Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.96.12ON73733923e-51
YEL059C-A (SOM1)6.12ON74733482e-44
Smik_5.286.12ON74733319e-42
Skud_5.306.12ON74733171e-39
KLLA0D00880g6.12ON71731685e-17
Ecym_30156.12ON70741512e-14
KLTH0C11484g6.12ON89731434e-13
SAKL0E00924g6.12ON97801402e-12
Kwal_56.223596.12ON91731392e-12
Kpol_1032.36.12ON78801364e-12
ACR014C6.12ON70731321e-11
TDEL0G045906.12ON74771322e-11
TPHA0M002206.12ON78781286e-11
KNAG0E009306.12ON109641161e-08
ZYRO0F00528g6.12ON77771071e-07
NCAS0F002106.12ON79761026e-07
KAFR0L003506.12ON7156760.005
Suva_2.6315.576ON326663660.41
NOTE: 1 genes in the same pillar as Suva_5.9 were not hit in these BLAST results
LIST: TBLA0G00990

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.9
         (73 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...   155   3e-51
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...   138   2e-44
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...   132   9e-42
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...   126   1e-39
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    69   5e-17
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    63   2e-14
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    60   4e-13
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    59   2e-12
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    58   2e-12
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    57   4e-12
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    55   1e-11
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    55   2e-11
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    54   6e-11
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    49   1e-08
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    46   1e-07
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    44   6e-07
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    34   0.005
Suva_2.631 Chr2 (1121570..1131370) [9801 bp, 3266 aa] {ON} YDR45...    30   0.41 

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score =  155 bits (392), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 73/73 (100%), Positives = 73/73 (100%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60
          MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60

Query: 61 AATNYEVTDTYTN 73
          AATNYEVTDTYTN
Sbjct: 61 AATNYEVTDTYTN 73

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score =  138 bits (348), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 69/73 (94%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60
          MAPPTTIR RDQALAPLATLDS+T+C LKELVQWECQFKGA+YVCSPF+RLFEHC AP +
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60

Query: 61 AATNYEVTDTYTN 73
          +ATNYEVTDTYTN
Sbjct: 61 SATNYEVTDTYTN 73

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score =  132 bits (331), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 64/73 (87%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60
          MAPPTTIR+RDQALAPL  LDS+  C LKELVQWECQFKGADYVCSPF+RLFEHC   G+
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60

Query: 61 AATNYEVTDTYTN 73
           ATNYEVTDTYTN
Sbjct: 61 PATNYEVTDTYTN 73

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score =  126 bits (317), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 64/73 (87%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60
          MAPPTTIR+RDQALAPLA LDS T C LKELVQWECQF+ ADYVC PF+RLFE C AP +
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60

Query: 61 AATNYEVTDTYTN 73
          +AT+YEVTDTYTN
Sbjct: 61 SATDYEVTDTYTN 73

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 69.3 bits (168), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60
          MAPPT I   D        L    +C LK LVQ EC F G DYVC+PF+RLFE C     
Sbjct: 1  MAPPTKILGLD---TQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDG 57

Query: 61 AATNYEVTDTYTN 73
             N EVT+  TN
Sbjct: 58 RVLNIEVTNLNTN 70

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 62.8 bits (151), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTH-CHLKELVQWECQFKGADYVCSPFRRLFEHCTAPG 59
          MAPPT I  RD+    L    SRT  C L  L+Q EC F G +YVC PF+RLFE CT   
Sbjct: 1  MAPPTPIITRDEVEPIL----SRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTL-N 55

Query: 60 EAATNYEVTDTYTN 73
          +     EVTD  TN
Sbjct: 56 KRRVRIEVTDISTN 69

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 59.7 bits (143), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60
          MAPPT +  +++         +   C LK LVQ EC+F G +YVC+PF+RLF+ C A G+
Sbjct: 1  MAPPTLVFGKEELKGIWE--KAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGA-GK 57

Query: 61 AATNYEVTDTYTN 73
               EVTD  TN
Sbjct: 58 RIVRIEVTDQDTN 70

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 58.5 bits (140), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 45/80 (56%), Gaps = 9/80 (11%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHC----- 55
          MAPPT +  +D+  + L  +  +  C LK L+Q EC F G +Y+C PF+RLF+ C     
Sbjct: 1  MAPPTPVFGKDELESLLKKV--KPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSK 58

Query: 56 TAPGEAA--TNYEVTDTYTN 73
          T  G  +     E+TD +TN
Sbjct: 59 TKDGRTSRTVRIEITDRHTN 78

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 58.2 bits (139), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60
          MAPPT +  +++ L PL   +    C  K L Q EC F G  YVC PF+R+F+ C   G+
Sbjct: 1  MAPPTVVFGKEE-LEPLLR-NVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGK 58

Query: 61 AATNYEVTDTYTN 73
           +   EVTD  TN
Sbjct: 59 -SIRIEVTDRNTN 70

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 57.0 bits (136), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 12/80 (15%)

Query: 1  MAPPTTIRARDQALAPLATL----DSRTHCHLKELVQWECQFKGA---DYVCSPFRRLFE 53
          MAPPT I++R++ L     L    + +  C L  + Q++C+F+ +   +Y+C PF+RLFE
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 54 HCTAPGEAATNYEVTDTYTN 73
           C     +    EVTD +TN
Sbjct: 61 EC-----SGIRIEVTDRFTN 75

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 55.5 bits (132), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 40/73 (54%), Gaps = 4/73 (5%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60
          MAPPT +  R++    LAT  SR  C L  L Q EC F G  YVC PF+RLF  CT   +
Sbjct: 1  MAPPTPVLTREEVAPALAT--SR-DCVLASLTQNECHFDGRGYVCVPFQRLFRECTL-NK 56

Query: 61 AATNYEVTDTYTN 73
               E+T+  TN
Sbjct: 57 RRVRIEITERNTN 69

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 55.5 bits (132), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 42/77 (54%), Gaps = 8/77 (10%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGAD---YVCSPFRRLFEHCTA 57
          MAPPT + AR++    L  +    +C LK L Q++CQ + A    Y C PF+RLF+ C  
Sbjct: 1  MAPPTPVLAREE----LPEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRD 56

Query: 58 P-GEAATNYEVTDTYTN 73
          P G   +  EVT   TN
Sbjct: 57 PSGRFKSRIEVTSPLTN 73

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 53.9 bits (128), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 42/78 (53%), Gaps = 10/78 (12%)

Query: 1  MAPPTTIRARDQALAPL--ATLDSRTHCHLKELVQWECQF---KGADYVCSPFRRLFEHC 55
          MAP T +  R+   A L  +   +R  C LK L Q+ECQF   +   Y+C PF+RLFE C
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

Query: 56 TAPGEAATNYEVTDTYTN 73
               A T+YE T   TN
Sbjct: 61 -----AGTSYETTAQPTN 73

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 49.3 bits (116), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60
          MAP   +  R+    P      +  C LKELVQ+ C+  G  + C+PFRRLFE C  P +
Sbjct: 1  MAPNVRVLTRNDVPLP----QPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC--PSQ 54

Query: 61 AATN 64
            TN
Sbjct: 55 EGTN 58

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 45.8 bits (107), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 1  MAPPTTIRARDQALAP---LATLDSRTHCHLKELVQWECQFKG-ADYVCSPFRRLFEHCT 56
          MAPPT I   +Q       +  L  +  C LK L Q  C  +   +Y+C PF+R+FE C 
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60

Query: 57 APGEAATNYEVTDTYTN 73
            G A    EVTD  TN
Sbjct: 61 --GHA---LEVTDADTN 72

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 43.9 bits (102), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 10/76 (13%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTH---------CHLKELVQWECQF-KGADYVCSPFRR 50
          MAPP  +  +D      A  ++RT          C   +L Q++CQ  +   Y+C PF+R
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQYICFPFKR 60

Query: 51 LFEHCTAPGEAATNYE 66
          +F+ C       TN +
Sbjct: 61 VFQECQGVRTEVTNVD 76

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 33.9 bits (76), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFK-GADYVCSPFRRLFEHC 55
          MAP   +   D A   +   +    C L  LVQ+ C+++ G    C PF+R+F  C
Sbjct: 1  MAPMIRVMDGDAAEREVKGAEG---CQLYSLVQYNCEYRVGGTLECFPFKRMFLEC 53

>Suva_2.631 Chr2 (1121570..1131370) [9801 bp, 3266 aa] {ON} YDR457W
            (REAL)
          Length = 3266

 Score = 30.0 bits (66), Expect = 0.41,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 12/63 (19%)

Query: 12   QALAPLATLDSRTHCHLKEL--VQWECQFKGADYVCSPFRR--LFEHCTAPGEAATNYEV 67
            Q L+ L  + +  + H KEL  + W       D V  P R+  LFE    PG+ A NY +
Sbjct: 1171 QLLSMLKNVFTTVNIHTKELYELHW-------DLVFPPIRKINLFEQVDIPGDVAANY-L 1222

Query: 68   TDT 70
            T+T
Sbjct: 1223 TET 1225

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.132    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,422,924
Number of extensions: 220557
Number of successful extensions: 310
Number of sequences better than 10.0: 18
Number of HSP's gapped: 304
Number of HSP's successfully gapped: 18
Length of query: 73
Length of database: 53,481,399
Length adjustment: 45
Effective length of query: 28
Effective length of database: 48,321,429
Effective search space: 1353000012
Effective search space used: 1353000012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)