT 100
           Q Q  D   E P ++L  +V D LR+D  FD  +      H +L     +      N  T
Sbjct: 39  QHQSTD---EAPAKRLFLIVGDGLRADTTFDKILHPVTGEHDYL---APYIRDLVRNEAT 92

Query: 101 VTLPRLKSITTGSTPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQHNNTIRFMG 154
             +   + + T S P  + ++    +DV +       +  + DS+   F Q  +T  F  
Sbjct: 93  YGVSHTR-MPTESRPGHVAMIAGFYEDVSAVTKGWQENPVDFDSF---FNQSKHTYSFGS 148

Query: 155 DD---------------TWLKLFPHEWFDFTDPT---HSFFVSDFTQVDNNVTRN--LQG 194
            D                W+  + HE+ DFT  +    +F      ++ NN   N  L+ 
Sbjct: 149 PDILPMFKDGATPNKVDAWM--YGHEFEDFTQSSIELDAFVFRHIYELFNNTKSNKTLET 206

Query: 195 KLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDT 254
           ++ Q+    +V  LH LG D  GH   P+S       + +D  +K + ++V E   D+DT
Sbjct: 207 EIKQDG---NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKEVKLLVEKVHEFFDDEDT 263

Query: 255 LICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQ 314
                 DHGM+  G+HG      T   L+     +++ VK      N  PI      ++ 
Sbjct: 264 AFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGINKPVK------NQAPIFDNYTENWN 317

Query: 315 YLD----SVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNK 355
             D     V Q DI   ++ L G   P+NSVG +  +F+    +K
Sbjct: 318 LADIKRNDVNQADIASLMSYLIGANYPVNSVGELPLNFIDAPEDK 362

>NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {ON}
           Anc_1.184 YKL165C
          Length = 925

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 85/330 (25%), Positives = 130/330 (39%), Gaps = 65/330 (19%)

Query: 52  PFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKS--- 108
           P ++L  +V D LR+D  FD            L T    G T F  P   +L +  +   
Sbjct: 46  PAKRLFLIVGDGLRADTTFD------------LITHPTTGKTEFLAPFIRSLVKTNATYG 93

Query: 109 -----ITTGSTPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQHNNTIRFMGDD- 156
                + T S P  + ++    +DV +       +  + DS+   F Q  +T  F   D 
Sbjct: 94  ISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSF---FNQSTHTYSFGSPDI 150

Query: 157 ---------------TWLKLFPHEWFDFTDPTHSFFVSDFTQVDN---NVTRN--LQGKL 196
                           W+  + HE+ DFT  +       F  +D+   N T N  L  ++
Sbjct: 151 LPMFKDGASDPNKVDAWM--YGHEYEDFTQSSIELDAYVFRHLDSLFKNSTSNVTLDHEI 208

Query: 197 FQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLI 256
            QE    +V  LH LG D  GH   P+S       + +D  +  + D+V +   D+DT  
Sbjct: 209 RQEG---NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSLLVDKVHDFFGDEDTAF 265

Query: 257 CVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYL 316
               DHGM+  G+HG      T   L+     L++ VK      N +PI       +   
Sbjct: 266 IFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVK------NEVPIYDNYTESWGLA 319

Query: 317 D----SVQQIDIVPTIAALFGMPIPMNSVG 342
           D     ++Q DI P ++ L G   P NSVG
Sbjct: 320 DIKRNDIKQADITPLMSYLIGANYPANSVG 349

>AEL113C Chr5 complement(409096..411873) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL165C
           (MCD4)
          Length = 925

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 88/332 (26%), Positives = 133/332 (40%), Gaps = 61/332 (18%)

Query: 48  QHERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLK 107
             E P ++L  +V D LR+D  FD ++ H              G T F  P   +L    
Sbjct: 43  NEEPPAKRLFLIVGDGLRADTSFD-KVKH-----------PVTGKTEFLAPYLRSLVEHN 90

Query: 108 S--------ITTGSTPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQHNNTIRFM 153
           +        + T S P  + ++    +DV +       +  + DS    F Q  +T  F 
Sbjct: 91  ATYGISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDS---VFNQSTHTYSFG 147

Query: 154 GDD----------------TWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRN--LQGK 195
             D                 W+  + HE+ DFT  +       F  +D  + RN  +  K
Sbjct: 148 SPDILPMFKSGASDPTKVDAWM--YGHEFEDFTQSSIELDAYVFRHMDA-LFRNATVDSK 204

Query: 196 LFQEWAQ-WDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDT 254
           L  E  Q  +V  LH LG D  GH   P+S       + +DS L+ +  +V E   DDDT
Sbjct: 205 LRHEMMQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDSQLERLVPKVREFFGDDDT 264

Query: 255 LICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPI--NGTLDRD 312
                 DHGM+  G+HG      T   L+     L++ V       N +P+  N T + D
Sbjct: 265 AFVFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNRPVL------NDVPVYDNYTENWD 318

Query: 313 FQYL--DSVQQIDIVPTIAALFGMPIPMNSVG 342
             ++  + V Q DI   ++ L G+  P NSVG
Sbjct: 319 LAHVRRNDVNQADIASLMSYLIGLNYPTNSVG 350

>Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AEL113C
          Length = 926

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 131/331 (39%), Gaps = 61/331 (18%)

Query: 49  HERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSF-----ANPPTVTL 103
            + P ++L  +V D LR+D  FD +I+       + + GEA     F      N  T  +
Sbjct: 44  EQPPAKRLFLIVGDGLRADTTFD-KIT-------YPSAGEAEFLAPFIRSLVMNNATYGI 95

Query: 104 PRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQ-------FIQHNNTIRFMGDD 156
              + + T S P  + ++    +DV +        W +        F Q  +T  F   D
Sbjct: 96  SHTR-MPTESRPGHVSMIAGFYEDVSAVT----KGWKENPVNFDSVFNQSAHTYSFGSPD 150

Query: 157 ----------------TWLKLFPHEWFDFTDPTHSFFVSDFTQVD-----NNVTRNLQGK 195
                            W+  + HE+ DFT  +       F  +D     + V   L  +
Sbjct: 151 ILPMFKDGASDPNKVSAWM--YGHEFEDFTQSSIELDAYVFRHLDQLFRNSTVNATLNEE 208

Query: 196 LFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTL 255
           +FQ+    +V  LH LG D  GH   P+S       + +D  +  + D+V +   DDDT 
Sbjct: 209 IFQDG---NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKQISLLVDKVRDFFGDDDTA 265

Query: 256 ICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQY 315
                DHGM+  G+HG      T   L+     L++ V+      N  PI+    ++++ 
Sbjct: 266 FLFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVR------NKHPIHDNYTKNWEL 319

Query: 316 LD----SVQQIDIVPTIAALFGMPIPMNSVG 342
            D     V Q DI   ++ L G   P NSVG
Sbjct: 320 SDIKRNDVNQADIASLMSYLIGANYPANSVG 350

>Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {ON}
           YKL165C (MCD4) - (putative) involved in cell polarity
           [contig 108] FULL
          Length = 922

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 85/193 (44%), Gaps = 14/193 (7%)

Query: 156 DTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNV-TRNLQGKLFQEWAQ-WDVAILHYLGL 213
           D W+  + HE+ DFT  +       F  +DN   T      L QE  Q  +V  LH LG 
Sbjct: 166 DAWM--YGHEFEDFTQSSIELDAFVFRHLDNLFNTSTTNETLRQEITQSGNVFFLHLLGC 223

Query: 214 DHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGNHGGS 273
           D  GH   P+S       + +D  L  +  +V ++  DDDT      DHGM+  G+HG  
Sbjct: 224 DTAGHSYRPYSAEYYDNVKYIDQELSKLVVKVRDYFGDDDTAFIFTADHGMSAFGSHGDG 283

Query: 274 SAGETSAGLLFLSPKLSQFVKPASQAENALPI--NGTLDRDFQYL--DSVQQIDIVPTIA 329
               T   L+     L++ VK      N +PI  N T   D   +  + V+Q DI   ++
Sbjct: 284 HPNNTRTPLVAWGAGLNKPVK------NPVPIYDNYTEGWDLATIQRNDVKQADIASLMS 337

Query: 330 ALFGMPIPMNSVG 342
            L G   P NSVG
Sbjct: 338 YLIGANYPANSVG 350

>Kpol_2001.28 s2001 (81621..83408,83411..84382) [2760 bp, 919 aa]
           {ON} (81621..83408,83411..84382) [2760 nt, 920 aa]
          Length = 919

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 81/327 (24%), Positives = 130/327 (39%), Gaps = 59/327 (18%)

Query: 52  PFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLP------- 104
           P ++L  VV D LR+D  FD +I+H              G T +  P   +L        
Sbjct: 47  PAKRLFLVVGDGLRADTTFD-KITH-----------PVTGKTEYLAPFIRSLVLNNGTYG 94

Query: 105 -RLKSITTGSTPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQ-----HNNTIRF 152
                + T S P  + ++    +DV +       +  + DS+  Q +        + +  
Sbjct: 95  ISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSVHTYSFGSPDILPM 154

Query: 153 MGD--------DTWLKLFPHEWFDFTDPTHSFFVSDFTQVD----NNVTRN-LQGKLFQE 199
             D        D W+  + HE+ DFT  +       F  +D    N+ T N L  ++ Q+
Sbjct: 155 FKDGASDPSRVDAWM--YGHEFEDFTQSSIELDAFVFNHLDTLFKNSTTNNTLNAEIRQD 212

Query: 200 WAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVL 259
               +V  LH LG D  GH   P+S       + +D+ +  + D+V E   DD+T     
Sbjct: 213 G---NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDNQVSVLVDKVREFFGDDETAFVFT 269

Query: 260 GDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLD-- 317
            DHGM+  G+HG      T   L+     +++ V+      N  PI       +   D  
Sbjct: 270 ADHGMSAFGSHGDGHPNNTRTPLVAWGAGVNKPVR------NEYPIYDNYTEGWNLADIK 323

Query: 318 --SVQQIDIVPTIAALFGMPIPMNSVG 342
              V+Q DI   ++ L G+  P NSVG
Sbjct: 324 RNDVKQADIASLMSYLIGVNYPSNSVG 350

>NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON}
           Anc_1.184 YKL165C
          Length = 924

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 84/331 (25%), Positives = 128/331 (38%), Gaps = 67/331 (20%)

Query: 52  PFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITT 111
           P ++L  +V D LR+D  FD            + T    G T F  P   +L  L + T 
Sbjct: 47  PAKRLFLIVGDGLRADTTFD------------MITHPVTGKTEFLAPYIRSLV-LNNATY 93

Query: 112 G---------STPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQHNNTIRFMGD- 155
           G         S P  + ++    +DV +       +  + DS+   F Q ++T  F    
Sbjct: 94  GISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSF---FNQSSHTYSFGSPD 150

Query: 156 ---------------DTWLKLFPHEWFDFTDPTHSFFVSDFTQVD-----NNVTRNLQGK 195
                          D W  ++ HE+ DFT  +       F  +D     + +   L  +
Sbjct: 151 ILPMFKEGATDPHKVDAW--MYGHEYEDFTQSSIELDAYVFRHLDSLFHNSTLDSTLDHE 208

Query: 196 LFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTL 255
           + QE    +V  LH LG D  GH   P+S       + +D  +  + D+V     DDDT 
Sbjct: 209 IRQE---GNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSILVDKVHTFFGDDDTA 265

Query: 256 ICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQY 315
                DHGM+  G+HG      T   L+     L++ VK      N +PI       ++ 
Sbjct: 266 FIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVK------NEVPIYDNYTESWKL 319

Query: 316 LD----SVQQIDIVPTIAALFGMPIPMNSVG 342
            D     V+Q DI   ++ L G   P NSVG
Sbjct: 320 ADIKRNDVKQADITSLMSYLIGTNYPANSVG 350

>KLTH0F04884g Chr6 complement(431251..434019) [2769 bp, 922 aa] {ON}
           highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 922

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 85/327 (25%), Positives = 128/327 (39%), Gaps = 59/327 (18%)

Query: 52  PFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSF-----ANPPTVTLPRL 106
           P ++L  +V D LR+D  FD +I+H         TGE      F      N  T  +   
Sbjct: 47  PAKRLFLIVGDGLRADTTFD-KITH-------PTTGETAHLAPFLRSLVLNNATYGVSHT 98

Query: 107 KSITTGSTPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQHNNTIRFMGD----- 155
           + + T S P  + ++    +DV +       +  + DS+   F Q  +T  F        
Sbjct: 99  R-MPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSF---FNQSAHTYSFGSPDILPM 154

Query: 156 -----------DTWLKLFPHEWFDFTDPTHSFFVSDFTQVDN-----NVTRNLQGKLFQE 199
                      D W  ++ HE+ DFT  +       F  +DN      + R L  ++ Q 
Sbjct: 155 FKDGASDPNKVDAW--MYGHEFEDFTQSSIELDAYVFRHLDNLFYNSTMDRELHEQIMQP 212

Query: 200 WAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVL 259
               +V  LH LG D  GH   P+S       + +D  +  +  +V +   DDDT     
Sbjct: 213 ---GNVFFLHLLGCDTAGHSYRPYSPEYYDNVKYIDDEVSKLVPKVRDFFGDDDTAFVFT 269

Query: 260 GDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPI--NGTLDRDFQYL- 316
            DHGM+  G+HG      T   L+     L++ V       N  PI  N T   D   + 
Sbjct: 270 ADHGMSAFGSHGDGHPNNTRTPLIAWGAGLNRPVL------NKAPIYDNYTEGWDLANIQ 323

Query: 317 -DSVQQIDIVPTIAALFGMPIPMNSVG 342
            + V+Q DI   +  L G   P NSVG
Sbjct: 324 RNDVKQADIASLMTYLIGADYPANSVG 350

>SAKL0C05434g Chr3 complement(516536..519643) [3108 bp, 1035 aa]
           {ON} similar to uniprot|P36051 Saccharomyces cerevisiae
           YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 1035

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 132/337 (39%), Gaps = 62/337 (18%)

Query: 46  DLQHER-----PFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPT 100
           ++QH R     P ++L  +V D LR+D  FD +I+H              G T++  P  
Sbjct: 147 NMQHFRSTETPPAKRLFLIVGDGLRADTTFD-KITH-----------PVSGETTYLAPFI 194

Query: 101 VTLPRLKS--------ITTGSTPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQH 146
            +L +  +        + T S P  + ++    +DV +       +  + DS+   F Q 
Sbjct: 195 RSLVKNNATYGISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWQENPVDFDSF---FNQS 251

Query: 147 NNTIRFMGDD----------------TWLKLFPHEWFDFTDPTHSFFVSDFTQVD----- 185
            +T  F   D                 W+  + HE+ DFT  +       F  +D     
Sbjct: 252 AHTYSFGSPDILPMFKEGASDPHRVDAWM--YGHEFEDFTQSSIELDAYVFRHLDQLFHN 309

Query: 186 NNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQV 245
           + V   L+ ++ Q     +V  LH LG D  GH   P+S       + +D  +  + ++V
Sbjct: 310 STVDTALREEIMQ---HGNVFFLHLLGCDTAGHSYRPYSAEYYDNVRYIDEQVAVLVEKV 366

Query: 246 LEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPI 305
            +   DDDT      DHGM+  G+HG      T   L+     L+  V+  ++       
Sbjct: 367 RDFFGDDDTAFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNTPVR--NEKPEYDNY 424

Query: 306 NGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVG 342
             T D      + V Q DI   +A L G   P NSVG
Sbjct: 425 TATWDLAEVRRNDVNQADIASLMAYLIGTNYPANSVG 461

>KNAG0C01080 Chr3 complement(209716..212511) [2796 bp, 931 aa] {ON}
           Anc_1.184 YKL165C
          Length = 931

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 79/325 (24%), Positives = 130/325 (40%), Gaps = 49/325 (15%)

Query: 49  HERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKS 108
            + P ++L  +V D LR+D  FD          ++L     +  +   N  T  +   + 
Sbjct: 44  EQPPAKRLFLIVGDGLRADTTFDMITHPVTGKTEYL---APYIRSLVENNATYGISHTR- 99

Query: 109 ITTGSTPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQHNNTIRFMGD------- 155
           + T S P  + ++    +DV +       +  + DS+   F Q  +T  F          
Sbjct: 100 MPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSF---FNQSTHTYSFGSPDILPMFK 156

Query: 156 ---------DTWLKLFPHEWFDFTDPTHSFFVSDFTQVD-----NNVTRNLQGKLFQEWA 201
                    D W  ++ HE+ DFT  +       F  +D     + V R L  ++ Q   
Sbjct: 157 DGASDHNKVDAW--MYGHEFEDFTQSSIELDAYVFNHMDQLFYNSTVNRTLDNEIRQ--- 211

Query: 202 QWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGD 261
             +V  LH LG D  GH   P+S       + +D  ++ + D+V     DDDT      D
Sbjct: 212 NGNVFFLHLLGCDTAGHSYRPYSPEYYDNVKYIDREVEKLMDKVHNFFDDDDTAFIFTAD 271

Query: 262 HGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPI--NGTLDRDFQYL--D 317
           HGM+  G+HG      T   L+     L++         N +PI  N T   +  ++  +
Sbjct: 272 HGMSAFGSHGDGHPNNTRTPLVAWGAGLNR------PKLNDVPIYDNYTKPWNLSHIQRN 325

Query: 318 SVQQIDIVPTIAALFGMPIPMNSVG 342
            V+Q DI   ++ L G   P+NSVG
Sbjct: 326 DVKQADIASLMSYLIGANYPVNSVG 350

>TBLA0C05840 Chr3 complement(1411740..1414583) [2844 bp, 947 aa]
           {ON} Anc_1.184 YKL165C
          Length = 947

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 80/341 (23%), Positives = 130/341 (38%), Gaps = 69/341 (20%)

Query: 43  QDRDLQHERPFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANP--PT 100
           Q     +E P ++L  +V D LR+D  FD +I+H              G T +  P   +
Sbjct: 38  QQHKSTNEPPAKRLFLIVGDGLRADTTFD-KINH-----------PITGETDYLAPFLRS 85

Query: 101 VTLPR------LKSITTGSTPSFIDLLLNVAQDVD--SNDLSEHDSWLQQFIQHNNTIRF 152
           + L           + T S P  + ++    +DV   +    E+      F   +     
Sbjct: 86  IVLEEGTYGISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKENPVNFDSFFNQSKHTYS 145

Query: 153 MGD-----------------DTWLKLFPHEWFDFTDPTHSFFVSDFTQVD-----NNVTR 190
            G                  DTW+  + HE+ DFT  +       F  ++     + V  
Sbjct: 146 FGSPDILPMFKDGASDINRIDTWM--YGHEFEDFTQSSIELDAYVFRHMNELFFNSTVNE 203

Query: 191 NLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHES 250
            L  ++ Q+    +V  LH LG D  GH   P+S       + +D ++  + D V    +
Sbjct: 204 TLNYEIRQDG---NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKMVSKLVDDVTTFFN 260

Query: 251 DDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPIN---- 306
           D+DT      DHGM+  G+HG      T   L+     +++ VK      N +PI     
Sbjct: 261 DNDTAFIFTADHGMSAFGSHGDGHPNNTRTPLIAWGAGINKPVK------NEVPIFDNYT 314

Query: 307 -----GTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVG 342
                G++ R     + V+Q DI   ++ L G   P NSVG
Sbjct: 315 EGWNLGSIKR-----NDVKQADIASLMSYLIGANYPANSVG 350

>TDEL0C03690 Chr3 (648638..651400) [2763 bp, 920 aa] {ON} Anc_1.184
           YKL165C
          Length = 920

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 85/329 (25%), Positives = 127/329 (38%), Gaps = 63/329 (19%)

Query: 52  PFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITT 111
           P ++L  +V D LR+D  FD            L T    G T +  P   +L  L + T 
Sbjct: 47  PAKRLFLIVGDGLRADTTFD------------LITHPTSGKTEYLAPYIRSLV-LNNATY 93

Query: 112 G---------STPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQHNNTIRFMGDD 156
           G         S P  + ++    +DV +       +  + DS+   F Q  +T  F   D
Sbjct: 94  GISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSF---FNQSAHTYSFGSPD 150

Query: 157 ----------------TWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEW 200
                           TW   + HE+ DFT  +       F  +D+    + +     + 
Sbjct: 151 ILPMFKEGASDPSRVDTWT--YGHEFEDFTQSSIELDAYVFRHLDDLFHNSTRDSTLNDE 208

Query: 201 AQWD--VAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICV 258
            + D  V  LH LG D  GH   P+S       + +D  +  + D+V     DDDT    
Sbjct: 209 IRGDGNVVFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQVSMLSDKVRSFFGDDDTAFIF 268

Query: 259 LGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPI--NGTLD---RDF 313
             DHGM+  G+HG      T   L+     L++ +K      N  P+  N T      D 
Sbjct: 269 TADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPLK------NDYPVFDNYTFTWGLEDV 322

Query: 314 QYLDSVQQIDIVPTIAALFGMPIPMNSVG 342
           Q  D V+Q DI   ++ L G+  P NSVG
Sbjct: 323 QRHD-VKQADIASLMSYLIGVNYPANSVG 350

>ZYRO0G18458g Chr7 (1522413..1525178) [2766 bp, 921 aa] {ON} highly
           similar to uniprot|P36051 Saccharomyces cerevisiae
           YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 921

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 89/203 (43%), Gaps = 20/203 (9%)

Query: 156 DTWLKLFPHEWFDFTDPTHSFFVSDFTQVDN-----NVTRNLQGKLFQEWAQWDVAILHY 210
           D W+  + HE+ DFT  +       F  +D+      +   L  ++  +    +V  LH 
Sbjct: 166 DAWM--YGHEFEDFTQSSIEMDAFVFKHLDDLFHNSTINNTLNNEIRHDG---NVFFLHL 220

Query: 211 LGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNELGNH 270
           LG D  GH   P+S       + +D  ++T+ +QV +   DD+T      DHGM+  G+H
Sbjct: 221 LGCDTAGHSYRPYSAEYYDNVKYIDGKVETLVEQVRDFFGDDETAFVFTADHGMSAFGSH 280

Query: 271 GGSSAGETSAGLLFLSPKLSQFVKPASQAENALPI--NGTLDRDFQYLDS--VQQIDIVP 326
           G      T   L+     L+   KP     N  P+  N T   D  ++    V+Q DI  
Sbjct: 281 GDGHPNNTRTPLVAWGAGLN---KP---VHNLKPVYDNYTQGWDLSHIKRHDVKQADIAS 334

Query: 327 TIAALFGMPIPMNSVGIIIPDFL 349
            ++ L G   P NSVG +  D++
Sbjct: 335 LMSYLIGANYPANSVGELPLDYI 357

>YKL165C Chr11 complement(137932..140691) [2760 bp, 919 aa] {ON}
           MCD4Protein involved in glycosylphosphatidylinositol
           (GPI) anchor synthesis; multimembrane-spanning protein
           that localizes to the endoplasmic reticulum; highly
           conserved among eukaryotes
          Length = 919

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 81/330 (24%), Positives = 133/330 (40%), Gaps = 65/330 (19%)

Query: 52  PFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKS--- 108
           P ++L  +V D LR+D  FD +++H              G T F  P   +L    +   
Sbjct: 47  PAKRLFLIVGDGLRADTTFD-KVTH-----------PVSGKTEFLAPFIRSLVMNNATYG 94

Query: 109 -----ITTGSTPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQHNNTIRFMGDD- 156
                + T S P  + ++    +DV +      ++    DS+   F Q  +T  F   D 
Sbjct: 95  ISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKSNPVNFDSF---FNQSTHTYSFGSPDI 151

Query: 157 ---------------TWLKLFPHEWFDFTDPT---HSFFVSDFTQVDNNVTRN--LQGKL 196
                          TW+  + H + DFT  +    +F      Q+ +N T N  L  ++
Sbjct: 152 LPMFKDGASDPNKVDTWM--YDHTFEDFTQSSIELDAFVFRHLDQLFHNSTLNSTLDYEI 209

Query: 197 FQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLI 256
            Q+    +V  LH LG D  GH   P+S       + +D  +  + D+V +  +DD T  
Sbjct: 210 RQDG---NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKTAF 266

Query: 257 CVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQY- 315
               DHGM+  G+HG      T   L+     L+   KP     N  P++     +++  
Sbjct: 267 IFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLN---KP---VHNPFPVSDNYTENWELS 320

Query: 316 ---LDSVQQIDIVPTIAALFGMPIPMNSVG 342
               + V+Q DI   ++ L G+  P NSVG
Sbjct: 321 SIKRNDVKQADIASLMSYLIGVNYPKNSVG 350

>KAFR0G00500 Chr7 complement(134741..137509) [2769 bp, 922 aa] {ON}
           Anc_1.184 YKL165C
          Length = 922

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 87/201 (43%), Gaps = 30/201 (14%)

Query: 156 DTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKL----------FQEWAQWDV 205
           D W+  + HE+ DFT  +         ++D  V RNL              F+   + +V
Sbjct: 166 DAWM--YGHEFEDFTQSS--------IELDAYVFRNLDELFYNSTIDATLDFEIKQEGNV 215

Query: 206 AILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMN 265
             LH LG D  GH   P+S       + +D  L  +  +V +  +DDDT      DHGM+
Sbjct: 216 FFLHLLGCDTAGHSYRPYSAEYYDNIKYIDEQLSILIPKVHDFFNDDDTAFIFTADHGMS 275

Query: 266 ELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPI--NGTLDRDFQYL--DSVQQ 321
             G+HG      T   L+     L+   KP     N +PI  N T   +  ++  + V+Q
Sbjct: 276 AFGSHGDGHPNNTRTPLVAWGAGLN---KPQI---NKVPIYDNYTESWNLSHIKRNDVKQ 329

Query: 322 IDIVPTIAALFGMPIPMNSVG 342
            DI   ++ L G   P+NSVG
Sbjct: 330 ADIASLMSYLIGTNYPVNSVG 350

>Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {ON}
           YKL165C (REAL)
          Length = 945

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 79/330 (23%), Positives = 134/330 (40%), Gaps = 65/330 (19%)

Query: 52  PFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKS--- 108
           P ++L  +V D LR+D  FD +++H              G T F  P   +L    +   
Sbjct: 73  PAKRLFLIVGDGLRADTTFD-KVTH-----------PVTGKTEFLAPYIRSLVMNNATYG 120

Query: 109 -----ITTGSTPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQHNNTIRFMGD-- 155
                + T S P  + ++    +DV +      ++    DS+   F Q  +T  F     
Sbjct: 121 ISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKSNPVNFDSF---FNQSTHTYSFGSPDI 177

Query: 156 --------------DTWLKLFPHEWFDFTDPT---HSFFVSDFTQVDNNVTRN--LQGKL 196
                         DTW  ++ H + DFT  +    ++      ++ +N T N  L  ++
Sbjct: 178 LPMFKDGASDPNRVDTW--MYDHTFEDFTQSSIELDAYVFRHLNELFHNSTLNSTLDYEI 235

Query: 197 FQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLI 256
            Q+    +V  LH LG D  GH   P+S       + +D  +  + D+V +  +DD T  
Sbjct: 236 RQD---GNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKTAF 292

Query: 257 CVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQY- 315
               DHGM+  G+HG      T   L+     L+   KP    +N+ P+      +++  
Sbjct: 293 IFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLN---KP---VQNSFPVFDNYTDNWELS 346

Query: 316 ---LDSVQQIDIVPTIAALFGMPIPMNSVG 342
               + V+Q DI   ++ L G+  P NSVG
Sbjct: 347 NIKRNDVKQADIASLMSYLIGVNYPKNSVG 376

>CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa]
           {ON} highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165c sporulation protein
          Length = 921

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 125/315 (39%), Gaps = 35/315 (11%)

Query: 52  PFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITT 111
           P ++L  +V D LR+D  FD +I+H   V +  +    +  +   N  T  +   + + T
Sbjct: 47  PAKRLFLIVGDGLRADTTFD-KITH--PVTKKADYLAPFIRSLVQNNATYGISHTR-MPT 102

Query: 112 GSTPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQHNNTIRFMGDD--------- 156
            S P  + ++    +DV +       +  + DS+   F Q  +T  F   D         
Sbjct: 103 ESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSF---FNQTAHTYSFGSPDILPMFKDGA 159

Query: 157 -------TWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRNLQGKLFQEWAQWD--VAI 207
                   W+  + HE+ DFT  +       F  +D     +   K   +  + D     
Sbjct: 160 SDPNKVDAWM--YGHEYEDFTQSSIELDAYVFRHLDQLFKNSSTDKELDKQIRQDGNAFF 217

Query: 208 LHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLGDHGMNEL 267
           LH LG D  GH   P+S         +D  ++ +  QV E   D+DT      DHGM+  
Sbjct: 218 LHLLGCDTAGHSYRPYSAEYYDNVIYIDKQVEKLVKQVEEFFGDNDTAFIFTADHGMSAF 277

Query: 268 GNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDSVQQIDIVPT 327
           G+HG      T   L+     L++ V+  +   +    N  L    +  + V+Q DI   
Sbjct: 278 GSHGDGHPNNTRTPLVAWGAGLNRPVRLDTPEFDEYTENWNLANIKR--NDVKQADIAAL 335

Query: 328 IAALFGMPIPMNSVG 342
           ++ L G   P NSVG
Sbjct: 336 MSYLIGTNYPANSVG 350

 Score = 32.0 bits (71), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 11/118 (9%)

Query: 611 AWAIVVISRLVLTKLKVL--DQKYLIRDMKLYITI---LLILQTSSQNIGLFI----VFQ 661
            WAI+VIS  ++  L  L  +  Y +R + +Y+T     +IL  S + +  FI    + Q
Sbjct: 691 GWAILVISLTIMPFLHYLKPNNNYQVRLLTIYLTFAPSFIILSISFEALFYFIFTAYIVQ 750

Query: 662 ILQ--SQICYFFQNFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSISTIDLGNAYH 717
            LQ    I        S S+  ++    ++   LQ  +FF  G   SIS+  L + Y 
Sbjct: 751 WLQIEKNIKVLKDEQKSDSNGIQLLRVAIIGFFLQQIAFFGTGNVASISSFSLDSVYR 808

>Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 130/328 (39%), Gaps = 61/328 (18%)

Query: 52  PFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKS--- 108
           P ++L  +V D LR+D  FD +++H              G T F  P   +L    +   
Sbjct: 47  PAKRLFLIVGDGLRADTTFD-KVTH-----------PVTGKTEFLAPFIRSLVMNNATYG 94

Query: 109 -----ITTGSTPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQHNNTIRFMGDD- 156
                + T S P  + ++    +DV +      ++  + DS+   F Q  +T  F   D 
Sbjct: 95  ISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKSNPVDFDSF---FNQSAHTYSFGSPDI 151

Query: 157 ---------------TWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRN--LQGKLFQE 199
                          TW+  + H + DFT  +       F  +D  + RN  L   L  E
Sbjct: 152 LPMFRDGASDPNKVDTWM--YDHTFEDFTQSSIELDAYVFRHLDQ-LFRNSTLNSTLDYE 208

Query: 200 WAQ-WDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICV 258
             Q  +V  LH LG D  GH   P+S       + +D  +  + ++V    +DD T    
Sbjct: 209 IRQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIEKVNRFFADDKTAFVF 268

Query: 259 LGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQY--- 315
             DHGM+  G+HG      T   L+     L+   KP     N+ P+      +++    
Sbjct: 269 TADHGMSAFGSHGDGHPNNTRTPLIAWGAGLN---KP---VHNSYPVFDNYTENWELSNI 322

Query: 316 -LDSVQQIDIVPTIAALFGMPIPMNSVG 342
             + ++Q DI   ++ L G+  P NSVG
Sbjct: 323 KRNDIKQADIASLMSYLIGVNYPKNSVG 350

>Suva_11.58 Chr11 complement(123117..125876) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 128/324 (39%), Gaps = 53/324 (16%)

Query: 52  PFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKS--- 108
           P ++L  +V D LR+D  FD +++H              G T F  P   +L    +   
Sbjct: 47  PAKRLFLIVGDGLRADTTFD-KVTH-----------PVTGKTEFLAPFIRSLVMNNATYG 94

Query: 109 -----ITTGSTPSFIDLLLNVAQDVDS------NDLSEHDSWLQQFIQHNNTIRFMGD-- 155
                + T S P  + ++    +DV +      ++  + DS+   F Q  +T  F     
Sbjct: 95  ISHTRMPTESRPGHVAMIAGFYEDVSAVTKGWKSNPVDFDSF---FNQSTHTYSFGSPDI 151

Query: 156 --------------DTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRN--LQGKLFQE 199
                         D W  ++ H + DFT  +       F  +D  + RN  L   L  E
Sbjct: 152 LPMFKDGASDPNKVDAW--MYDHTFEDFTQSSIELDAYVFKHLD-QLFRNSTLNSTLDYE 208

Query: 200 WAQ-WDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICV 258
             Q  +V  LH LG D  GH   P+S       + +D  + T+ ++V +   DD T    
Sbjct: 209 IRQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPTLIEKVNKFFDDDKTAFVF 268

Query: 259 LGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGTLDRDFQYLDS 318
             DHGM+  G+HG      T   L+     L++ V  +    +    N  L    +  + 
Sbjct: 269 TADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVHTSYPVFDNYTENWELSSIKR--ND 326

Query: 319 VQQIDIVPTIAALFGMPIPMNSVG 342
           V+Q DI   ++ L G+  P NSVG
Sbjct: 327 VKQADIASLMSYLIGVNYPKNSVG 350

>TPHA0A02800 Chr1 complement(603610..606372) [2763 bp, 920 aa] {ON}
           Anc_1.184 YKL165C
          Length = 920

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 124/326 (38%), Gaps = 57/326 (17%)

Query: 52  PFQKLVFVVIDALRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANP---------PTVT 102
           P ++L  +V D LR+D  FD            L T    G T++  P          T  
Sbjct: 47  PAKRLFLIVGDGLRADTTFD------------LITHPVSGETAYLAPYIRSIVLNNGTYG 94

Query: 103 LPRLKSITTGSTPSFIDLLLNVAQDVD--SNDLSEHDSWLQQFIQHNNTIRFMGD----- 155
           +   + + T S P  + ++    +DV   +    E+      F    N     G      
Sbjct: 95  ISHTR-MPTESRPGHVAMIAGFYEDVSAVTKGWKENPVNFDSFFNQTNHTYSFGSPDILP 153

Query: 156 ------------DTWLKLFPHEWFDFTDPTHSFFVSDFTQVDNNVTRN--LQGKLFQEWA 201
                       D W  ++ HE+ DF+  +       F  V N + +N  L   L ++  
Sbjct: 154 MFKQGASDPNKIDAW--MYGHEFEDFSQSSLELDAFVFDHV-NELFKNATLDSDLNEQIK 210

Query: 202 Q-WDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEHESDDDTLICVLG 260
           Q  +   LH LG D  GH   P+S       + +D  +  + ++V +   DD T      
Sbjct: 211 QDGNCFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDMQISQLVEKVNDFFGDDQTAFVFTA 270

Query: 261 DHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPI--NGTLDRDFQYL-- 316
           DHGM+  G+HG      T   L+     ++   KP    ++  PI  N T    F Y+  
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWGAGIN---KP---EKHQYPIVNNYTESWGFDYIKR 324

Query: 317 DSVQQIDIVPTIAALFGMPIPMNSVG 342
           + V+Q DI   ++ L G   P NSVG
Sbjct: 325 NDVKQADIASLMSYLIGTNYPANSVG 350

>TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1040

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 114/274 (41%), Gaps = 62/274 (22%)

Query: 98  PPTVTLPRLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDT 157
           PPT TL R+K IT GS PSFID  +          + E D+ L+Q   +N +I F GD  
Sbjct: 151 PPTDTLQRVKCITGGSVPSFIDTGITFY-----GSMIEEDNILKQMYLNNRSIYFTGDKF 205

Query: 158 WLKLFPHEWFDF-----------------TDPTHSFFVSDFT-----QVDNNVTRNL--- 192
           W  L+   + +F                 T   HS+  S+ +      +D N+ +N+   
Sbjct: 206 WNSLYSKYFQNFKLANNIDDIIDYFQKITTSTNHSYGESNRSSDKPISLDTNLLQNISSI 265

Query: 193 ----QGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYDQVLEH 248
                  +      WD+ I H +       +D  + K    K   ++S L    + +   
Sbjct: 266 PTISNATVTTPSKDWDILIGHIM-------EDTMNEKVTQLK---VNSFLNDTINSI--- 312

Query: 249 ESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENALPINGT 308
             D+DTL+ VLGD+  +   NH          GL   + K   F       +N L     
Sbjct: 313 --DNDTLLLVLGDY--STANNH------MLDTGLFMYTKKFKNF----WNLQNHLG-EYN 357

Query: 309 LDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVG 342
           +D   +    + Q D+VP+++ L G+PIP N++G
Sbjct: 358 VDNFGENYRVIDQFDVVPSLSLLLGLPIPFNNLG 391

>Kpol_1044.18 s1044 complement(37667..40735) [3069 bp, 1022 aa] {ON}
           complement(37667..40735) [3069 nt, 1023 aa]
          Length = 1022

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 111/249 (44%), Gaps = 43/249 (17%)

Query: 202 QWDVAILHYLGLDHIGHKDGPHSKFMSTKH----QEMDSILKTIYDQVLEHESDDDTLIC 257
           +W+V I H  GL        PH + + T      +    I K I D  L+   D+DTL+ 
Sbjct: 252 KWEVLIGHLYGLK-------PHDENLETNDPSILRNQIEIDKLITD--LKKSMDNDTLLM 302

Query: 258 VLGDHGMNELGNHGGSSAG--ETSAGLLFL---SPKLSQFVKPASQAENALPINGTLDRD 312
           V+        GN   S+    + +  +L+L    P L  +    S A+N+  I G  +  
Sbjct: 303 VVS-------GNSKFSTKDVIKNNKNILYLYSNVPNLWNY----SVADNSNLIIGKDNST 351

Query: 313 FQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMKENFMHLWRL--- 369
            +Y  ++ ++DI+P+I+ L  +P+P++S+G+ IP+      +    +  N + +  L   
Sbjct: 352 LKY-SNIDKVDIIPSISLLLDLPLPVDSLGLFIPELANSEEHFNTYLNVNKLQIQYLLKN 410

Query: 370 -----SDHQEEVVLDDLDIGDIYSKMHDIQETLTKS----ATNYNYPLLSLAFASFLIIT 420
                +D  E ++   L     Y      Q+ +  S     T ++Y  LS+   SFLII+
Sbjct: 411 KKVITNDSTEYILYPVLPENSDYLSWKKFQQKILTSYKGFKTVFDYWYLSIG-VSFLIIS 469

Query: 421 IIATYQLQR 429
           +I  + + +
Sbjct: 470 LILLFSMTK 478

>KAFR0G03760 Chr7 (770672..771985) [1314 bp, 437 aa] {ON} Anc_3.505
           YGR141W
          Length = 437

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 10/93 (10%)

Query: 105 RLKSITTGSTPSFIDLLLNVAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPH 164
           +++SI   +    +  +LN  Q  DSN    +DS++ Q++  N  I  + DD     FP 
Sbjct: 31  KIRSIEDPNNEDSLPFILNAKQVNDSNKSLVNDSYIPQYVLENAPIVHLSDDEL--YFPQ 88

Query: 165 ------EWFDFTDPTHSFFVSDFT--QVDNNVT 189
                 E F  TD +++  + D T  Q++N  T
Sbjct: 89  DIETYIENFKVTDESNNTILEDLTLQQLENTFT 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 87,069,006
Number of extensions: 3862134
Number of successful extensions: 14103
Number of sequences better than 10.0: 78
Number of HSP's gapped: 14090
Number of HSP's successfully gapped: 85
Length of query: 830
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 712
Effective length of database: 39,950,811
Effective search space: 28444977432
Effective search space used: 28444977432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 70 (31.6 bits)